Calcium-activated potassium channel slo-1, putative

Overview
NameCalcium-activated potassium channel slo-1, putative
Smed IDSMED30001493
Length (bp)3071
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-activated potassium channel slo-1, putative (SMED30001493) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-activated potassium channel slo-1, putative (SMED30001493) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-activated potassium channel slo-1, putative (SMED30001493) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-activated potassium channel slo-1, putative (SMED30001493) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001493

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30001493SMESG000014623.1 dd_Smed_v4_13498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001493SMESG000014623.1 dd_Smed_v4_13498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001493SMESG000014623.1 dd_Smed_v4_13498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30001493SMESG000014623.1 dd_Smed_v4_13498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 447.973 bits (1151), Expect = 4.983e-142
Identity = 242/672 (36.01%), Postives = 386/672 (57.44%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVK-----MRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K      R+ K + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   + ++L+ K +Q          TS +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:   26 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 682          

HSP 2 Score: 79.337 bits (194), Expect = 4.983e-142
Identity = 91/310 (29.35%), Postives = 150/310 (48.39%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D
Sbjct:  680 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTD 977          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 447.588 bits (1150), Expect = 5.369e-142
Identity = 241/668 (36.08%), Postives = 386/668 (57.78%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  N ++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   + ++L+ K +Q          TS +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  165 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 817          

HSP 2 Score: 79.7221 bits (195), Expect = 5.369e-142
Identity = 91/312 (29.17%), Postives = 151/312 (48.40%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSV 2977
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +
Sbjct:  815 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLI 1114          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 447.588 bits (1150), Expect = 5.738e-142
Identity = 241/668 (36.08%), Postives = 386/668 (57.78%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  N ++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   + ++L+ K +Q          TS +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  209 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 861          

HSP 2 Score: 79.337 bits (194), Expect = 5.738e-142
Identity = 91/312 (29.17%), Postives = 151/312 (48.40%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSV 2977
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +
Sbjct:  859 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLI 1158          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 447.588 bits (1150), Expect = 5.738e-142
Identity = 242/672 (36.01%), Postives = 386/672 (57.44%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVK-----MRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K      R+ K + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   + ++L+ K +Q          TS +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  165 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 821          

HSP 2 Score: 79.337 bits (194), Expect = 5.738e-142
Identity = 91/312 (29.17%), Postives = 151/312 (48.40%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSV 2977
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +
Sbjct:  819 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLI 1118          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 447.588 bits (1150), Expect = 5.834e-142
Identity = 241/668 (36.08%), Postives = 386/668 (57.78%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  N ++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   + ++L+ K +Q          TS +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  165 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 817          

HSP 2 Score: 79.337 bits (194), Expect = 5.834e-142
Identity = 91/312 (29.17%), Postives = 151/312 (48.40%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSV 2977
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +
Sbjct:  815 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLI 1114          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 469.544 bits (1207), Expect = 1.439e-151
Identity = 269/701 (38.37%), Postives = 405/701 (57.77%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNS--WINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK--TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSR---------------------QQFQYAVLDKAE----------------KEIDFLK-------------------CDYKDFKESLIKNPLEPIKFSN-HIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W  + ISGQ+ TG+ +V +  + +  ++  Y Y+A++   Q+E C I ++ +    IDL    FF  Y+ IRF+AA +K+ F   +YS +D  TIP  FV IYL   W+G RFLRA+ LM VPD+LQYL +LK+++  RL QL T+F+ + + G+G+ H+LEN+GD +    +N    +T+ DS+YF +VTMSTVGYGDI   +  G++++  FIL   A+FAS++PEIA+++ +  KY G Y  +   KHIVVCG+  + S+  F+ DF +EDR    + VVF+++  PD EL  L K +F + +F  GTVMD +DL R  I +ADAC +LAN    NP  EDAANIMRVIS+KN+SS +RV++QL+QY NK+YL NIP+W+  +GD V+C +E++L  +A+SCL PG+ST ++NLF++RS      F+ S  +  W+N Y+ G G+E+YT  LS S +GMTF + V   +  L LLL+A+E+K    K   + INP        +T G+FI  S  E +R   +C  CH   +   L     KC C N +A      + ++   +R                     QQ Q  ++++                  + +DF K                   C  ++ ++ +++     +   N H+++C+FAD DSP IGL+NFI+PLRS    +  LK
Sbjct:  126 WAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETC-IPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGD-FFKGFINPHR-ITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS------FKTSQTTPDWLNLYLCGAGMEMYTDTLSHSFVGMTFPEAVDLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIK---KCKCKN-LALFRRNTKHSTAARARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQRPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELK 813          

HSP 2 Score: 88.1965 bits (217), Expect = 1.439e-151
Identity = 88/306 (28.76%), Postives = 151/306 (49.35%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXX----------------------XXXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQ 2989
            +L+ ++I  + E+L +EW++L   P +  ++ + +++  L  + +  C +CVI+SARV        D  L DKE IL +LN+K++                          +QKK       +P   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN     +I  L+ G      E+   E         +    +N  +C+I   +L D+ +     NT    Y  +FT A + Y  L +GLY++ +        S K+ ++TNP  E  +   D V  L+
Sbjct:  811 ELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTE----DTTLADKEAILASLNIKAMQFDDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVP---MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVVHNTT---YGAMFTIALRRYGQLCIGLYRLHDQDN---PDSMKRYVITNPPAELRIKNTDYVYVLE 1103          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 468.389 bits (1204), Expect = 3.563e-151
Identity = 267/701 (38.09%), Postives = 405/701 (57.77%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNS--WINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK--TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSR---------------------QQFQYAVLDKAE----------------KEIDFLK-------------------CDYKDFKESLIKNPLEPIKFSN-HIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W  + ISGQ+ TG+ +V +  + +  ++  Y Y+A++   Q+E C I ++ +    IDL    FF  Y+ IRF+AA +K+ F   +YS +D  TIP  FV IYL   W+G RFLRA+ LM VPD+LQYL +LK+++  RL QL T+F+ + + G+G+ H+LEN+GD +    +N    +T+ DS+YF +VTMSTVGYGDI   +  G++++  FIL   A+FAS++PEIA+++ +  KY G Y  +   KHIVVCG+  + S+  F+ DF +EDR    + VVF+++  PD EL  L K +F + +F  GTVMD +DL R  I +ADAC +LAN    NP  EDAANIMRVIS+KN+SS +RV++QL+QY NK+YL NIP+W+  +GD V+C +E++L  +A+SCL PG+ST ++NLF++RS      F+ S ++  W+NDY+ G G+E+YT +LS S   M+F +     +  L LLL+A+E+K    K   + INP        +T G+FI  S  E +R   +C  CH   +   L     KC C N +A      + ++   +R                     QQ Q  ++++                  + +DF K                   C  ++ ++ +++     +   N H+++C+FAD DSP IGL+NFI+PLRS    +  LK
Sbjct:  126 WAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETC-IPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGD-FFKGFINPHR-ITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS------FKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIK---KCKCKN-LALFRRNTKHSTAARARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQRPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELK 813          

HSP 2 Score: 88.1965 bits (217), Expect = 3.563e-151
Identity = 88/306 (28.76%), Postives = 151/306 (49.35%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXX----------------------XXXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQ 2989
            +L+ ++I  + E+L +EW++L   P +  ++ + +++  L  + +  C +CVI+SARV        D  L DKE IL +LN+K++                          +QKK       +P   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN     +I  L+ G      E+   E         +    +N  +C+I   +L D+ +     NT    Y  +FT A + Y  L +GLY++ +        S K+ ++TNP  E  +   D V  L+
Sbjct:  811 ELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTE----DTTLADKEAILASLNIKAMQFDDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVP---MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVVHNTT---YGAMFTIALRRYGQLCIGLYRLHDQDN---PDSMKRYVITNPPAELRIKNTDYVYVLE 1103          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 446.432 bits (1147), Expect = 7.613e-139
Identity = 245/577 (42.46%), Postives = 360/577 (62.39%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNS--WINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK--TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSR-----QQFQ 1956
            W  + ISGQ+ TG+ +V +  + +  ++  Y Y+A++   Q+E C I ++ +    IDL    FF  Y+ IRF+AA +K+ F   +YS +D  TIP  FV IYL   W+G RFLRA+ LM VPD+LQYL +LK+++  RL QL T+F+ + + G+G+ H+LEN+GD +    +N    +T+ DS+YF +VTMSTVGYGDI   +  G++++  FIL   A+FAS++PEIA+++ +  KY G Y  +   KHIVVCG+  + S+  F+ DF +EDR    + VVF+++  PD EL  L K +F + +F  GTVMD +DL R  I +ADAC +LAN    NP  EDAANIMRVIS+KN+SS +RV++QL+QY NK+YL NIP+W+  +GD V+C +E++L  +A+SCL PG+ST ++NLF++RS      F+ S  +  W+N Y+ G G+E+YT  LS S +GMTF + V   +  L LLL+A+E+K    K   + INP        +T G+FI  S  E +R   +C  CH   +   L     KC C N +A      + ++   +R     QQFQ
Sbjct:  126 WAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETC-IPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGD-FFKGFINPHR-ITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS------FKTSQTTPDWLNLYLCGAGMEMYTDTLSHSFVGMTFPEAVDLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIK---KCKCKN-LALFRRNTKHSTAARARATDVLQQFQ 689          

HSP 2 Score: 88.1965 bits (217), Expect = 1.112e-26
Identity = 88/306 (28.76%), Postives = 151/306 (49.35%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXX----------------------XXXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQ 2989
            +L+ ++I  + E+L +EW++L   P +  ++ + +++  L  + +  C +CVI+SARV        D  L DKE IL +LN+K++                          +QKK       +P   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN     +I  L+ G      E+   E         +    +N  +C+I   +L D+ +     NT    Y  +FT A + Y  L +GLY++ +        S K+ ++TNP  E  +   D V  L+
Sbjct:  833 ELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTE----DTTLADKEAILASLNIKAMQFDDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVP---MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVVHNTT---YGAMFTIALRRYGQLCIGLYRLHDQDN---PDSMKRYVITNPPAELRIKNTDYVYVLE 1125          

HSP 3 Score: 52.373 bits (124), Expect = 1.112e-26
Identity = 28/77 (36.36%), Postives = 43/77 (55.84%), Query Frame = 1
Query: 1945 QQFQYAVLDKAEKEIDFLKCDYKDFKESLIKNPLEPIKFSN-HIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            QQFQ    D       F  C  ++ ++ +++     +   N H+++C+FAD DSP IGL+NFI+PLRS    +  LK
Sbjct:  762 QQFQDMKYDSTGM---FHWCPSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELK 835          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 445.662 bits (1145), Expect = 1.305e-138
Identity = 249/600 (41.50%), Postives = 368/600 (61.33%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNS--WINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK--TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKESLIKN 2040
            W  + ISGQ+ TG+ +V +  + +  ++  Y Y+A++   Q+E C I ++ +    IDL    FF  Y+ IRF+AA +K+ F   +YS +D  TIP  FV IYL   W+G RFLRA+ LM VPD+LQYL +LK+++  RL QL T+F+ + + G+G+ H+LEN+GD +    +N    +T+ DS+YF +VTMSTVGYGDI   +  G++++  FIL   A+FAS++PEIA+++ +  KY G Y  +   KHIVVCG+  + S+  F+ DF +EDR    + VVF+++  PD EL  L K +F + +F  GTVMD +DL R  I +ADAC +LAN    NP  EDAANIMRVIS+KN+SS +RV++QL+QY NK+YL NIP+W+  +GD V+C +E++L  +A+SCL PG+ST ++NLF++RS      F+ S  +  W+N Y+ G G+E+YT  LS S +GMTF + V   +  L LLL+A+E+K    K   + INP        +T G+FI  S  E +R   +C  CH          D  K V      SL +K +  +  L R+  +++    A +E +    DY DF     +N
Sbjct:  126 WAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETC-IPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGD-FFKGFINPHR-ITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS------FKTSQTTPDWLNLYLCGAGMEMYTDTLSHSFVGMTFPEAVDLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCH----------DDIKDV------SLIKKCKCKNLALFRRNTKHST---AAREKNAKISDYSDFDALFYQN 697          

HSP 2 Score: 88.1965 bits (217), Expect = 1.280e-26
Identity = 88/306 (28.76%), Postives = 151/306 (49.35%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXX----------------------XXXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQ 2989
            +L+ ++I  + E+L +EW++L   P +  ++ + +++  L  + +  C +CVI+SARV        D  L DKE IL +LN+K++                          +QKK       +P   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN     +I  L+ G      E+   E         +    +N  +C+I   +L D+ +     NT    Y  +FT A + Y  L +GLY++ +        S K+ ++TNP  E  +   D V  L+
Sbjct:  831 ELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTE----DTTLADKEAILASLNIKAMQFDDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVP---MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVVHNTT---YGAMFTIALRRYGQLCIGLYRLHDQDN---PDSMKRYVITNPPAELRIKNTDYVYVLE 1123          

HSP 3 Score: 52.373 bits (124), Expect = 1.280e-26
Identity = 28/77 (36.36%), Postives = 43/77 (55.84%), Query Frame = 1
Query: 1945 QQFQYAVLDKAEKEIDFLKCDYKDFKESLIKNPLEPIKFSN-HIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            QQFQ    D       F  C  ++ ++ +++     +   N H+++C+FAD DSP IGL+NFI+PLRS    +  LK
Sbjct:  760 QQFQDMKYDSTGM---FHWCPSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELK 833          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 445.662 bits (1145), Expect = 2.049e-138
Identity = 249/600 (41.50%), Postives = 368/600 (61.33%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNS--WINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK--TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKESLIKN 2040
            W  + ISGQ+ TG+ +V +  + +  ++  Y Y+A++   Q+E C I ++ +    IDL    FF  Y+ IRF+AA +K+ F   +YS +D  TIP  FV IYL   W+G RFLRA+ LM VPD+LQYL +LK+++  RL QL T+F+ + + G+G+ H+LEN+GD +    +N    +T+ DS+YF +VTMSTVGYGDI   +  G++++  FIL   A+FAS++PEIA+++ +  KY G Y  +   KHIVVCG+  + S+  F+ DF +EDR    + VVF+++  PD EL  L K +F + +F  GTVMD +DL R  I +ADAC +LAN    NP  EDAANIMRVIS+KN+SS +RV++QL+QY NK+YL NIP+W+  +GD V+C +E++L  +A+SCL PG+ST ++NLF++RS      F+ S  +  W+N Y+ G G+E+YT  LS S +GMTF + V   +  L LLL+A+E+K    K   + INP        +T G+FI  S  E +R   +C  CH          D  K V      SL +K +  +  L R+  +++    A +E +    DY DF     +N
Sbjct:  126 WAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETC-IPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGD-FFKGFINPHR-ITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS------FKTSQTTPDWLNLYLCGAGMEMYTDTLSHSFVGMTFPEAVDLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCH----------DDIKDV------SLIKKCKCKNLALFRRNTKHST---AAREKNAKISDYSDFDALFYQN 697          

HSP 2 Score: 88.1965 bits (217), Expect = 1.159e-26
Identity = 88/306 (28.76%), Postives = 151/306 (49.35%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXX----------------------XXXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQ 2989
            +L+ ++I  + E+L +EW++L   P +  ++ + +++  L  + +  C +CVI+SARV        D  L DKE IL +LN+K++                          +QKK       +P   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN     +I  L+ G      E+   E         +    +N  +C+I   +L D+ +     NT    Y  +FT A + Y  L +GLY++ +        S K+ ++TNP  E  +   D V  L+
Sbjct:  853 ELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTE----DTTLADKEAILASLNIKAMQFDDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVP---MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVVHNTT---YGAMFTIALRRYGQLCIGLYRLHDQDN---PDSMKRYVITNPPAELRIKNTDYVYVLE 1145          

HSP 3 Score: 52.373 bits (124), Expect = 1.159e-26
Identity = 28/77 (36.36%), Postives = 43/77 (55.84%), Query Frame = 1
Query: 1945 QQFQYAVLDKAEKEIDFLKCDYKDFKESLIKNPLEPIKFSN-HIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            QQFQ    D       F  C  ++ ++ +++     +   N H+++C+FAD DSP IGL+NFI+PLRS    +  LK
Sbjct:  782 QQFQDMKYDSTGM---FHWCPSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELK 855          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0301582)

HSP 1 Score: 475.322 bits (1222), Expect = 6.790e-149
Identity = 244/562 (43.42%), Postives = 355/562 (63.17%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGN--SWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRN---GKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCH-GANEGTPLRVDKFKCVCINKVASLNEKIR 1920
            W  + ISGQ TTG+I+V +  + +  ++  Y  +A+    ++ERC   +       IDL    FF  Y+ IRF+AA +K+ F   +YS VD  TIP  FV IYLD  W+GLRFLRA+ LM VPD+LQYL VLK+++  RL QL ++FI +W+  +G+ H+LEN+GD     + N+ + L++   +YF IVTMSTVGYGD+   + LG+ ++  F+LV  A+FAS+IPEI E+    SKY G+Y      +HIVVCG+  + S+  F+ DF +EDR    + VVF++++EPD EL  LLK ++    F +GT+M+ VDL+R  + EADAC +LAN  C++P  EDAANIMRVIS+KN+S  +RV+IQL+QY NK+YL NIP+W+  +GD V+C +E++L  +A+SCL PG+ST ++NLF++RS      F+ S +  SW NDY+ G G+E+YT  LS + IG+ F       +  L LLL+A+E+K         + INP   +     T G+FI  S  E +R   YC  CH    + T ++    KC C N +A+  + +R
Sbjct:   97 WAGELISGQTTTGRILVVLVFILSIASLIIYFVDASS--EEVERCQ-KWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPL---DFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAVFASWIPEITELAAQRSKYGGTYSKDPRKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKEPDLELEGLLKRHYTTVAFFQGTMMNAVDLERVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS------FKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRG-AKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIK----KCKCKN-LATFRKGVR 640          

HSP 2 Score: 92.8189 bits (229), Expect = 2.164e-26
Identity = 90/304 (29.61%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXXXXXXXXXEI---------------------PNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+ ++I  + +++ REW+ L   P +  ++ + +++  L  + V  C +C I+SA+V     +N D  L DKE IL +LN+K++           +  E                       N  +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN +   +I  LI G      E+   E         +    +N  +C++   +L+D      F    +  Y +LF  A K Y +L +GLY+  +T+ +  +SSK+ VI TNP  +FS+   D V  L
Sbjct:  874 ELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKV----PSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQ-FGECGK--YGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVI-TNPPDDFSLLPTDQVFVL 1169          

HSP 3 Score: 46.9802 bits (110), Expect = 2.164e-26
Identity = 17/38 (44.74%), Postives = 27/38 (71.05%), Query Frame = 1
Query: 2059 FSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
             + H+++C+FAD DSP IGL+N ++PLR+    +  LK
Sbjct:  839 LNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELK 876          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0330286)

HSP 1 Score: 473.396 bits (1217), Expect = 3.312e-148
Identity = 244/555 (43.96%), Postives = 349/555 (62.88%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGN--SWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRN---GKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCH-GANEGTPLRVDKFKCVCINKVA 1899
            W  + ISGQ TTG+I+V +  + +  ++  Y  +A+    ++ERC   +       IDL    FF  Y+ IRF+AA +K+ F   +YS VD  TIP  FV IYLD  W+GLRFLRA+ LM VPD+LQYL VLK+++  RL QL ++FI +W+  +G+ H+LEN+GD     + N+ + L++   +YF IVTMSTVGYGD+   + LG+ ++  F+LV  A+FAS+IPEI E+    SKY G+Y      +HIVVCG+  + S+  F+ DF +EDR    + VVF++++EPD EL  LLK ++    F +GT+M+ VDL+R  + EADAC +LAN  C++P  EDAANIMRVIS+KN+S  +RV+IQL+QY NK+YL NIP+W+  +GD V+C +E++L  +A+SCL PG+ST ++NLF++RS      F+ S +  +W NDY+ G G E+YT  LS S  GMTF       +  L LLL+A+E+K         + INP   +     T G+FI  S  E +R   YC  CH    + T ++    KC C N V 
Sbjct:   97 WAGELISGQTTTGRILVVLVFILSIASLIIYFVDASS--EEVERCQ-KWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPL---DFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAVFASWIPEITELAAQRSKYGGTYSKDPRKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKEPDLELEGLLKRHYTTVAFFQGTMMNAVDLERVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS------FKTSPDTQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQASELCFSKLKLLLLAIEIKGAEEGADSKISINPRG-AKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIK----KCKCKNYVG 634          

HSP 2 Score: 92.8189 bits (229), Expect = 2.128e-26
Identity = 90/304 (29.61%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXXXXXXXXXEI---------------------PNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+ ++I  + +++ REW+ L   P +  ++ + +++  L  + V  C +C I+SA+V     +N D  L DKE IL +LN+K++           +  E                       N  +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN +   +I  LI G      E+   E         +    +N  +C++   +L+D      F    +  Y +LF  A K Y +L +GLY+  +T+ +  +SSK+ VI TNP  +FS+   D V  L
Sbjct:  881 ELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKV----PSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQ-FGECGK--YGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVI-TNPPDDFSLLPTDQVFVL 1176          

HSP 3 Score: 47.3654 bits (111), Expect = 2.128e-26
Identity = 17/38 (44.74%), Postives = 27/38 (71.05%), Query Frame = 1
Query: 2059 FSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
             + H+++C+FAD DSP IGL+N ++PLR+    +  LK
Sbjct:  846 LNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELK 883          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100622)

HSP 1 Score: 472.241 bits (1214), Expect = 3.626e-148
Identity = 235/532 (44.17%), Postives = 340/532 (63.91%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGN--SWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRN---GKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCH 1833
            W  + ISGQ TTG+I+V +  + +  ++  Y  +A+    ++ERC   +       IDL    FF  Y+ IRF+AA +K+ F   +YS VD  TIP  FV IYLD  W+GLRFLRA+ LM VPD+LQYL VLK+++  RL QL ++FI +W+  +G+ H+LEN+GD     + N+ + L++   +YF IVTMSTVGYGD+   + LG+ ++  F+LV  A+FAS+IPEI E+    SKY G+Y      +HIVVCG+  + S+  F+ DF +EDR    + VVF++++ PD EL  L K +F   +F +GT+M+ +DL+R  + EADAC +LAN  C++P  EDAANIMRVIS+KN+S  +RV+IQL+QY NK+YL NIP+W+  +GD V+C +E++L  +A+SCL PG+ST ++NLF++RS      F+ S +  SW NDY+ G G+E+YT  LS + IG+ F       +  L LLL+A+E+K         + INP   +     T G+FI  S  E +R   YC  CH
Sbjct:  114 WAGELISGQTTTGRILVVLVFILSIASLIIYFVDAS--SEEVERCQ-KWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPL---DFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAVFASWIPEITELAAQRSKYGGTYSKDPRKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS------FKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRG-AKIQANTQGFFIAQSADEVKRAWFYCKACH 632          

HSP 2 Score: 93.2041 bits (230), Expect = 1.882e-26
Identity = 90/304 (29.61%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXXXXXXXXXEI---------------------PNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+ ++I  + +++ REW+ L   P +  ++ + +++  L  + V  C +C I+SA+V     +N D  L DKE IL +LN+K++           +  E                       N  +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN +   +I  LI G      E+   E         +    +N  +C++   +L+D      F    +  Y +LF  A K Y +L +GLY+  +T+ +  +SSK+ VI TNP  +FS+   D V  L
Sbjct:  839 ELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKV----PSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQ-FGECGK--YGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVI-TNPPDDFSLLPTDQVFVL 1134          

HSP 3 Score: 46.9802 bits (110), Expect = 1.882e-26
Identity = 19/48 (39.58%), Postives = 30/48 (62.50%), Query Frame = 1
Query: 2029 LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            L +N       + H+++C+FAD DSP IGL+N ++PLR+    +  LK
Sbjct:  794 LDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELK 841          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100624)

HSP 1 Score: 471.47 bits (1212), Expect = 7.925e-148
Identity = 237/532 (44.55%), Postives = 342/532 (64.29%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGN--SWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRN---GKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCH 1833
            W  + ISGQ TTG+I+V +  + +  ++  Y  +A+    ++ERC   +       IDL    FF  Y+ IRF+AA +K+ F   +YS VD  TIP  FV IYLD  W+GLRFLRA+ LM VPD+LQYL VLK+++  RL QL ++FI +W+  +G+ H+LEN+GD     + N+ + L++   +YF IVTMSTVGYGD+   + LG+ ++  F+LV  A+FAS IPEI E++ SG+KY G    +   +HIVVCG+  + S+  F+ DF +EDR    + VVF++++EPD EL  LLK ++    F +GT+M+ VDL+R  + EADAC +LAN  C++P  EDAANIMRVIS+KN+S  +RV+IQL+QY NK+YL NIP+W+  +GD V+C +E++L  +A+SCL PG+ST ++NLF++RS      F+ S +  SW NDY+ G G+E+YT  LS + IG+ F       +  L LLL+A+E+K         + INP   +     T G+FI  S  E +R   YC  CH
Sbjct:  114 WAGELISGQTTTGRILVVLVFILSIASLIIYFVDAS--SEEVERCQ-KWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPL---DFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKEPDLELEGLLKRHYTTVAFFQGTMMNAVDLERVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS------FKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRG-AKIQANTQGFFIAQSADEVKRAWFYCKACH 632          

HSP 2 Score: 93.2041 bits (230), Expect = 1.776e-26
Identity = 90/304 (29.61%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXXXXXXXXXEI---------------------PNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+ ++I  + +++ REW+ L   P +  ++ + +++  L  + V  C +C I+SA+V     +N D  L DKE IL +LN+K++           +  E                       N  +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN +   +I  LI G      E+   E         +    +N  +C++   +L+D      F    +  Y +LF  A K Y +L +GLY+  +T+ +  +SSK+ VI TNP  +FS+   D V  L
Sbjct:  839 ELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKV----PSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQ-FGECGK--YGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVI-TNPPDDFSLLPTDQVFVL 1134          

HSP 3 Score: 47.3654 bits (111), Expect = 1.776e-26
Identity = 19/48 (39.58%), Postives = 30/48 (62.50%), Query Frame = 1
Query: 2029 LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            L +N       + H+++C+FAD DSP IGL+N ++PLR+    +  LK
Sbjct:  794 LDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELK 841          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0334294)

HSP 1 Score: 469.544 bits (1207), Expect = 1.855e-147
Identity = 244/563 (43.34%), Postives = 353/563 (62.70%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGN--SWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRN---GKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCH-GANEGTPLRVDKFKCVCINKVASLNEKIRQ 1923
            W  + ISGQ TTG+I+V +  + +  ++  Y  +A+    ++ERC   +       IDL    FF  Y+ IRF+AA +K+ F   +YS VD  TIP  FV IYLD  W+GLRFLRA+ LM VPD+LQYL VLK+++  RL QL ++FI +W+  +G+ H+LEN+GD     + N+ + L++   +YF IVTMSTVGYGD+   + LG+ ++  F+LV  A+FAS IPEI E++ SG+KY G    +   +HIVVCG+  + S+  F+ DF +EDR    + VVF++++ PD EL  L K +F   +F +GT+M+ +DL+R  + EADAC +LAN  C++P  EDAANIMRVIS+KN+S  +RV+IQL+QY NK+YL NIP+W+  +GD V+C +E++L  +A+SCL PG+ST ++NLF++RS      F+ S +  +W NDY+ G G E+YT  LS S  GMTF       +  L LLL+A+E+K         + INP   +     T G+FI  S  E +R   YC  CH    + T ++    KC C N    LN  +R+
Sbjct:   97 WAGELISGQTTTGRILVVLVFILSIASLIIYFVDAS--SEEVERCQ-KWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPL---DFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS------FKTSPDTQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQASELCFSKLKLLLLAIEIKGAEEGADSKISINPRG-AKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIK----KCKCKNL---LNRNVRR 639          

HSP 2 Score: 93.2041 bits (230), Expect = 1.734e-26
Identity = 90/304 (29.61%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXXXXXXXXXEI---------------------PNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+ ++I  + +++ REW+ L   P +  ++ + +++  L  + V  C +C I+SA+V     +N D  L DKE IL +LN+K++           +  E                       N  +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN +   +I  LI G      E+   E         +    +N  +C++   +L+D      F    +  Y +LF  A K Y +L +GLY+  +T+ +  +SSK+ VI TNP  +FS+   D V  L
Sbjct:  799 ELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKV----PSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQ-FGECGK--YGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVI-TNPPDDFSLLPTDQVFVL 1094          

HSP 3 Score: 47.3654 bits (111), Expect = 1.734e-26
Identity = 19/48 (39.58%), Postives = 30/48 (62.50%), Query Frame = 1
Query: 2029 LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            L +N       + H+++C+FAD DSP IGL+N ++PLR+    +  LK
Sbjct:  754 LDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELK 801          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 447.588 bits (1150), Expect = 1.367e-143
Identity = 243/669 (36.32%), Postives = 383/669 (57.25%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVK-----MRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQT----------SFRLSRQQF-------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +G Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++   +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K      R+ K + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  I     ++L+ K +Q           S ++ R          Q   +D   K  D    F  C  K+ ++  L ++       S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:  136 WAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRESRSRKRILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELK 792          

HSP 2 Score: 84.3445 bits (207), Expect = 1.367e-143
Identity = 90/315 (28.57%), Postives = 154/315 (48.89%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+PI+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  +++  +     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +      S   K+ ++TNP  EF +   D +  L
Sbjct:  790 ELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFEMVPTDLIFCL 1092          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 446.047 bits (1146), Expect = 3.932e-143
Identity = 241/665 (36.24%), Postives = 382/665 (57.44%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK-TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQT----------SFRLSRQQF-------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +G Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++   +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K    + ++ INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  I     ++L+ K +Q           S ++ R          Q   +D   K  D    F  C  K+ ++  L ++       S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:  119 WAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELK 771          

HSP 2 Score: 84.3445 bits (207), Expect = 3.932e-143
Identity = 90/315 (28.57%), Postives = 154/315 (48.89%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+PI+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  +++  +     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +      S   K+ ++TNP  EF +   D +  L
Sbjct:  769 ELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFEMVPTDLIFCL 1071          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 446.817 bits (1148), Expect = 6.499e-138
Identity = 241/665 (36.24%), Postives = 382/665 (57.44%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK-TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQT----------SFRLSRQQF-------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +G Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++   +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K    + ++ INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  I     ++L+ K +Q           S ++ R          Q   +D   K  D    F  C  K+ ++  L ++       S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:  136 WAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELK 788          

HSP 2 Score: 59.6918 bits (143), Expect = 1.923e-8
Identity = 58/179 (32.40%), Postives = 98/179 (54.75%), Query Frame = 2
Query: 2480 LITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +      S   K+ ++TNP  EF +   D +  L
Sbjct:  942 MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFEMVPTDLIFCL 1116          

HSP 3 Score: 51.2174 bits (121), Expect = 7.562e-6
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANL-DFHLVDKEIILGTLNV 2410
            +L+PI+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+ D  L DKE IL +LN+
Sbjct:  786 ELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDASLQDKECILASLNI 863          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: CABZ01092907.1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1b [Source:NCBI gene;Acc:798583])

HSP 1 Score: 378.637 bits (971), Expect = 7.762e-121
Identity = 184/462 (39.83%), Postives = 292/462 (63.20%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTF 1638
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +++  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F
Sbjct:    7 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD---PIESCE-HFDKNFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSF 457          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: si:dkey-21e5.1 (si:dkey-21e5.1 [Source:ZFIN;Acc:ZDB-GENE-141210-6])

HSP 1 Score: 132.494 bits (332), Expect = 7.208e-31
Identity = 93/341 (27.27%), Postives = 167/341 (48.97%), Query Frame = 1
Query:  787 LTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPK--EEYKHIVVC-GNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNF--MRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLI-----GMTFYDLVLFSYEYLNLLLIAVEVKMRNGKTVFINPASQSYTTKETVGYFI 1779
            LT  D++YF IVT STVGYGD++P  +  ++ V I I V+  +      E+A +     K  G+Y     +  KH+V+C  + +   +  F+ +F+   R +    VV +   E D ++R +L++     R  +++G+ +   DL RA +D+A+ACFIL++ N  +    D   I+R  ++K+F+ +  + +Q+L+ ENK ++           D VVC  E +  +LA +C+ P  ST ++ L      ++ +E + S   W   Y    G E+Y   L  S       G +F      +++   + LI    K  + K++ +NP  +   +     Y+I
Sbjct:  178 LTLFDALYFCIVTFSTVGYGDVTPRIWPSQLLVVIMICVALVVLPLQFEELAYLWMERQKSGGNYSRHRAQTEKHVVLCVTSLKIDLLMDFLNEFYAHPR-LQDYYVVILCPTEMDIQVRRILQIPLWSQRVIYLQGSALKDQDLMRAKMDDAEACFILSSRNEVDRTAADHQTILRAWAVKDFAPNCPLYVQILKPENKFHVKF--------ADHVVCEEEFKYAMLALNCVCPATSTLVTLLVHT---SRGQEGQTSPEQWQRTYGRCSGNEVYHIRLMDSKFFGEYDGKSFTYASFHAHKKYGVCLIG--TKREDNKSILLNPGPRHIMSATDTCYYI 504          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 444.506 bits (1142), Expect = 6.907e-141
Identity = 238/666 (35.74%), Postives = 378/666 (56.76%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCIN---------KVASLNEKIRQTSFRLSRQQFQYAVLDKAEKEID---------------FLKCDYKDFKESLIKNPLEPIK-FSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V      +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + E  +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K   G++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +          K    N  +RQ+            +L     +ID               F  C  K+  + L+      +   S H+++CIF D  S  IG++N ++PLR+    +  LK
Sbjct:  116 WAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSSN---PIETCQNFYKD-FTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFE--NSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCACKRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELK 769          

HSP 2 Score: 79.337 bits (194), Expect = 6.907e-141
Identity = 88/310 (28.39%), Postives = 151/310 (48.71%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +L+ I+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                   ++  I     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +L+  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D
Sbjct:  767 ELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLYCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTD 1064          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 441.81 bits (1135), Expect = 3.833e-140
Identity = 235/666 (35.29%), Postives = 377/666 (56.61%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCIN---------KVASLNEKIRQTSFRLSRQQFQYAVLDKAEKEID---------------FLKCDYKDFKESLIKNPLEPIK-FSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V      +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + E  +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FA ++PEIA ++ +  KY G++      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K   G++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +          K    N  +RQ+            +L     +ID               F  C  K+  + L+      +   S H+++CIF D  S  IG++N ++PLR+    +  LK
Sbjct:  162 WAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSSN---PIETCQNFYKD-FTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFE--NSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGTFNATRGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCACKRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELK 815          

HSP 2 Score: 78.9518 bits (193), Expect = 3.833e-140
Identity = 89/315 (28.25%), Postives = 153/315 (48.57%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+ I+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                   ++  I     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +L+  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +  L
Sbjct:  813 ELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLYCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCL 1115          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 437.187 bits (1123), Expect = 1.042e-138
Identity = 238/684 (34.80%), Postives = 377/684 (55.12%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKC---------------------------VCINKVASLNEKIRQTSFRLSRQQFQYAVLDKAEKEID---------------FLKCDYKDFKESLIKNPLEPIK-FSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V      +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + E  +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K   G++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C                               K    N  +RQ+            +L     +ID               F  C  K+  + L+      +   S H+++CIF D  S  IG++N ++PLR+    +  LK
Sbjct:  162 WAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSSN---PIETCQNFYKD-FTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFE--NSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCACKRRSQFHKSPLQNKKKGNGPFEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELK 833          

HSP 2 Score: 79.337 bits (194), Expect = 1.042e-138
Identity = 88/310 (28.39%), Postives = 151/310 (48.71%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +L+ I+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                   ++  I     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +L+  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D
Sbjct:  831 ELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLYCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTD 1128          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 435.647 bits (1119), Expect = 2.923e-138
Identity = 238/690 (34.49%), Postives = 378/690 (54.78%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-------------------------VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCIN---------KVASLNEKIRQTSFRLSRQQFQYAVLDKAEKEID---------------FLKCDYKDFKESLIKNPLEPIK-FSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V      +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + E  +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K   G++                         + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +          K    N  +RQ+            +L     +ID               F  C  K+  + L+      +   S H+++CIF D  S  IG++N ++PLR+    +  LK
Sbjct:   99 WAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSSN---PIETCQNFYKD-FTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFE--NSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRGSKLEAVDILARFCVITFRVFFTRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCACKRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELK 776          

HSP 2 Score: 79.337 bits (194), Expect = 2.923e-138
Identity = 89/315 (28.25%), Postives = 153/315 (48.57%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+ I+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                   ++  I     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +L+  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +  L
Sbjct:  774 ELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLYCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCL 1076          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 444.891 bits (1143), Expect = 5.054e-138
Identity = 238/666 (35.74%), Postives = 378/666 (56.76%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCIN---------KVASLNEKIRQTSFRLSRQQFQYAVLDKAEKEID---------------FLKCDYKDFKESLIKNPLEPIK-FSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V      +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + E  +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K   G++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +          K    N  +RQ+            +L     +ID               F  C  K+  + L+      +   S H+++CIF D  S  IG++N ++PLR+    +  LK
Sbjct:   27 WAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSSN---PIETCQNFYKD-FTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFE--NSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCACKRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELK 680          

HSP 2 Score: 58.5362 bits (140), Expect = 6.861e-8
Identity = 56/174 (32.18%), Postives = 97/174 (55.75%), Query Frame = 2
Query: 2480 LITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +L+  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D
Sbjct:  834 IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLYCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTD 1003          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 447.588 bits (1150), Expect = 3.610e-142
Identity = 241/668 (36.08%), Postives = 385/668 (57.63%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  N ++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   +  +L+ K +Q          TS +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  100 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DVTDPKRIKKCGCRRLEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 752          

HSP 2 Score: 79.7221 bits (195), Expect = 3.610e-142
Identity = 91/312 (29.17%), Postives = 151/312 (48.40%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSV 2977
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +
Sbjct:  750 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLI 1049          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 447.588 bits (1150), Expect = 3.890e-142
Identity = 241/668 (36.08%), Postives = 385/668 (57.63%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  N ++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   +  +L+ K +Q          TS +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  100 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DVTDPKRIKKCGCRRLEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 752          

HSP 2 Score: 79.337 bits (194), Expect = 3.890e-142
Identity = 91/312 (29.17%), Postives = 151/312 (48.40%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSV 2977
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +
Sbjct:  750 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLI 1049          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 447.203 bits (1149), Expect = 4.829e-142
Identity = 241/668 (36.08%), Postives = 385/668 (57.63%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  N ++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   +  +L+ K +Q          TS +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  165 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DVTDPKRIKKCGCRRLEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 817          

HSP 2 Score: 79.337 bits (194), Expect = 4.829e-142
Identity = 91/312 (29.17%), Postives = 151/312 (48.40%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSV 2977
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +
Sbjct:  815 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLI 1114          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 447.203 bits (1149), Expect = 4.993e-142
Identity = 241/668 (36.08%), Postives = 385/668 (57.63%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  N ++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   +  +L+ K +Q          TS +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  100 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DVTDPKRIKKCGCRRLEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 752          

HSP 2 Score: 79.7221 bits (195), Expect = 4.993e-142
Identity = 92/315 (29.21%), Postives = 152/315 (48.25%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +  L
Sbjct:  750 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCL 1052          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 447.203 bits (1149), Expect = 7.023e-142
Identity = 242/671 (36.07%), Postives = 385/671 (57.38%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKC-----VCINKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  N ++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C     V   +  +L+ K +Q          TS +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:   40 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DVTDPKRIKKCGCRRPVYVEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 695          

HSP 2 Score: 79.337 bits (194), Expect = 7.023e-142
Identity = 91/310 (29.35%), Postives = 150/310 (48.39%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D
Sbjct:  693 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTD 990          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q03720|SLO_DROME (Calcium-activated potassium channel slowpoke OS=Drosophila melanogaster OX=7227 GN=slo PE=1 SV=3)

HSP 1 Score: 469.544 bits (1207), Expect = 6.346e-146
Identity = 235/532 (44.17%), Postives = 341/532 (64.10%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGN--SWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRN---GKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCH 1833
            W  + ISGQ TTG+I+V +  + +  ++  Y  +A+    ++ERC   +       IDL    FF  Y+ IRF+AA +K+ F   +YS VD  TIP  FV IYLD  W+GLRFLRA+ LM VPD+LQYL VLK+++  RL QL ++FI +W+  +G+ H+LEN+GD     + N+ + L++   +YF IVTMSTVGYGD+   + LG+ ++  F+LV  A+FAS IPEI E++ SG+KY G    +   +HIVVCG+  + S+  F+ DF +EDR    + VVF++++ PD EL  L K +F   +F +GT+M+ +DL+R  + EADAC +LAN  C++P  EDAANIMRVIS+KN+S  +RV+IQL+QY NK+YL NIP+W+  +GD V+C +E++L  +A+SCL PG+ST ++NLF++RS      F+ S +  SW NDY+ G G+E+YT  LS + IG+ F       +  L LLL+A+E+K         + INP   +     T G+FI  S  E +R   YC  CH
Sbjct:  114 WAGELISGQTTTGRILVVLVFILSIASLIIYFVDASS--EEVERCQ-KWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPL---DFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS------FKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRG-AKIQANTQGFFIAQSADEVKRAWFYCKACH 632          

HSP 2 Score: 93.2041 bits (230), Expect = 1.678e-25
Identity = 90/304 (29.61%), Postives = 154/304 (50.66%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXXXXXXXXXEI---------------------PNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+ ++I  + +++ REW+ L   P +  ++ + +++  L  + V  C +C I+SA+V     +N D  L DKE IL +LN+K++           +  E                       N  +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN +   +I  LI G      E+   E         +    +N  +C++   +L+D      F    +  Y +LF  A K Y +L +GLY+  +T+ +  +SSK+ VI TNP  +FS+   D V  L
Sbjct:  864 ELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKV----PSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQ-FGECGK--YGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVI-TNPPDDFSLLPTDQVFVL 1159          

HSP 3 Score: 46.9802 bits (110), Expect = 1.678e-25
Identity = 17/38 (44.74%), Postives = 27/38 (71.05%), Query Frame = 1
Query: 2059 FSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
             + H+++C+FAD DSP IGL+N ++PLR+    +  LK
Sbjct:  829 LNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELK 866          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q8AYS8|KCMA1_CHICK (Calcium-activated potassium channel subunit alpha-1 OS=Gallus gallus OX=9031 GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 452.595 bits (1163), Expect = 2.612e-143
Identity = 244/665 (36.69%), Postives = 389/665 (58.50%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKM-RNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQF-------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N +  LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL PG ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  +   ++ INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   + ++L+ K +Q          +S +L R          Q   +D   K+ D    F  C  KD ++  L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  124 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNNQQ--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELVFAKLKLLMIAIEYKSEKRESSILINPGNHVKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNSSPKLMRHDPLLIPGNEQIDNMDANVKKYDSTGMFHWCPAKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSALIGLRNLVMPLRASNFHYHELK 776          

HSP 2 Score: 81.2629 bits (199), Expect = 2.612e-143
Identity = 91/310 (29.35%), Postives = 152/310 (49.03%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D
Sbjct:  774 ELKHIVFVGSLEYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLLRQPSITTGANIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTD 1071          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q9BG98|KCMA1_RABIT (Calcium-activated potassium channel subunit alpha-1 OS=Oryctolagus cuniculus OX=9986 GN=KCNMA1 PE=2 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 5.230e-141
Identity = 240/668 (35.93%), Postives = 386/668 (57.78%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  N ++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   + ++L+ K +Q          +S +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  166 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNSSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 818          

HSP 2 Score: 79.7221 bits (195), Expect = 5.230e-141
Identity = 91/312 (29.17%), Postives = 151/312 (48.40%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSV 2977
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +
Sbjct:  816 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLI 1115          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q28204|KCMA1_BOVIN (Calcium-activated potassium channel subunit alpha-1 OS=Bos taurus OX=9913 GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 446.432 bits (1147), Expect = 5.452e-141
Identity = 240/668 (35.93%), Postives = 386/668 (57.78%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  N ++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   + ++L+ K +Q          +S +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  153 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPSSSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 805          

HSP 2 Score: 79.337 bits (194), Expect = 5.452e-141
Identity = 91/312 (29.17%), Postives = 151/312 (48.40%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSV 2977
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D +
Sbjct:  803 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLI 1102          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|O18866|KCMA1_PIG (Calcium-activated potassium channel subunit alpha-1 (Fragment) OS=Sus scrofa OX=9823 GN=KCNMA1 PE=2 SV=2)

HSP 1 Score: 446.432 bits (1147), Expect = 5.876e-141
Identity = 240/668 (35.93%), Postives = 386/668 (57.78%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKT-VFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKES---------------LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W + + N    LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LL+IA+E K  N ++ + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +   + ++L+ K +Q          +S +L R      +L     +ID +  + K +  +               L ++       S H+++CIF D  S  IGL+N ++PLR+    +  LK
Sbjct:  139 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQA--LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPSSSPKLMRHD---PLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK 791          

HSP 2 Score: 79.337 bits (194), Expect = 5.876e-141
Identity = 91/310 (29.35%), Postives = 150/310 (48.39%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  L++  I     IP   +IT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D
Sbjct:  789 ELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIP---IITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD-RCRVAQLALLDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTD 1086          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A023VZW9 (SLO-1 2 OS=Trichuris muris OX=70415 PE=2 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 1.536e-161
Identity = 276/686 (40.23%), Postives = 404/686 (58.89%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNS--WINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK--TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCIN----------------KVASLNEKIRQTS----------------FRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKESLIKNPLEPIKFS----------NHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W  + ISGQ+TTG+I+V +  + +  ++  Y Y+A++   Q+E C I +  +    IDL    FF  Y+ IRF+AA +K+ F   VYS VD  TIP  FV IYL+  W+GLRFLRA+ LM VPD+LQYL VLK+++  RL QL ++F+ + + G+G  H+LEN+GD +      +   +T+ + +YF +VTM TVGYGDI   + LG++++  FIL   A+FAS+IPEIA+++ S  KY G Y  +   KHIVVCG   + S+  F+ DF +EDR    + VVF+++  PD EL  L K +F + +F +GTVMD +DL R  + +ADAC ILAN    +P  EDAANIMRVISLKN+S  +RV++QL+QY NK+YL NIP+WN   GD V+C +E++L ILA+SCL PG+ST ++NLF++RS      F+ S N+  W+NDY+ G G+E+YT  LS S +GMTF + V   +  L LLL+A+EVK  +    T+ INP S +     T G+FI  S  E +R   YC  CH   +   + + K KC  +                 KV S  E+I +                   R  R   + ++ +  + + + +K D           P+E +             NH+++C+FAD +SP IGL++F++PLR+    +  LK
Sbjct:  144 WAGELISGQSTTGRILVVLVFILSIGSLIIYFYDASHPNFQVETC-ISWSKSPSQQIDLAFNIFFLIYFFIRFVAATDKVWFLLEVYSFVDYFTIPPSFVAIYLERTWLGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFVSVSLTGAGFLHLLENSGDPF--QNFQNPQRITYWECVYFLVVTMGTVGYGDICCKTSLGRLFMVFFILGGLAMFASYIPEIADLIGSRQKYGGEYKSENGKKHIVVCGYITYESVSHFLQDFLHEDRDDVDVEVVFVHRVPPDLELEGLFKRHFTKVEFFQGTVMDSIDLSRVKVHKADACLILANKYSSDPDAEDAANIMRVISLKNYSPDIRVIVQLMQYHNKAYLLNIPSWNWKTGDDVICLAELKLGILAQSCLAPGFSTMMANLFAMRS------FKTSPNTPCWLNDYLRGAGMEIYTETLSHSFVGMTFPETVELIFVKLKLLLLAIEVKDDDNLECTIIINPESSAVIKVNTQGFFIAQSADEVKRAFYYCQKCHEDIQDVNM-IKKCKCRNLTLFRKGVRHIILANRTAKVLSPPERITKDDTGEIEGDNRYLADAIMTRDLRIPARASLTNGDKTDENDMKYDSTGMFHWCRARPIEEVILQREQAATTLLRNHVVICMFADKNSPLIGLRSFVMPLRASNYHYHELK 819          

HSP 2 Score: 110.923 bits (276), Expect = 1.536e-161
Identity = 90/305 (29.51%), Postives = 151/305 (49.51%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXX--------------------XXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFE--NINDEEST-NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQP 2992
            +L+ ++I  + E+L REW+ L   P +  ++ N +++  L  + V  C +CVI+SAR+   N    D  L DKE IL +LN+K++                             I    +IP   L+T+L+ ++NVQFLDQ+DED+PN  ++L++ F CG AF   +LD L+S  YFN     +I   + G      E+   E  ++    ST  +     +C+I  + + +  F + F     C Y +LF  A + + +LL+GLY++ E   + L+   K+ ++T P     +   D V  L+P
Sbjct:  817 ELKHVVIVGDVEYLRREWKMLQNMPKITVLNGNPLSRADLRAVNVNLCDMCVIISARIPNPNE---DPTLTDKEAILASLNIKAMNFDATTALLYHPLGNHGLNSPPMALCESRIKSGTQIP---LLTELVNDSNVQFLDQDDEDDPNTELYLTQPFTCGKAFAISVLDSLMSTTYFNDSALTLIRTFVTGGATPELEVILAEGGDLKGAPSTPQLLRKRDRCRIAQYGITEGPFVN-FGVQEGCTYGSLFLQALRRHGMLLIGLYRLQEAQPDELT---KRFVITAPPENMRLQITDLVFVLEP 1111          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A085MB25 (Uncharacterized protein OS=Trichuris suis OX=68888 GN=M513_04764 PE=4 SV=1)

HSP 1 Score: 494.197 bits (1271), Expect = 7.981e-161
Identity = 278/690 (40.29%), Postives = 406/690 (58.84%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNS--WINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK--TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKC-------------VCINKVASL---------------NEKIRQTSFRL-----------SRQQFQYA--VLDKAEKEID----FLKCDYKDFKESLIKNPLEPIK-FSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W  + ISGQ+TTG+I+V +  V +  ++  Y Y+A++   Q+E C I +  +    IDL    FF  Y+ IRF+AA +K+ F   VYS VD  TIP  FV IYL+  W+GLRFLRA+ LM VPD+LQYL VLK+++  RL QL ++F+ + + G+G  H+LEN+GD +      +   +T+ + +YF +VTM TVGYGDI   + LG++++  FIL   A+FAS++PEIA+++ S  KY G Y  +   +HIVVCG   + S+  F+ DF +EDR    + VVF+++  PD EL  L K +F + +F +GTVMD +DL R  + +ADAC ILAN    +P  EDAANIMRVISLKN+S  +RV++QL+QY NK+YL NIP+WN   GD V+C +E++L ILA+SCL PG+ST ++NLF++RS      F+ S N+  W+NDY+ G G+E+YT  LS S +GMTF + V   +  L LLL+A+EVK  +    T+ INP S +     T G+FI  S  E +R   YC  CH   +   + + K KC             +  N+ A +               +E  R + F             +R  F       D  + + D    F  C  +  +E +++         SNH+++C+FAD +SP IGL+NF++PLR+    +  LK
Sbjct:  149 WAGELISGQSTTGRILVVLVFVLSIGSLIIYFYDASHPNFQVETC-ISWSKSPSQQIDLAFNIFFLIYFFIRFVAATDKVWFLLEVYSFVDYFTIPPSFVAIYLERTWLGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFVSVSLTGAGFLHLLENSGDPF--QNFQNPQRITYWECVYFLVVTMGTVGYGDICCKTTLGRLFMVFFILGGLAMFASYVPEIADLIGSRQKYGGEYKAENGKRHIVVCGYITYESVSHFLQDFLHEDRDDVDVEVVFVHRVPPDLELEGLFKRHFTKVEFFQGTVMDSIDLSRVKVHKADACLILANKYSSDPDAEDAANIMRVISLKNYSPDIRVIVQLMQYHNKAYLLNIPSWNWKTGDDVICLAELKLGILAQSCLAPGFSTMMANLFAMRS------FKTSPNTPCWLNDYLRGAGMEIYTETLSHSFVGMTFPETVELIFVKLKLLLLAIEVKDDDNLECTIIINPESSAIIKVNTQGFFIAQSADEVKRAFYYCQKCHEDIQDVNM-IKKCKCRNLTLFRKGVRHIILANRTAKVLSPVERGAKEKAEEDDETERSSPFTANAIKARDVRIPARASFSSGGDKTDGNDMKYDSTGMFHWCRSRPIEEVILQREQAATTLLSNHVVICMFADKNSPLIGLRNFVMPLRASNYHYHELK 828          

HSP 2 Score: 105.916 bits (263), Expect = 7.981e-161
Identity = 88/305 (28.85%), Postives = 149/305 (48.85%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXX--------------------XXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFE--NINDEEST-NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQP 2992
            +L+ ++I  + E+L REW+ L   P +  ++ N +++  L  + V  C +CVI+SAR+   N    D  L DKE IL +LN+K++                             I    +IP   L+T+L+ ++NVQFLDQ+DED+PN  ++L++ F CG AF   +LD L+S  YFN     +I   + G      E+   E  ++    ST  +     +C+I  + + +  F + F       Y +LF  A + + +LL+GLY++ E     ++   K+ ++T P     +   D V  L+P
Sbjct:  826 ELKHVVIVGDVEYLRREWKMLQNMPKITVLNGNPLSRADLRAVNVNLCDMCVIISARIPNPNE---DPTLTDKEAILASLNIKAMNFDATTAQLYHPLGNSSLNSPPMALFESKIKSGTQIP---LLTELVNDSNVQFLDQDDEDDPNTELYLTQPFTCGKAFAISVLDSLMSTTYFNDSALTLIRTFVTGGATPELEVILAEGGDLKGAPSTPQLLRKRDRCRIAQYGITEGPFVN-FGVQEGWTYGSLFLQALRKHGMLLIGLYRLQEMQPEEVT---KRFVITAPPENMKLQMTDLVFVLEP 1120          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A1I8J2U5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 481.1 bits (1237), Expect = 3.313e-160
Identity = 284/760 (37.37%), Postives = 434/760 (57.11%), Query Frame = 1
Query:   22 CSEKKWYVFLLTNVXXXXXXXXXXXXXXXXXXXYGKIYKKLSPRNSSQGSYKAGEFSGGNNSGRXXXXXXXXXXXRVWTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNG-KTVFINPASQSYTTKETV-GYFICNSFKESQRVALYCNVCH---------------------------GANEGTPLRVDKFKCVCIN-KVASLNE---KIRQTSFRLSRQQF--QYAVLDKAEKEIDFLK-------CDYKDFKESLIK-NPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            CS + WY+ L +  I    GL L+LL +L+ ++  +I ++ S   S++    A   + GN      +       ++ W ++ IS Q+ TG+I+V +    +  ++G YIYEAT+    +E C + +  + L  +DL     F  Y+ IRFLAA++K+ FW  +YS+VD  T+P  FV IYL+  W+GLRF+R + +M +PD+LQYL VLKS T  R  Q+ T F+ +W++G+G+TH+ EN+GD     E ++ N +TFG+ MYFTIVTMSTVG+GD SP +  GK +++ +I+V+  IFASFIPEIAEI+ S S Y G Y  +   +H+VVCG     SI+SF+ DF +EDR  + + VV IN++ P  E ++LLK NF    +  G+V++  D +R  ++ + A  IL N   ++P  EDA+NIMRVIS+KN S   R +IQLLQY NK YL NIP W+   GD  +C +EM+   LA+SCL PG+ST ++NLFS R+ +          SW  DY +G  +E+Y+   S S +GMTF + V+  Y  L ++L A+E K   G + + INP  +S        G+F+ +S +E +R  LYCN CH                           GA+E T LR +         +VAS  +    +++T F    QQ   +Y+  D +++  ++         C  ++F++ ++K      +    H I+ +FAD+DS  IGL++F++PLR+       LK
Sbjct:   22 CSTRLWYIHLASTAIAFIGGLLLVLLVRLVGWLVKRI-RRSSQGGSTEIGKDAAMVAKGNGQTIEGDRIDWTAEVKEWANELISAQSITGRILVVLIFSLSVSSLGIYIYEATFLVGFVENC-VPWSQSVLNQVDLAFNIVFLIYFCIRFLAAQDKLWFWLEIYSIVDYCTVPPAFVNIYLNQSWLGLRFIRCLRIMTLPDVLQYLSVLKSGTVIRFFQMVTTFLSVWVIGAGITHLCENSGDP--QYEYSNVNGITFGNCMYFTIVTMSTVGFGDYSPKTDWGKFFISFYIMVALGIFASFIPEIAEIITSRSPYAGRYKKEHGRRHVVVCGAVTKESIESFLEDFLHEDREDTDVEVVCINKKAPSLEFQSLLKRNFGHLVYFIGSVLNPTDCQRVCLESSAAAIILCNKYDEDPDAEDASNIMRVISIKNVSPKTRCIIQLLQYHNKGYLLNIPNWDWRLGDECLCVAEMKQGFLAQSCLAPGFSTLMANLFSTRAMSDSHLI----GSWEKDYQDGSAMEIYSEYFSDSFVGMTFQEAVMLCYNKLRVILFAIEAKNSEGDRFLSINPPGRSAIIYNGCHGFFVADSQEEVRRAYLYCNRCHRDLADPRQIRKCSCQTEVSGPESPGHDGAHEVTRLRGNSANVRRPEIQVASRKKVLAAVQETEFGADEQQRYGEYSGDDPSKQSTEYFDLTGMFHWCPERNFEDVMLKPGSAARLNLREHYIVIVFADSDSHLIGLRSFVMPLRASNFHLRELK 773          

HSP 2 Score: 116.701 bits (291), Expect = 3.313e-160
Identity = 86/303 (28.38%), Postives = 151/303 (49.83%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXXXXXXXXXE-----------------IPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQPL 2995
            +L+PI+   N EFL +EW+SL  FP L+    + +N+  L   ++  C +CVIMSA+   +    +D +L+DKE++L TLN+K++         +    +                 +P   ++T++ V  N+QFLDQ+D D     ++ S+ +ACG+AFTT +LD L+S  ++N +   +I  L+ G      E+   E +     E +  +  N  +C+I   ++ D + +       +  Y  LFT   K + +L  G+Y+  ++       + K+V++TNP  EF +   D V  L P 
Sbjct:  771 ELKPIVFIGNLEFLQKEWQSLKNFPKLYMFPGSPMNRVILRSAKINLCDMCVIMSAKSKWKE--QMDPYLMDKEVVLCTLNIKAMSFADELDTSVQAQMQAFQSKDAQAKSMMSKVAVP---ILTEIFVGKNIQFLDQDDNDSDEEEIYNSQPYACGNAFTTDVLDSLMSTVFYNMNAMTLIRTLVTGGATPEMEVLMAEGLSMDGTEATPEIEANRNRCRIMQLSMLDARLRP----YGQLTYGELFTGVLKSHGILCFGVYRYRDSYNMGEPQTTKRVVVTNPPAEFRLLNSDLVYCLVPF 1064          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A061QHQ8 (Putative calcium-activated potassium channel, slowpoke OS=Cupiennius salei OX=6928 GN=CSH_0438 PE=2 SV=1)

HSP 1 Score: 509.99 bits (1312), Expect = 5.969e-160
Identity = 299/791 (37.80%), Postives = 447/791 (56.51%), Query Frame = 1
Query:   28 EKKWYVFLLTNVXXXXXXXXXXXXXXXXXXXYGKIYKKLSPRNSSQGSYKAGEFSGGNNSGRXXXXXXXXXXXRVWTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNG--KTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCH---------------------------GANEGTPLRVDKFKCVCINKVASLNEKI-RQTSFRLSRQQFQYAVLDKAEKEIDFLK-------------CDYKDFKESLI-KNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK-------TDYYSEQ*GISPQRMEIFSVFSKSP 2247
            E+KW+ FLL+++I    GLF++L+W+   FI  +  KK     ++  S       GGNN  R   E   +   + W  + ISGQ TTG+I+V +  + +  ++  Y  +A+    ++E C  + E      IDL    FF  Y+ IRF+AA +K+ F   +YS VD  TIP  F+ IYL   W+GLRFLRA+ LM VPD+LQYL VLK+++  RL QL ++ I +W+  +G+ H+LEN+GD     + ++ N +T+   +YF IVTMSTVGYGDI   + LG+ ++ +FILV  A+FAS+IPEI E++   SKY G    +   +HIVVCG+  + S+  F+ DF +EDR    + VVF++++ PD EL  L K +F   +F +GTVM+ VDL+R  + +ADAC +LAN  C++P  EDAANIMRVIS+KNFS  +RV+IQL+QY NK+YL NIP+WN   GD V+C +E++L  +A+SCL PG+ST ++NLF++RS     +      +W NDY+ G G+E+YT  LS S +GM+F       +  L LLL+A+EV   +G    + INP SQ   T +T G+FI  S  E +RV  YC  CH                           G  + +P +V+    +   +         R +S  ++ + F     D+  K+ DF +             C  +  ++ ++ +N       + H++LC+FAD DSP IGL+N ++PLR+    +  LK        DY   +  +  Q +   S+ S SP
Sbjct:   17 ERKWWCFLLSSIITFLVGLFIILIWRAFAFICCR--KKTGDSQAATKSKVPDSKGGGNN--REVAEIGFMTEAKDWAGELISGQTTTGRILVVLVFLLSIASLIIYFIDAS--KDKVETCHSWSENT-TQQIDLALNIFFMVYFFIRFIAASDKLWFMLELYSFVDYFTIPPSFISIYLGRTWIGLRFLRALRLMSVPDILQYLNVLKTSSSIRLAQLVSIVISVWLTAAGIIHLLENSGD---PLDFSNPNEMTYWQCVYFLIVTMSTVGYGDIYCQTSLGRGFIVLFILVGLAVFASWIPEITELIGHPSKYGGVLRKERGKRHIVVCGHINYDSVSYFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTVMNPVDLQRVKVHQADACLVLANKYCQDPDAEDAANIMRVISIKNFSDDIRVIIQLMQYHNKAYLLNIPSWNWKNGDDVICLAELKLGFIAQSCLAPGFSTMVANLFAMRSYKTSPD----TPAWQNDYLCGTGMEMYTETLSTSFVGMSFPQAAELCFVKLKLLLLAIEVTHDDGTDSKISINPKSQVKLTPDTQGFFIAQSADEVKRVWYYCKNCHEDVKDEKQIKKCKCKIPPASSVVLPRNGNRQKSPGKVNSMSSISSARKGRHGRPTGRNSSGSVTERPFGIMAEDQG-KDFDFERTEMKYDSTGMFHWCPARSIEDCILDRNQAAMTVLNGHVVLCLFADKDSPLIGLRNLVMPLRASNFHYHELKHVVIVGNVDYLRREWKML-QNLPKISILSGSP 791          

HSP 2 Score: 92.8189 bits (229), Expect = 2.966e-15
Identity = 90/303 (29.70%), Postives = 153/303 (50.50%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXX--------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG------EIHCFENI---NDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+ ++I  N ++L REW+ L   P +  +S + +++  L  + +  C +CVI+SA++     ++ D  L DKE IL +LN+K++                                S    N  LIT+L+ + NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN +   +I  LI G      E+   E         +    NN  +C++   +L D    S +    +  Y ++F  A K+Y +L +GLY+  +T+ +  +S+K+ VI TNP  +F +   D V  L
Sbjct:  758 ELKHVVIVGNVDYLRREWKMLQNLPKISILSGSPLSRADLRAVNINLCDMCVILSAKI----PSSEDPTLADKEAILASLNIKAMTFDDTIGVLTHHETGREGMSPLGSPIVLQRRGSVYGTNVPLITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNANALTLIRSLITGGATPELELILAEGAGLRGGYSTPESLNNRDRCRVGQISLSDGPLAS-YGEGGK--YGDVFVKALKNYGMLCIGLYRYRDTSSSFEASTKRYVI-TNPPADFPLIPSDKVFVL 1052          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A0V1EKP6 (Calcium-activated potassium channel slo-1 OS=Trichinella pseudospiralis OX=6337 GN=slo-1 PE=4 SV=1)

HSP 1 Score: 486.108 bits (1250), Expect = 2.160e-158
Identity = 278/701 (39.66%), Postives = 405/701 (57.77%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNS--WINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK--TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCIN------------------KVASLNEKIRQ---------------------TSFRLSRQQFQYAVLDKAEKEID-FLKCDYKDFKESLI-------KNPLEPIKFS----------NHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W  + ISGQ+TTG+I+V +  V +  ++  Y Y+A++   Q+E C I +  +    IDL    FF  Y+ IRF+AA +K+ F   VYS +D  TIP  FV IYL+  W+GLRFLRA+ LM VPD+LQYL VLK+++  RL QL ++F+ + + G+G  H+LEN+GD +      +   +T+ + +YF +VTM TVGYGDI   + LG+ ++  FIL   A+FAS++PEIA+++ S  KY G Y  +   +HIVVCG   + S+  F+ DF +EDR    + VVF+++  PD EL  L K +F + +F +GTVMD +DL R  + +ADAC ILAN    +P  EDAANIMRVISLKN+S  +RV++QL+QY NK+YL NIP+WN   GD VVC +E++L I+A+SCL PG+ST ++NLF++RS      F+ S ++  W+NDY+ G G+E+YT +LS S +GMTF +     +  L LLL+A+E+K        + INP S       T G+FI  S  E +R   YC  CH  ++   + + K KC C N                  KV S NE+ ++                     +S R +    +  + D  +   D + + D +D K             P+E I             NH++LC+FAD  SP IGL+NF++PLR+    +  LK
Sbjct:  153 WAGELISGQSTTGRILVVLVFVLSIGSLIIYFYDASHPNFQVETC-ISWSHSPSQQIDLAFNIFFLIYFFIRFVAATDKVWFLLEVYSFIDYFTIPPSFVAIYLERTWLGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFVSVSLTGAGFIHLLENSGDPF--QNFQNPQRITYWECVYFLVVTMGTVGYGDICCKTLLGRFFMVFFILGGLAMFASYVPEIADLIGSRQKYGGEYKAENGKRHIVVCGYITYESVTHFLQDFLHEDRDDVDVEVVFLHRVPPDLELEGLFKRHFTKVEFFQGTVMDSIDLSRVKVHKADACLILANKYSSDPDAEDAANIMRVISLKNYSPEIRVIVQLMQYHNKAYLLNIPSWNWRTGDDVVCLAELKLGIIAQSCLAPGFSTMMANLFAMRS------FKTSMSTPGWLNDYLRGAGMEIYTESLSHSFVGMTFPETAELMFTRLKLLLLAIEIKDDESLECNIIINPESNVIIKVNTQGFFIAQSADEVKRAFYYCQKCH--DDVLDVNLIK-KCKCRNLTLFRKGVRHVILANRTAKVLSPNERSQRSSLDDRNKGNLIEGTSEIDLKSSLREAGLPLKVGLSDPDDGSNDPWQRIDEEDMKYDSTGMFHWCKARPIEDIILDREQASVTLLHNHVVLCLFADRHSPLIGLRNFVMPLRASNYHYHELK 841          

HSP 2 Score: 105.531 bits (262), Expect = 2.160e-158
Identity = 83/305 (27.21%), Postives = 146/305 (47.87%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXX-------XXXXXXXXXXXXXEIPNRFL-------------ITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDE--------ESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQP 2992
            +L+ ++I  + E+L REW+ +   P +  ++ N +++  L  + +  C +CVI+SAR+   N    D  L DKE IL +LN+K++                I  +   P+  L             +T+L+ ++NVQFLDQ+DED+PN  ++L++ F CG AF   +LD L+S  YFN     +I  L+  G     E I  E         ++ +     +C+I  + + DD   +     +   Y  LF    +   +L +GLY++ E      ++S K+ ++T+P     +   D +  L+P
Sbjct:  839 ELKQVVIVGDVEYLRREWKMIQNLPKIIILNGNPLSRADLRAVNINMCDMCVIISARIPNPNE---DPTLTDKEAILASLNIKAMNFDECSPNLTAAMSGNILVNSRSPSMMLCSNPIRSGTEILMLTELVNDSNVQFLDQDDEDDPNTELYLTQPFTCGKAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELEGILAEGGDLRGAPSTSQLLRKRDRCRIAQYGINDDGPFAGLNIQDNYTYGRLFIKVLRERRMLCIGLYRLQEPPP---ATSGKRFVITSPPENMKLMITDRIFVLEP 1137          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 440.269 bits (1131), Expect = 4.097e-140
Identity = 234/649 (36.06%), Postives = 372/649 (57.32%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK-TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ------TSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKESLIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +G Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++   +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K    + ++ INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C        ++L+ K +Q       S   S +     +  ++E  +  L                     S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:   41 WAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD---PIESCQNFYKD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHD-DITDPKRIKKCGCKRFEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSMFLNTRSEASMTVL---------------------SGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELK 656          

HSP 2 Score: 79.7221 bits (195), Expect = 4.097e-140
Identity = 89/315 (28.25%), Postives = 153/315 (48.57%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGL 2986
            +L+ I+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  +++  +     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +      S   K+ ++TNP  EF +   D +  L
Sbjct:  654 ELKHIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLTAPSPCTKRYVITNPPYEFELVPTDLIFCL 956          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000050702.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000050702.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 445.277 bits (1144), Expect = 4.249e-138
Identity = 243/665 (36.54%), Postives = 382/665 (57.44%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKM-RNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKV--ASLNEKIRQ------TSFRLSRQQF-----------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C I+ E    L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K  +   +  INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C    +V  ++L+ K +Q      TS   S +             Q   +D   K+ D    F  C  KD ++  L ++       S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:  115 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD---PIESCQIFDED-ITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHD-DITDPKRIKKCGCKRFEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELK 767          

HSP 2 Score: 60.4622 bits (145), Expect = 9.262e-9
Identity = 57/174 (32.76%), Postives = 97/174 (55.75%), Query Frame = 2
Query: 2480 LITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D
Sbjct:  921 MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSAPSQCTKRYVITNPPYEFELVPTD 1090          

HSP 3 Score: 52.7582 bits (125), Expect = 2.179e-6
Identity = 29/83 (34.94%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANL-DFHLVDKEIILGTLNV 2410
            +L+PI+   + E+L REW +L  FP +  +  + +++  L  + +  C +CVI+SA     N  N+ D  L DKE IL +LN+
Sbjct:  765 ELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSA-----NQNNIDDASLQDKECILASLNI 842          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000044980.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000044980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 442.58 bits (1137), Expect = 6.327e-137
Identity = 241/678 (35.55%), Postives = 382/678 (56.34%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKM-RNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLN------EKIRQTSFRLSRQQF--------------------------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C I+ E    L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K  +   +  INP +     + T+G+FI +  KE +R   YC  CH  +   P R+   KC C    ++ N      E++ Q++    ++Q                           Q   +D   K+ D    F  C  KD ++  L ++       S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:  115 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD---PIESCQIFDED-ITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHD-DITDPKRIK--KCGCKRSKSNYNGYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELK 778          

HSP 2 Score: 60.4622 bits (145), Expect = 9.524e-9
Identity = 57/174 (32.76%), Postives = 97/174 (55.75%), Query Frame = 2
Query: 2480 LITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D
Sbjct:  932 MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSAPSQCTKRYVITNPPYEFELVPTD 1101          

HSP 3 Score: 52.7582 bits (125), Expect = 2.278e-6
Identity = 29/83 (34.94%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANL-DFHLVDKEIILGTLNV 2410
            +L+PI+   + E+L REW +L  FP +  +  + +++  L  + +  C +CVI+SA     N  N+ D  L DKE IL +LN+
Sbjct:  776 ELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSA-----NQNNIDDASLQDKECILASLNI 853          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000050440.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:48528:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000050440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 441.425 bits (1134), Expect = 1.207e-136
Identity = 239/678 (35.25%), Postives = 381/678 (56.19%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKM-RNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLN------EKIRQTSFRLSRQQF--------------------------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C I+ E    L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FA ++PEIA ++ +  KY G+Y      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K  +   +  INP +     + T+G+FI +  KE +R   YC  CH  +   P R+   KC C    ++ N      E++ Q++    ++Q                           Q   +D   K+ D    F  C  KD ++  L ++       S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:  115 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD---PIESCQIFDED-ITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGTYNSTRGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHD-DITDPKRIK--KCGCKRSKSNYNGYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELK 778          

HSP 2 Score: 60.4622 bits (145), Expect = 9.579e-9
Identity = 57/174 (32.76%), Postives = 97/174 (55.75%), Query Frame = 2
Query: 2480 LITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +   D
Sbjct:  932 MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSAPSQCTKRYVITNPPYEFELVPTD 1101          

HSP 3 Score: 52.7582 bits (125), Expect = 2.216e-6
Identity = 29/83 (34.94%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANL-DFHLVDKEIILGTLNV 2410
            +L+PI+   + E+L REW +L  FP +  +  + +++  L  + +  C +CVI+SA     N  N+ D  L DKE IL +LN+
Sbjct:  776 ELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSA-----NQNNIDDASLQDKECILASLNI 853          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000051878.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000051878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 418.313 bits (1074), Expect = 1.099e-127
Identity = 212/543 (39.04%), Postives = 330/543 (60.77%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKM-RNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKC 1878
            W    IS Q  TG+++V +    +   +  Y  +++     IE C I+ E    L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K  +   +  INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C
Sbjct:  115 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD---PIESCQIFDED-ITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHD-DITDPKRIKKCGC 645          

HSP 2 Score: 87.0409 bits (214), Expect = 4.762e-23
Identity = 89/306 (29.08%), Postives = 153/306 (50.00%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXX------------------------------XXXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSV 2959
            +L+PI+   + E+L REW +L  FP +  +  + +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  +++  +     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +   +  S   K+ ++TNP  EF +
Sbjct:  831 ELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSA-----NQNNIDDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLSAPSQCTKRYVITNPPYEFEL 1124          

HSP 3 Score: 41.9726 bits (97), Expect = 4.762e-23
Identity = 24/78 (30.77%), Postives = 39/78 (50.00%), Query Frame = 1
Query: 1954 QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            Q   +D   K+ D    F  C  KD ++  L ++       S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:  756 QMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELK 833          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006399.1 (pep scaffold:Pmarinus_7.0:GL477091:41003:110164:-1 gene:ENSPMAG00000005728.1 transcript:ENSPMAT00000006399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 311.997 bits (798), Expect = 1.995e-97
Identity = 151/383 (39.43%), Postives = 240/383 (62.66%), Query Frame = 1
Query:  736 ENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRN--GKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKC 1878
            EN+GD W   + N +N LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FA ++PEIA ++ +  KY G Y+P    KH+VVCG+    S+ +F+ DF ++DR    + ++F++   P+ EL  L + +F + +F +G+V++ +DL R  I+ ADAC I+AN  C +P  EDA+NIMRVIS+KN+   +RV+ Q+LQY NK++L NIP+W+  +GD  +C SE++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LLLIA+E +  +  G ++ +NP S       T+ +FI N  KE +R   YC  CH  +   P ++ K  C
Sbjct:    1 ENSGDPWRDFQ-NQQN-LTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRRKYGGEYLPTRGRKHVVVCGHITLESVSNFLKDFLHKDRDDVNVEILFLHSISPNLELEALFRRHFTQVEFYQGSVLNPLDLARVKIEAADACMIIANKYCPDPDAEDASNIMRVISIKNYHPRIRVITQMLQYHNKAHLLNIPSWSWREGDAAICLSELKLGFIAQSCLAQGISTMLANLFSMRSYIKIEE-----DTWQKFYLEGVSNEMYTEYLSSAFVGLSFPAVSELCFVKLRLLLIAIEYRSEHSYGSSILLNPGSHVRIQDGTLAFFIANDSKEVKRAFYYCKACH-EDVTDPKKIKKCSC 375          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006404.1 (pep scaffold:Pmarinus_7.0:GL477091:42221:110230:-1 gene:ENSPMAG00000005728.1 transcript:ENSPMAT00000006404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 312.383 bits (799), Expect = 2.266e-97
Identity = 149/384 (38.80%), Postives = 240/384 (62.50%), Query Frame = 1
Query:  733 LENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRN--GKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKC 1878
            +EN+GD W   +  ++  LT+ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FA ++PEIA ++ +  KY G Y+P    KH+VVCG+    S+ +F+ DF ++DR    + ++F++   P+ EL  L + +F + +F +G+V++ +DL R  I+ ADAC I+AN  C +P  EDA+NIMRVIS+KN+   +RV+ Q+LQY NK++L NIP+W+  +GD  +C SE++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    +  L LLLIA+E +  +  G ++ +NP S       T+ +FI N  KE +R   YC  CH  +   P ++ K  C
Sbjct:   22 VENSGDPW--RDFQNQQNLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRRKYGGEYLPTRGRKHVVVCGHITLESVSNFLKDFLHKDRDDVNVEILFLHSISPNLELEALFRRHFTQVEFYQGSVLNPLDLARVKIEAADACMIIANKYCPDPDAEDASNIMRVISIKNYHPRIRVITQMLQYHNKAHLLNIPSWSWREGDAAICLSELKLGFIAQSCLAQGISTMLANLFSMRSYIKIEE-----DTWQKFYLEGVSNEMYTEYLSSAFVGLSFPAVSELCFVKLRLLLIAIEYRSEHSYGSSILLNPGSHVRIQDGTLAFFIANDSKEVKRAFYYCKACH-EDVTDPKKIKKCSC 397          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007042.1 (pep scaffold:Pmarinus_7.0:GL486096:7796:16492:-1 gene:ENSPMAG00000006371.1 transcript:ENSPMAT00000007042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.438 bits (498), Expect = 1.345e-57
Identity = 91/215 (42.33%), Postives = 140/215 (65.12%), Query Frame = 1
Query: 1000 KHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKS--GNSWINDYINGMGLELYTSNLSLSLIGMTF 1638
            +HIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +RV+ Q+ QY NK++L NIP+WN  +GD  +C +E++L  +A+SCL PG ST ++NLFS+RS  +          ++W   Y+ G+  E+YT  LS +  G++F
Sbjct:    1 RHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIEAADACLILANKYCGDPDAEDASNIMRVISIKNYHPRIRVITQMQQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSYIKRVPLPHQIEEDTWQKYYLEGVSNEMYTEYLSNAFTGLSF 215          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: KCNT1 (potassium sodium-activated channel subfamily T member 1 [Source:HGNC Symbol;Acc:HGNC:18865])

HSP 1 Score: 97.0561 bits (240), Expect = 1.688e-21
Identity = 64/236 (27.12%), Postives = 115/236 (48.73%), Query Frame = 1
Query:  679 LSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSY--VPKEEYKHIVVC-GNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNF--MRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENK 1371
            + T+F  M+    G  H LE   +            ++   S+YF IVT STVG+GD+ P  +  ++ V I I V+  +      E+  +     K  G+Y     +  KH+V+C  + +   +  F+ +F+   R +     V +   + D ++R +L +     R  +++G+ +   DL R  ID+A+ACFIL + N  +    D   I+R  ++K+F+ S  + +Q+L+ ENK
Sbjct:  198 ICTLFCLMFTFICGFQH-LERAAEN-----------ISLFRSLYFCIVTFSTVGFGDVLPKIWPSQLLVVIMICVALMVLPVQFEELVYLYMERQKSGGNYSRYRAQTEKHVVLCVSSLKLDLLMDFLNEFYAHPR-LQDFYTVILCPTDMDSQVRRMLHVPLWAQRVIYLQGSALKDQDLVRVKIDDAEACFILTSRNEVDRTAADHQTILRAWAVKDFAPSCPLYVQILKPENK 420          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001869.1 (pep scaffold:Pmarinus_7.0:GL480351:152:3521:-1 gene:ENSPMAG00000001700.1 transcript:ENSPMAT00000001869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 3.174e-14
Identity = 62/236 (26.27%), Postives = 106/236 (44.92%), Query Frame = 1
Query:  289 GKIIVFIACVCTFITVGDYIYEATYFP--MQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLD----------------HLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWI-VGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEI 939
             K++  I+ +  FI +          P   + +  G   +   L  ++  C ++FT  Y++RFL++ NK +F+ G  +++DLL I  +++ I+L                  ++  +R LR + L +    LQ LG     +   LG L  +F+ M I + S +    E   D        D  F +   S ++  +TM+TVGYGDI P + LGKI   +  +    + A  IP I
Sbjct:    1 AKVLAIISIL--FIVLSTIALSLNTLPDLQETDEYGNVMDNPSLAHVEAVCIAWFTTEYMLRFLSSPNKWKFFKGALNVIDLLAILPYYITIFLTESNHSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLL-ILFLAMGIMIFSSLVFFAEKDED--------DTKFRSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPII 225          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: EDO32743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU69])

HSP 1 Score: 119.398 bits (298), Expect = 2.608e-27
Identity = 109/443 (24.60%), Postives = 205/443 (46.28%), Query Frame = 1
Query:  526 LLTIPSFFVEIYLDHL---WMGLRFLRAIWLMQVP------DLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSY--VPKEEYKHIVVCG-NFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNF--MRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGM-----TFYDLVLFSYEYLNLLLIAVEVKMRNGKTVFINPASQSYTTKETVGYFICNSFKE 1797
            +L++P F + I++  L   W+ L FL   WL +        DL + +   +SA   ++  L T  +C+        H LE     W           +   +++F IVT STVGYGD  P  +  + +V I I ++  +    +  +A +LFS  K  G+Y  +     +H+V+C       ++  F+ +F+ + R +  ++VV +   + D  LR LL++     R  ++KG+ +   DL RA  + A  CFILA+    + +  D   I+R  ++++F+ +  + +Q+L+ ENK +++          + VVC  E++  +LA +C+ PG    IS L ++      +++ +    W   Y    G E+Y   L  S+I       +F      +++   + LI V+   + G+ + +NP        +   ++I  S +E
Sbjct:  168 ILSVP-FLISIFMSELRNIWIPL-FLNC-WLAKAALETMFNDLHRLVLHQQSALSQKVLILITTVVCILFTSVCGIHHLERASLQW-----------SMMKTLWFVIVTFSTVGYGDTVPTHWTTQTFVMIMIGIALVLLPIELERLAFLLFSRQKEGGAYNHLLAGTDRHVVLCATTLRTGTLIDFLNEFYADSR-LHDVHVVLLCPSDLDSTLRILLQVPVWAQRVTYLKGSALIDEDLVRARRNAA-GCFILADRYAADREAADQHTILRTWAIQDFAPATPLFVQILKPENKFHVSF--------AEHVVCEDEIKHALLAVNCVCPG----ISTLVTLLLHTLHEQYVRGSEKWHEIYGKCAGNEIYDIRLGDSMIFRPYAYKSFTHAAFHAHKKYGVTLIGVKRHGKGGR-LMLNPGPSHNMAYDDRCFYIAISSEE 581          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: EDO46156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQS3])

HSP 1 Score: 77.0258 bits (188), Expect = 8.798e-15
Identity = 57/226 (25.22%), Postives = 114/226 (50.44%), Query Frame = 1
Query:  289 GKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLR---AIWLMQVPDLLQYLGVLKSATKFR-LGQ-LSTMF--ICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAE 945
            GKI+  +  +  +++V   I E     +  + C   +   F  A+D FC   FT  YI+R  AAEN  EF     +++D+L +  F++ + +  + +  + L    ++ ++++  + +   + + + K R +G  L + F  +   I    + ++L  +   ++  + + + F +  DSM++TI+TM TVGYGD  P + LGK+  ++  L+   + A  IP + E
Sbjct:  153 GKIVQTLIAILIYVSVAASIVETLQCSLG-KTCEETHPTIFF-ALDAFCMITFTLEYILRLFAAENMREFLTNKLNILDVLAVAPFYILLCVREIELSQQMLENANSLVILRILRMFRIFKLSRHSRKMRKMGHALKSAFSDLGFLIFAFLLANVLFASVLYFIERDTSPQQFTSIPDSMWYTIITMMTVGYGDAVPVTVLGKVVGSVCALLGIIMLALPIPILQE 376          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: SHAK6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFM4])

HSP 1 Score: 70.0922 bits (170), Expect = 1.181e-12
Identity = 53/167 (31.74%), Postives = 86/167 (51.50%), Query Frame = 1
Query:  418 AIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLW--MGLRFLRAIWLMQVPDL---------LQYLGVLKSATKFRLGQLSTMFICMWIV--GSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKI 879
            AI+ FC ++FT  Y IRFL + +K +F   V +L+DL+ I  FF+ + +        L  LR + L++V  +         LQ LG    A+   LG L   F+C+ ++   S + +   N           D  FL+   S +++I+TM+TVGYGD++P +  GK+
Sbjct:  184 AIESFCIAWFTLEYFIRFLCSPDKCKFVVSVLNLIDLVAILPFFITLPMTEPTSVSSLAILRCVRLVRVFRIFKLSRYSRGLQILGHTLKASLRELGLL-FFFLCVGVILFSSAVYYAEYNYN--------RDTEFLSIPHSFWWSIITMTTVGYGDMAPKTLGGKL 341          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: EDO31311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYB8])

HSP 1 Score: 70.4774 bits (171), Expect = 1.308e-12
Identity = 58/242 (23.97%), Postives = 108/242 (44.63%), Query Frame = 1
Query:  247 RVWTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIER-CGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMG------------LRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIP 933
            RVW        ++ GKI   +  +   +++   I E    P    R CG  +  AF + +D  C   FT  Y++R L+A  +  F     S++D+ ++  F+++I  + +  G             R  R + + +    LQ LG     +   LG +   F    ++ + + +  E         E+N  +FL+  D M++ IVTM+T GYGD++P + +G++  +   +V   + A  +P
Sbjct:  173 RVWDLFENPYNSSLGKITYAVTGIAIIVSILTTITET--IPCSTTRTCGELHASAFFI-VDGVCVGIFTLEYLVRLLSAPERWPFVKNFQSIIDVASVMPFYLDILFEQISGGSSGAEGLTILRVFRVFRVVKMSRHSKRLQSLGASIKNSSSELGFILFSFSLGVVIFATVIYYCEKD-------ELN-TSFLSIPDGMWYAIVTMTTTGYGDMTPETAIGQLMGSFCCIVGTLVIALPVP 403          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: SHAKR12 (Potassium channel; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI05])

HSP 1 Score: 67.781 bits (164), Expect = 9.162e-12
Identity = 46/166 (27.71%), Postives = 82/166 (49.40%), Query Frame = 1
Query:  418 AIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLD------------HLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKI 879
             ID    ++FT  YI R ++A +K++F F   +L+DL+ I  +F+ + LD             ++  LR +R + L +    L+ LG    + + +L  L  + +   I+ S + + LEN        E N   F +   + ++ I+TM+TVGYGD  P +  G++
Sbjct:  208 VIDTCIITWFTSEYIARLISAPHKLKFVFSTLALIDLIAIIPYFISLGLDADQTHAITFTVLRIFRLLRVIRLLKLTRYVAALRILGYTIQSCQDQLTALMFLLLISIILFSSLMYYLEN--------EENPTEFYSIPAAFWWCIITMTTVGYGDTCPRTPFGRL 365          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 444.891 bits (1143), Expect = 4.480e-143
Identity = 242/666 (36.34%), Postives = 379/666 (56.91%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK-TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCIN----KVASLNEKIRQTSFR---------LSRQQF-------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +G Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++   +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K    + ++ INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +        S  +K R    R         +SR          Q   +D   K  D    F  C  KD ++  L ++       S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:  141 WAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD---PIESCQSFYDD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHD-DITDPKRIKKCGCKRLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELK 794          

HSP 2 Score: 85.1149 bits (209), Expect = 4.480e-143
Identity = 88/306 (28.76%), Postives = 151/306 (49.35%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANL-DFHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSV 2959
            +L+PI+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+ D  L DKE IL +LN+KS+                                  +++  +     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +      S   K+ ++TNP  EF +
Sbjct:  792 ELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIEDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFEL 1085          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: ENSORLT00000011055.2 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:101155390])

HSP 1 Score: 445.662 bits (1145), Expect = 3.037e-142
Identity = 241/665 (36.24%), Postives = 385/665 (57.89%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKM-RNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCI--NKVASLNEKIRQ----------TSFRLSRQQF-------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +  Y  +++     IE C  +Y   + L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++L  +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K  +   +  INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C     ++ ++L+ K +Q          +S ++ R          Q   +D+  K+ D    F  C  +D ++  L ++       S H+++CIF D  S  IGL+NF++PLR+    +  LK
Sbjct:  111 WAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD---PIEFCKHFYSN-YTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQALSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPVICELCYVKLKLLLIAIEYKSDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALFYCKACHD-DISDPKRIKKCGCKKFEEDRHSALSPKKKQRNGGMRNSPNSSPKIMRHDPLFIPGSEQIESMDENVKKYDSTGMFHWCPSRDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSALIGLRNFVMPLRASNFHYHELK 763          

HSP 2 Score: 81.6481 bits (200), Expect = 3.037e-142
Identity = 88/306 (28.76%), Postives = 150/306 (49.02%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLD-FHLVDKEIILGTLNVXXX------------------------------XXXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSV 2959
            +L+ I+   + E+L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+D   L DKE IL +LN+KS+                                  +++  +     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +   N  S   K+ ++TNP   F +
Sbjct:  761 ELKHIVFVGSLEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIDDASLQDKECILASLNIKSMLFDDSIRVLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALKGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLNAQSQCTKRYVITNPPYAFEL 1054          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 437.187 bits (1123), Expect = 1.210e-140
Identity = 246/697 (35.29%), Postives = 381/697 (54.66%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVK-----MRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDK-------------------------FKCVC------INKVASLNEKIRQTSFR---------LSRQQF-------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +G Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++   +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K      R+ K + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K                         FK  C           S  +K R    R         +SR          Q   +D   K  D    F  C  KD ++  L ++       S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:  141 WAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD---PIESCQSFYDD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESRSRKRILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHD-DITDPKRIKKCGCKRPAEGATTPGNTGSQKEAGVRFKADCNIVEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELK 825          

HSP 2 Score: 84.7297 bits (208), Expect = 1.210e-140
Identity = 89/310 (28.71%), Postives = 152/310 (49.03%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANL-DFHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +L+PI+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+ D  L DKE IL +LN+KS+                                  +++  +     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +      S   K+ ++TNP  EF +   D
Sbjct:  823 ELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIEDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFELVPSD 1120          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 447.588 bits (1150), Expect = 3.193e-138
Identity = 244/670 (36.42%), Postives = 380/670 (56.72%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVK-----MRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCIN----KVASLNEKIRQTSFR---------LSRQQF-------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +G Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FAS++PEI E++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMRVIS+KN+   +R++ Q+LQY NK++L NIP+WN  +GD  +C +E++   +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K      R+ K + INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +        S  +K R    R         +SR          Q   +D   K  D    F  C  KD ++  L ++       S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:  141 WAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD---PIESCQSFYDD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESRSRKRILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHD-DITDPKRIKKCGCKRLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELK 798          

HSP 2 Score: 60.4622 bits (145), Expect = 1.044e-8
Identity = 57/174 (32.76%), Postives = 96/174 (55.17%), Query Frame = 2
Query: 2480 LITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYD 2971
            +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +      S   K+ ++TNP  EF +   D
Sbjct:  952 MITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFELVPSD 1121          

HSP 3 Score: 51.6026 bits (122), Expect = 5.294e-6
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANL-DFHLVDKEIILGTLNV 2410
            +L+PI+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+ D  L DKE IL +LN+
Sbjct:  796 ELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIEDASLQDKECILASLNI 873          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 391.734 bits (1005), Expect = 4.709e-127
Identity = 226/666 (33.93%), Postives = 354/666 (53.15%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK-TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCIN----KVASLNEKIRQTSFR---------LSRQQF-------QYAVLDKAEKEID----FLKCDYKDFKES-LIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W    IS Q  TG+++V +    +   +G Y  +++     IE C  +Y+  F L ID+    FF  Y+ +RF+AA +K+ FW  V S+VD  T+P  FV +YL+  W+GLRFLRA+ L+Q  ++LQ+L +LK++   +L  L ++FI  W+  +G  H++EN+GD W      +   L++ + +Y  +VTMSTVGYGD+   + LG++++  FIL   A+FA ++PEIA ++ +  KY GSY      KHIVVCG+    S+ +F+ DF ++DR    + +VF++   P+ EL  L K +F + +F +G+V++  DL R  I+ ADAC ILAN  C +P  EDA+NIMR                          T    WN  +GD  +C +E++   +A+SCL  G ST ++NLFS+RS  + +E     ++W   Y+ G+  E+YT  LS + +G++F  +    Y  L LLLIA+E K    + ++ INP +     + T+G+FI +  KE +R   YC  CH  +   P R+ K  C  +        S  +K R    R         +SR          Q   +D   K  D    F  C  KD ++  L ++       S H+++CIF D  S  +GL+N ++PLR+    +  LK
Sbjct:  141 WAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD---PIESCQSFYDD-FTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPW--ENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGSYNSTRGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMR-------------------------YTLYHIWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE-----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHD-DITDPKRIKKCGCKRLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELK 769          

HSP 2 Score: 85.1149 bits (209), Expect = 4.709e-127
Identity = 88/306 (28.76%), Postives = 151/306 (49.35%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANL-DFHLVDKEIILGTLNVXXXX------------------------------XXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEEST---------NMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSV 2959
            +L+PI+   + ++L REW +L  FP +  +    +++  L  + +  C +CVI+SA     N  N+ D  L DKE IL +LN+KS+                                  +++  +     IP   +IT+L+ ++NVQFLDQ+D+D+P+  ++L++ FACG+AF   +LD L+S  YFN ++  +I  L+  G     E +  EE+           +AN + +C++    L+D  F         C Y +LF  A K Y++L  G+Y++ +      S   K+ ++TNP  EF +
Sbjct:  767 ELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSA-----NQNNIEDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIP---IITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRD-RCRVAQLALYDGPFADL--GDGGC-YGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFEL 1060          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000014623.1 (SMESG000014623.1)

HSP 1 Score: 1391.71 bits (3601), Expect = 0.000e+0
Identity = 710/720 (98.61%), Postives = 714/720 (99.17%), Query Frame = 1
Query:   13 MPKCSEKKWYVFLLTNVXXXXXXXXXXXXXXXXXXXYGKIYKKLSPRNSSQGSYKAGEFSGGNNSGRXXXXXXXXXXXRVWTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKESLIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            MPKCSEKKWYVFLLTNVIIIFSGLFLLLLWKLIKFIYGKI KKLSP N+SQGSYKAGEFSGGNNSGRINEENQNIQIIRVWTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSRQQFQYA+LDKAEKEIDFLKCDYKDFKESLIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKK   + L+
Sbjct:    1 MPKCSEKKWYVFLLTNVIIIFSGLFLLLLWKLIKFIYGKISKKLSPINASQGSYKAGEFSGGNNSGRINEENQNIQIIRVWTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSRQQFQYAILDKAEKEIDFLKCDYKDFKESLIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKLDTADLR 720          

HSP 2 Score: 526.168 bits (1354), Expect = 1.656e-170
Identity = 292/292 (100.00%), Postives = 292/292 (100.00%), Query Frame = 2
Query: 2147 KKLDTADLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAGEIHCFENINDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXXXXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQPLSQCDFTITN 3022
            KKLDTADLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVKSIFKKKLQKKFIGKSGEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAGEIHCFENINDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFKHYHLLLLGLYKVVETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQPLSQCDFTITN
Sbjct:  712 KKLDTADLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVKSIFKKKLQKKFIGKSGEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAGEIHCFENINDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFKHYHLLLLGLYKVVETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQPLSQCDFTITN 1003          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000044594.1 (SMESG000044594.1)

HSP 1 Score: 545.428 bits (1404), Expect = 2.956e-177
Identity = 274/656 (41.77%), Postives = 420/656 (64.02%), Query Frame = 1
Query:  247 RVWTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVK--MRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGA-NEGTPLRV-------DKFKCVCINKVASLNEKIRQTSFRLSRQQFQYAVLDKA----EKEIDFLKCDYKDFKESLIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            R + ++ IS Q   G+I+  IA V   ++   Y+YE    P+++E+C  Y     +   DL C   F  Y+++RF  +  K+ FW G ++++D  TIP     + LD  W+GLRF+R + L++V +++Q   V+KS T  R+ QL T F  + IVG+G  H+LEN+G+    +  N+   + +GDS+YF IVTMSTVGYGDI   +  GKI+V +FIL++ A FASFIPE+AE LF+GS+Y G Y+     +HI+VCG+  ++S+ +F+ DF +EDR  S ++V+FIN++EPD E+++LLK+ F + K+ +GTVMDQVDL R  +  ADAC ILA+ NC +P DEDA NIMR IS KN+     V+IQLLQ+ENK+YL NIPTWNK  GD ++CYSE+EL ILA+SCL+PG+ST ++N+FS+RSE +CK+   S  SW+NDY+ G+ +E+Y++ LS S    ++ +LV F ++ LNLLLIA+EVK  +   K + +NP +       +VG+FIC+S++++    +YC+ CH    + T L+V         ++   I+++ S  E++  T   +     +   +D+     +K  +F  C  +   +++I +  +      HIILCIF+DN + SIG++NF++PLRS     + LK
Sbjct:   76 RPYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKC--YPLTNPIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLHRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQ-NPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPGDYELTVISRLKS-EEEVSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELK 727          

HSP 2 Score: 80.4925 bits (197), Expect = 5.546e-15
Identity = 58/211 (27.49%), Postives = 106/211 (50.24%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLS-VLQVENCHVCVIMSARVSKRNAANL--DFHLVDKEIILGTL-------------------------------------NVXXXXXXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG 2677
            +L+ ++I ++++F+ +EW  +  FP +  + F+ I+ + ++ ++ ++ C  CVI++   +K N A+L  D ++VDKEII+  L                                     N       +  +   G   ++P   +I+KL +E+NVQ+LD  +++  N P +L + FA G AFTT MLD L+S AY+N +   ++  LI G
Sbjct:  725 ELKELVIIADKDFIEKEWSEICGFPKIK-VVFHQISIRRIAHLISIDTCSRCVILN---NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSETQVP---IISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLING 928          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000050831.1 (SMESG000050831.1)

HSP 1 Score: 449.129 bits (1154), Expect = 1.121e-149
Identity = 245/687 (35.66%), Postives = 392/687 (57.06%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGN--SWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVK--MRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCH------------------------------------------GANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKESLIKNP--LEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRL 2169
            W+ + ISGQN TGK +V + C+ +  ++  Y+YE + +    E C + +  +    +DL     F  Y+ +RFLA+ +K+ FW  +YS VDL TIP  FV +YL   W+GLRF+RA+ LM + D+L +L V+KS++  RL  L T F+ + I  SG  H++E++G   ++    ++NFL F    YF IVT+STVGYGDI   +  GK+ +  FIL   A+FA+ IPE+ EI+ S ++Y   +  +++ +HI++CG+  + S+ +F+ADF ++DR    + +V +N   P+ EL+N+LK  F+  +F +G+ M+  DL R  +  ADAC +LAN    +P  EDAANIMRVIS+KNF   ++V++QL+QY NK+YL NIP+W+  +GD  VC +E++L  +A+SCL PG+ST ++NLF++RS      F+   N  +W+N Y+ G G+E+Y+   S +  G TF + V  S++YL LLLIA+E K  +    ++ INP +         G+FI  S  ES+R   +C  CH                                            +E + +++ + + +  N+    +    Q SFR  R  F   +  + +    F  C  +  ++ L+ +   L+   FSNHI++C+FA+++S  IGL NF++PLR+    +S L
Sbjct:   96 WSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVC-VKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYLGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRS------FKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLNRHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSKLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLR--FNEQISRRFDTTGMFHWCPERPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSEL 770          

HSP 2 Score: 102.449 bits (254), Expect = 1.121e-149
Identity = 97/324 (29.94%), Postives = 157/324 (48.46%), Query Frame = 2
Query: 2162 ADLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXXXXXXXXXEIP---------------------------NRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEE--------STNMANNNVKCQIRIFNLFDDKFQSCFANTN-RCLYKNLFTYAFXXXXXXXXXXXXXX--------ETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQPLS 2998
            ++L  I+   N E+L REW+SLA FP L  +S +++++ +L  + V    +CVI+S   SK N +  D  LVDKE IL +LNV+++       K       +P                           +  +IT+L +++NVQFLDQ+DED P   +F+++ FACG AF   +LD L+S AYFN +   +I  LI  G     E +  E         + +   N  +C++ I  +  +     F + N  C Y +LF  A + + +L +GLY+++             + ++SKK+ ++TNP     +   D V  LQ  S
Sbjct:  768 SELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILS---SKSNNSMDDAFLVDKEAILCSLNVQAMSFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQFS 1088          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000076792.1 (SMESG000076792.1)

HSP 1 Score: 375.941 bits (964), Expect = 3.628e-129
Identity = 231/688 (33.58%), Postives = 357/688 (51.89%), Query Frame = 1
Query:  253 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGN--SWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK----TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGA-------------------------------NEGTPL----RVDKFKCVCINKVASL-NEKIRQTSFRLSRQQFQYAVLDKAEKEID----FLKCDYKDFKESLI--KNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            W  + ISGQN TG++++ I    +  ++  Y  E +      +   I +  ++    DL     F  ++ +R++AA +K  FW  +YSLVD+LT+P  F+   L+  W+GLRF RA+ L+   D+L +L +LKS++K RL  L T+F  + +  +G  H++E TGD     E  +K   T+ D  YF I TMSTVGYGDI   ++ GK+ +  FIL   AIFA+ IPEI EI+ + ++Y G +  +   +HI++CG+  F                         +   P  E              I   V  +    R  ++ ADAC IL +    +P  EDAANIMRVIS+KN+  +++V++QL+QY NK+YL NIP+W+  +GD VVC +E++L  +A+SCL PG+ST ++NLF +RS      F+K  +   W+N Y+ G  LE+YT  LS S  G+TF + V   +  LNLLLIAVEVK  N +    ++ INP         T G+FI  S  +++R   YC  CH +                               N G  L       K + V  N+      +  ++ S  L+         +++++  D    F  C  ++F+ +++  K+ L    FSNHI++CIFAD +SP IGL++F++PLRS    ++ L+
Sbjct:  125 WAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHLVTLFTSLVLTSAGFIHLIELTGDI---PEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQRTNC--------------------DSGHPSTEYS------------IAKCVEKKFKPARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRS------FKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELR 771          

HSP 2 Score: 107.457 bits (267), Expect = 3.628e-129
Identity = 86/301 (28.57%), Postives = 144/301 (47.84%), Query Frame = 2
Query: 2165 DLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVXXXXXXXXXXXXXXXXXEIPNRF-----------LITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAGEIHCFENINDEESTNMAN---------NNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFXXXX----XXXXXXXXXXETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQPL 2995
            +LR II    +++L REW+SL  FP +  ++ + +N+  L ++ +  C + VI+S   S      +D +L DKE IL +LN+K++       +    S    N             +IT+L V+++VQ+LDQ+DED P+  +FL++ FACG AF   +LD L+S AYFN +   +I  ++ G           E + +           N  +C++    L +  +   F N     Y +LF   FK Y      L   +   +E     +S++K + ++TNP  E  +   D V  L+P 
Sbjct:  769 ELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSN---GLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVTGGATLELEELLSEGSGIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKT--YGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFCLRPF 1064          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000078105.1 (SMESG000078105.1)

HSP 1 Score: 372.089 bits (954), Expect = 5.069e-119
Identity = 216/634 (34.07%), Postives = 359/634 (56.62%), Query Frame = 1
Query:  274 GQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK-TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSRQQFQYAVLDKAEKEIDFLKCDYKDFKESLIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKTRHSRLK 2172
            GQ T    I  +  V    +   Y++    + + +E C  + E   L  I L    FF   ++I F   ++ +EFW  +Y+++++ T+P+ F+ IYL   ++G  FLR IW+ ++PD++Q L +L+  +  RL  L ++F+C+W+ G+G+ ++ ENTGD W + + + K  +++G   YF +VTMSTVGYGDI P +  G+I++ +F+L++ AIFAS+IPE+ +IL S S Y  ++ P    KH +VCG+ E   I+SF++ F++E+R    I ++FI+   P   L+ L+K  + + ++++GT M   DLKR  ++ AD C ++   NC+N   ED ANIMRVIS+K    + RV+IQL Q++NK +L NIP W    GD V+C++E++L ILA+SCL  G+ST I + F+I S       +   N WI  Y  G    +Y    S    G TF + V   Y+   +++I +EV    G+ T+ + P  +   TK+   Y I  +      +++YC  CH +++ + L + K  C  I   ++++ KI      L+  +    +L+K   +  F     + F  S +K   +   F +HI+L +F+  +S S GL NF+ PLR KK  + ++K
Sbjct:   80 GQGTFYGTITLLNVVLNLFSFFIYVFNTNEYYI-LENCCPWNEN-LLEIIQLVLSIFFLISFLIDFSMQKDHLEFWKDLYAIINIFTVPNTFIGIYLQRNYVGTFFLRFIWVYKIPDVIQQLDLLEVKSVIRLWHLGSIFMCIWVCGAGLFYLFENTGDIWHNYKNSQK--ISYGACFYFILVTMSTVGYGDIYPKTDSGRIFLCLFLLIALAIFASYIPEMWDILKSRSIYDKTFRPVYNKKHNIVCGSLEDQEIESFLSTFYHENRNSKNIRIIFISLNRPKLYLKGLMK-RYPQVEYVEGTEMKSEDLKRIRVEIADCCLVITKRNCENEDAEDKANIMRVISIKECCPNQRVIIQLHQFQNKIHLLNIPNWCPLIGDEVICFNEIKLGILARSCLCAGFSTAICHAFTILSPKHI--IKNENNPWIEQYKRGFSASIYRERFSQFFYGRTFLETVHICYDRFKIIVIGLEVIDSYGESTIKLYPNPKHVITKQCWAYCISENQILPYNMSIYCKRCH-SDKNSNLYLKKCYCEIITINSNMSVKIPLKQSLLAHNKEMEKILNK-NLDNKFEITSRRSFYHSFVK--YDKTLF-DHIVLLVFSHENSKSAGLINFVKPLRIKKDDYVKIK 701          

HSP 2 Score: 77.411 bits (189), Expect = 5.069e-119
Identity = 51/178 (28.65%), Postives = 92/178 (51.69%), Query Frame = 2
Query: 2147 KKLDTADLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVX-XXXXXXXXXXXXXXXXEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAG 2677
            KK D   ++PII+  N  +L +EW++++ FP ++ +  +  + + L + QV     CV+++A     N    D +LVDKE+ILGTLN+   +   K+       S    N  +IT + ++ N+ FL     D      + +++FA G A+   +L+ LLS  Y++ +   ++   I G
Sbjct:  693 KKDDYVKIKPIILVGNGVYLEKEWKTISIFPEIYVVVGSCFDLEVLDLAQVNRARTCVLINAP-KPFNHKVEDPYLVDKEVILGTLNLLNYLKYNKVSLSESDFSSSSVNTKIITDVSIDTNMHFLYPNSLDSSQNGAYFTKVFASGHAYCNSILNSLLSSTYYDWNTINLLRLFIEG 869          
The following BLAST results are available for this feature:
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNMA14.983e-14236.01potassium calcium-activated channel subfamily M al... [more]
KCNMA15.369e-14236.08potassium calcium-activated channel subfamily M al... [more]
KCNMA15.738e-14236.08potassium calcium-activated channel subfamily M al... [more]
KCNMA15.738e-14236.01potassium calcium-activated channel subfamily M al... [more]
KCNMA15.834e-14236.08potassium calcium-activated channel subfamily M al... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slo-11.439e-15138.37Calcium-activated potassium channel slo-1 [Source... [more]
slo-13.563e-15138.09Calcium-activated potassium channel slo-1 [Source... [more]
slo-17.613e-13942.46Calcium-activated potassium channel slo-1 [Source... [more]
slo-11.305e-13841.50Calcium-activated potassium channel slo-1 [Source... [more]
slo-12.049e-13841.50Calcium-activated potassium channel slo-1 [Source... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slo6.790e-14943.42gene:FBgn0003429 transcript:FBtr0301582[more]
slo3.312e-14843.96gene:FBgn0003429 transcript:FBtr0330286[more]
slo3.626e-14844.17gene:FBgn0003429 transcript:FBtr0100622[more]
slo7.925e-14844.55gene:FBgn0003429 transcript:FBtr0100624[more]
slo1.855e-14743.34gene:FBgn0003429 transcript:FBtr0334294[more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnma1a1.367e-14336.32potassium large conductance calcium-activated chan... [more]
kcnma1a3.932e-14336.24potassium large conductance calcium-activated chan... [more]
kcnma1a6.499e-13836.24potassium large conductance calcium-activated chan... [more]
CABZ01092907.17.762e-12139.83potassium large conductance calcium-activated chan... [more]
si:dkey-21e5.17.208e-3127.27si:dkey-21e5.1 [Source:ZFIN;Acc:ZDB-GENE-141210-6][more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNMA16.907e-14135.74potassium calcium-activated channel subfamily M al... [more]
KCNMA13.833e-14035.29potassium calcium-activated channel subfamily M al... [more]
KCNMA11.042e-13834.80potassium calcium-activated channel subfamily M al... [more]
KCNMA12.923e-13834.49potassium calcium-activated channel subfamily M al... [more]
KCNMA15.054e-13835.74potassium calcium-activated channel subfamily M al... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnma13.610e-14236.08potassium large conductance calcium-activated chan... [more]
Kcnma13.890e-14236.08potassium large conductance calcium-activated chan... [more]
Kcnma14.829e-14236.08potassium large conductance calcium-activated chan... [more]
Kcnma14.993e-14236.08potassium large conductance calcium-activated chan... [more]
Kcnma17.023e-14236.07potassium large conductance calcium-activated chan... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q03720|SLO_DROME6.346e-14644.17Calcium-activated potassium channel slowpoke OS=Dr... [more]
sp|Q8AYS8|KCMA1_CHICK2.612e-14336.69Calcium-activated potassium channel subunit alpha-... [more]
sp|Q9BG98|KCMA1_RABIT5.230e-14135.93Calcium-activated potassium channel subunit alpha-... [more]
sp|Q28204|KCMA1_BOVIN5.452e-14135.93Calcium-activated potassium channel subunit alpha-... [more]
sp|O18866|KCMA1_PIG5.876e-14135.93Calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023VZW91.536e-16140.23SLO-1 2 OS=Trichuris muris OX=70415 PE=2 SV=1[more]
A0A085MB257.981e-16140.29Uncharacterized protein OS=Trichuris suis OX=68888... [more]
A0A1I8J2U53.313e-16037.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A061QHQ85.969e-16037.80Putative calcium-activated potassium channel, slow... [more]
A0A0V1EKP62.160e-15839.66Calcium-activated potassium channel slo-1 OS=Trich... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnma1a4.097e-14036.06potassium large conductance calcium-activated chan... [more]
ENSAMXT00000050702.14.249e-13836.54pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000044980.16.327e-13735.55pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050440.11.207e-13635.25pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051878.11.099e-12739.04pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006399.11.995e-9739.43pep scaffold:Pmarinus_7.0:GL477091:41003:110164:-1... [more]
ENSPMAT00000006404.12.266e-9738.80pep scaffold:Pmarinus_7.0:GL477091:42221:110230:-1... [more]
ENSPMAT00000007042.11.345e-5742.33pep scaffold:Pmarinus_7.0:GL486096:7796:16492:-1 g... [more]
KCNT11.688e-2127.12potassium sodium-activated channel subfamily T mem... [more]
ENSPMAT00000001869.13.174e-1426.27pep scaffold:Pmarinus_7.0:GL480351:152:3521:-1 gen... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327432.608e-2724.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461568.798e-1525.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK61.181e-1231.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313111.308e-1223.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAKR129.162e-1227.71Potassium channel; Predicted protein [Source:UniP... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnma1a4.480e-14336.34calcium-activated potassium channel subunit alpha-... [more]
ENSORLT00000011055.23.037e-14236.24potassium calcium-activated channel subfamily M al... [more]
kcnma1a1.210e-14035.29calcium-activated potassium channel subunit alpha-... [more]
kcnma1a3.193e-13836.42calcium-activated potassium channel subunit alpha-... [more]
kcnma1a4.709e-12733.93calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014623.11.656e-17098.61SMESG000014623.1[more]
SMESG000044594.12.956e-17741.77SMESG000044594.1[more]
SMESG000050831.11.121e-14935.66SMESG000050831.1[more]
SMESG000076792.13.628e-12933.58SMESG000076792.1[more]
SMESG000078105.15.069e-11934.07SMESG000078105.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001493 ID=SMED30001493|Name=Calcium-activated potassium channel slo-1, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=3071bp
ATCAAAATTAATATGCCAAAATGTTCTGAAAAGAAATGGTATGTGTTTCT
TTTAACAAATGTTATTATAATATTTTCCGGCTTATTCTTGCTATTGCTAT
GGAAATTGATAAAATTTATATACGGAAAAATTTACAAAAAATTGTCACCA
AGAAATTCTAGCCAGGGGAGCTATAAAGCTGGAGAGTTTTCAGGAGGAAA
TAATTCCGGAAGAATCAACGAAGAAAATCAGAATATTCAAATAATTCGAG
TTTGGACATCGAAATTCATTTCCGGTCAAAACACAACCGGGAAAATCATC
GTGTTCATCGCTTGCGTGTGCACCTTCATTACCGTCGGTGACTACATATA
TGAGGCCACGTATTTCCCCATGCAAATTGAAAGGTGCGGGATATATTATG
AAGGAGCCTTCTTACTTGCGATTGACCTTTTCTGTTACTCGTTCTTTACC
TGCTATTATATAATTCGCTTTCTAGCAGCTGAAAATAAAATCGAGTTCTG
GTTTGGGGTCTATTCTTTGGTGGATTTGTTAACAATTCCTAGCTTTTTCG
TGGAGATCTATTTGGATCATCTTTGGATGGGATTGCGGTTTTTAAGAGCA
ATTTGGTTGATGCAAGTCCCGGATTTATTACAATATCTCGGAGTGCTGAA
ATCAGCTACAAAGTTCAGGTTAGGGCAATTGAGTACAATGTTTATTTGCA
TGTGGATTGTGGGATCTGGCATGACGCATATGTTGGAAAATACTGGAGAC
ACCTGGCTTTCAGCGGAAGTAAATGACAAGAATTTCCTCACATTTGGCGA
TAGTATGTATTTCACAATTGTAACTATGTCAACGGTCGGCTACGGAGACA
TTAGCCCACATTCGTTTTTAGGAAAAATATGGGTTGCGATTTTTATTTTG
GTTTCTTTCGCCATTTTTGCTAGTTTCATCCCGGAAATCGCGGAAATTTT
GTTTTCTGGATCTAAATATACCGGAAGTTACGTTCCTAAAGAAGAATATA
AACATATTGTCGTTTGCGGGAATTTTGAGTTTTCATCTATTCAGTCTTTC
ATGGCAGATTTTTTTAATGAAGACAGACCAATTTCGAAGATAAATGTGGT
CTTCATCAACCAAGAAGAACCAGATTTTGAATTACGGAATCTTCTGAAAA
TGAACTTTATGAGATCAAAATTTATTAAGGGAACCGTAATGGACCAGGTG
GATTTGAAGCGAGCGTCGATTGACGAGGCGGATGCTTGTTTCATTCTGGC
GAATCATAATTGCAAAAATCCCAAAGACGAAGACGCCGCAAATATCATGA
GAGTGATCTCGTTGAAGAATTTCTCGTCAAGTGTTCGAGTTCTTATTCAA
TTGTTACAATATGAAAACAAATCCTATTTGACGAACATTCCCACATGGAA
TAAGGATAAAGGCGACACAGTTGTTTGCTACAGCGAGATGGAATTAAGAA
TTCTCGCAAAAAGCTGCTTGATTCCCGGATACTCGACGTTTATTAGCAAT
TTATTTTCCATCCGCTCAGAAGCTCAATGTAAAGAATTCCGCAAATCGGG
CAATTCTTGGATAAATGATTACATAAATGGAATGGGACTCGAACTTTACA
CCAGTAACTTATCTCTTTCTTTGATTGGGATGACCTTTTATGATTTGGTA
CTCTTCTCTTATGAATATCTCAACCTTTTACTAATCGCAGTGGAGGTGAA
AATGAGGAATGGCAAAACGGTATTTATAAATCCGGCATCACAAAGTTACA
CAACAAAAGAAACGGTTGGTTACTTTATATGTAATTCTTTTAAAGAATCT
CAAAGAGTTGCTTTGTATTGTAATGTTTGCCATGGTGCAAATGAGGGAAC
ACCTTTAAGGGTGGATAAGTTCAAATGCGTTTGTATTAACAAAGTAGCCT
CACTTAATGAAAAGATTAGACAAACCAGCTTTCGACTGAGTCGACAACAG
TTCCAGTACGCCGTTTTAGATAAAGCAGAAAAAGAAATCGACTTCCTTAA
GTGTGACTATAAGGATTTTAAGGAGAGTCTGATAAAGAATCCCCTGGAAC
CGATTAAGTTTTCTAATCATATAATTCTGTGCATTTTTGCTGACAATGAT
TCCCCGTCGATCGGATTGAAGAACTTCATAATTCCTTTGCGGTCGAAAAA
AACTCGACACAGCCGACTTAAGACCGATTATTATAGCGAGCAATGAGGAA
TTTCTCCACAGAGAATGGAGATCTTTAGCGTGTTTTCCAAATCTCCATCC
GATTTCATTCAATAACATCAATAAGAAGTCTCTAAGTGTTCTTCAAGTGG
AGAACTGCCACGTTTGCGTGATTATGAGTGCACGAGTCAGCAAACGGAAC
GCAGCGAATCTTGATTTCCATCTCGTCGACAAAGAGATCATTTTGGGCAC
TCTCAATGTCAAGTCTATTTTCAAGAAAAAACTTCAAAAAAAATTCATCG
GAAAATCCGGAGAAATCCCAAATCGATTTCTAATCACAAAATTATTAGTG
GAAAACAATGTCCAGTTTCTAGATCAAGAAGACGAAGACGAACCGAACTG
TCCGGTATTTCTCTCGGAAATATTTGCATGCGGTAGCGCGTTCACCACGA
AAATGCTGGATTGTCTACTGAGCATCGCCTATTTTAATCCGGACGTCAAC
AAAGTCATCACGCATTTGATTGCCGGGGAGATCCATTGCTTCGAAAACAT
CAACGACGAAGAAAGTACTAATATGGCAAACAACAACGTCAAATGTCAAA
TTCGGATTTTTAATTTGTTTGACGACAAATTCCAGTCATGTTTTGCCAAC
ACGAATCGTTGCTTGTATAAGAACCTCTTTACGTACGCCTTCAAGCATTA
CCACTTATTGCTATTGGGACTTTATAAGGTCGTTGAAACCACACAAAATA
TTCTTTCTTCCAGTAAAAAAAAGGTTATTCTGACAAACCCCGATGGTGAA
TTTTCCGTCAGCTGTTACGATTCGGTTCTCGGGTTACAGCCGCTAAGCCA
GTGTGACTTTACTATTACGAATTGACAGATTTATTATACATTTCATCAAG
AGTTACTTTTATCCTCCCCGG
back to top

protein sequence of SMED30001493-orf-1

>SMED30001493-orf-1 ID=SMED30001493-orf-1|Name=SMED30001493-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=234bp
MSARVSKRNAANLDFHLVDKEIILGTLNVKSIFKKKLQKKFIGKSGEIPN
RFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLS
IAYFNPDVNKVITHLIAGEIHCFENINDEESTNMANNNVKCQIRIFNLFD
DKFQSCFANTNRCLYKNLFTYAFKHYHLLLLGLYKVVETTQNILSSSKKK
VILTNPDGEFSVSCYDSVLGLQPLSQCDFTITN*
back to top

protein sequence of SMED30001493-orf-2

>SMED30001493-orf-2 ID=SMED30001493-orf-2|Name=SMED30001493-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=732bp
IKINMPKCSEKKWYVFLLTNVIIIFSGLFLLLLWKLIKFIYGKIYKKLSP
RNSSQGSYKAGEFSGGNNSGRINEENQNIQIIRVWTSKFISGQNTTGKII
VFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFT
CYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRA
IWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGD
TWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFIL
VSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSF
MADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQV
DLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQ
LLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISN
LFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLV
LFSYEYLNLLLIAVEVKMRNGKTVFINPASQSYTTKETVGYFICNSFKES
QRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSRQQ
FQYAVLDKAEKEIDFLKCDYKDFKESLIKNPLEPIKFSNHIILCIFADND
SPSIGLKNFIIPLRSKKTRHSRLKTDYYSEQ*
back to top

protein sequence of SMED30001493-orf-3

>SMED30001493-orf-3 ID=SMED30001493-orf-3|Name=SMED30001493-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MLLNEIGWRFGKHAKDLHSLWRNSSLLAIIIGLKSAVSSFFRPQRNYEVL
QSDRRGIIVSKNAQNYMIRKLNRFQGILYQTLLKILIVTLKEVDFFFCFI
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0040011locomotion
GO:0042493response to drug
GO:0043050pharyngeal pumping
GO:0045214sarcomere organization
GO:0046928regulation of neurotransmitter secretion
GO:0048149behavioral response to ethanol
GO:0050804modulation of synaptic transmission
GO:0071805potassium ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR027359Volt_channel_dom_sf
IPR036291NAD(P)-bd_dom_sf
IPR028325VG_K_chnl
IPR003929K_chnl_BK_asu
IPR016040NAD(P)-bd_dom
IPR005821Ion_trans_dom
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0015269calcium-activated potassium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
GO:0005515protein binding
GO:0060072large conductance calcium-activated potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031430M band
GO:0045202synapse
GO:0055120striated muscle dense body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 656..676
NoneNo IPR availablePRINTSPR01449BKCHANNELAcoord: 365..385
score: 34.52
coord: 487..502
score: 58.07
coord: 408..428
score: 57.14
coord: 441..454
score: 35.71
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 166..186
score: 25.38
coord: 262..284
score: 45.5
coord: 140..163
score: 29.98
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 223..322
e-value: 2.8E-18
score: 67.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 329..464
e-value: 1.0E-15
score: 59.7
NoneNo IPR availablePANTHERPTHR10027:SF33POTASSIUM LARGE CONDUCTANCE CALCIUM-ACTIVATED CHANNEL, SUBFAMILY M, ALPHA MEMBER 1Acoord: 74..730
NoneNo IPR availablePANTHERPTHR10027CALCIUM-ACTIVATED POTASSIUM CHANNEL ALPHA CHAINcoord: 74..730
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 101..317
NoneNo IPR availableTMHMMTMhelixcoord: 166..188
NoneNo IPR availableTMHMMTMhelixcoord: 262..281
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 137..159
NoneNo IPR availableTMHMMTMhelixcoord: 288..310
IPR003929Calcium-activated potassium channel BK, alpha subunitPFAMPF03493BK_channel_acoord: 465..564
e-value: 3.2E-24
score: 85.0
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 83..222
e-value: 4.0E-8
score: 34.8
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 99..315
e-value: 1.9E-14
score: 53.5
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 334..498