ADF-H domain-containing protein

Overview
NameADF-H domain-containing protein
Smed IDSMED30001490
Length (bp)507
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADF-H domain-containing protein (SMED30001490) t-SNE clustered cells

Violin plots show distribution of expression levels for ADF-H domain-containing protein (SMED30001490) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADF-H domain-containing protein (SMED30001490) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADF-H domain-containing protein (SMED30001490) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001490

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30001490SMESG000080129.1 Contig513GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30001490SMESG000080129.1 Contig513GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30001490SMESG000080129.1 dd_Smed_v4_260_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001490SMESG000080129.1 dd_Smed_v4_260_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30001490SMESG000080129.1 dd_Smed_v4_260_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001490SMESG000080129.1 dd_Smed_v4_260_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30001490SMESG000080129.1 dd_Smed_v4_260_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30001490SMESG000080129.1 dd_Smed_v6_260_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001490SMESG000080129.1 dd_Smed_v6_260_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30001490SMESG000080129.1 DN290811ncbi_smed_estsPMID:21664348
Forsthoefel et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30001490SMESG000080129.1 PL030005A10G01ncbi_smed_estsPMID:21664348
Forsthoefel et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Match: CFL1 (cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874])

HSP 1 Score: 56.6102 bits (135), Expect = 4.954e-10
Identity = 39/140 (27.86%), Postives = 73/140 (52.14%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLIDVTKKAPRE-------ATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            M++GV VS    + + ++K+          ++ + VLF ++E  K  ++  +  +E        T +D  A   +        YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+L GIK  ++AN
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKK--NIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQAN 138          
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Match: CFL1 (cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874])

HSP 1 Score: 56.6102 bits (135), Expect = 6.105e-10
Identity = 41/144 (28.47%), Postives = 72/144 (50.00%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLI-----------DVTKKAPREATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            M++GV VS    + + ++K+          ++ + VLF ++E  K I           DV +      T +D  A   +        YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+L GIK  ++AN
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQ------TVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQAN 138          
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Match: CFL1 (cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874])

HSP 1 Score: 56.6102 bits (135), Expect = 6.105e-10
Identity = 41/144 (28.47%), Postives = 72/144 (50.00%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLI-----------DVTKKAPREATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            M++GV VS    + + ++K+          ++ + VLF ++E  K I           DV +      T +D  A   +        YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+L GIK  ++AN
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQ------TVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQAN 138          
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Match: CFL1 (cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874])

HSP 1 Score: 54.299 bits (129), Expect = 1.708e-9
Identity = 24/57 (42.11%), Postives = 40/57 (70.18%), Query Frame = 2
Query:  203 YAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+L GIK  ++AN
Sbjct:   65 YALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQAN 121          
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Match: CFL1 (cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874])

HSP 1 Score: 53.9138 bits (128), Expect = 3.616e-9
Identity = 24/57 (42.11%), Postives = 40/57 (70.18%), Query Frame = 2
Query:  203 YAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+L GIK  ++AN
Sbjct:   65 YALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQAN 121          
BLAST of ADF-H domain-containing protein vs. Ensembl Celegans
Match: unc-60 (Actin-depolymerizing factor 2, isoform c [Source:UniProtKB/Swiss-Prot;Acc:Q07749])

HSP 1 Score: 64.3142 bits (155), Expect = 1.848e-13
Identity = 39/129 (30.23%), Postives = 68/129 (52.71%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGL-YAVYEYELSEKN---------SQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIK 358
            M++GV V P+C  AY  +    ++ Y++F I + D  I V K   + A Y +FV ++ +     K   YA  + E++ +          +++IFV + PD  PVR +MLYA S   L+  L G++++ +
Sbjct:    1 MASGVKVDPSCKNAYDLLHNKHQHSYIIFKIDKNDTAIVVEKVGEKNAPYAEFVEEMKKLVEDGKECRYAAVDVEVTVQRQGAEGTSTLNKVIFVQYCPDNAPVRRRMLYASSVRALKASL-GLESLFQ 128          
BLAST of ADF-H domain-containing protein vs. Ensembl Celegans
Match: F53E2.2 (Actin-depolymerizing factor 1, isoforms a/b [Source:UniProtKB/Swiss-Prot;Acc:Q07750])

HSP 1 Score: 50.8322 bits (120), Expect = 2.788e-8
Identity = 35/133 (26.32%), Postives = 65/133 (48.87%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRK-YRYVLFGITEGDKLID--VTKKA----------PREATYEDFVADLNEACAQ-NKGLYAVYEYELS--------EKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQL 334
            MS+GV+V P+   ++ ++  GRK YRY++F I E   +++  VT+              +A ++ FV D+           YAV++++ +         K  ++IF+   PD   ++ KM+YA S   ++  L
Sbjct:    1 MSSGVMVDPDVQTSFQKLSEGRKEYRYIIFKIDENKVIVEAAVTQDQLGITGDDYDDSSKAAFDKFVEDVKSRTDNLTDCRYAVFDFKFTCSRVGAGTSKMDKIIFLQICPDGASIKKKMVYASSAAAIKTSL 133          
BLAST of ADF-H domain-containing protein vs. Ensembl Celegans
Match: F53E2.2 (Actin-depolymerizing factor 1, isoforms a/b [Source:UniProtKB/Swiss-Prot;Acc:Q07750])

HSP 1 Score: 50.8322 bits (120), Expect = 2.788e-8
Identity = 35/133 (26.32%), Postives = 65/133 (48.87%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRK-YRYVLFGITEGDKLID--VTKKA----------PREATYEDFVADLNEACAQ-NKGLYAVYEYELS--------EKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQL 334
            MS+GV+V P+   ++ ++  GRK YRY++F I E   +++  VT+              +A ++ FV D+           YAV++++ +         K  ++IF+   PD   ++ KM+YA S   ++  L
Sbjct:    1 MSSGVMVDPDVQTSFQKLSEGRKEYRYIIFKIDENKVIVEAAVTQDQLGITGDDYDDSSKAAFDKFVEDVKSRTDNLTDCRYAVFDFKFTCSRVGAGTSKMDKIIFLQICPDGASIKKKMVYASSAAAIKTSL 133          
BLAST of ADF-H domain-containing protein vs. Ensembl Fly
Match: tsr (gene:FBgn0011726 transcript:FBtr0072188)

HSP 1 Score: 89.7373 bits (221), Expect = 4.116e-23
Identity = 48/132 (36.36%), Postives = 75/132 (56.82%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYEL---------SEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDV 370
            M++GV VS  C   Y EIK  +K+RYV+F I + +K IDV   A R A Y+ F+ D+ + C   +  Y ++++E          S K  +L  + W PD   V+ KMLY+ S + L+K L+G++  I+A D+
Sbjct:    1 MASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRD-EKQIDVETVADRNAEYDQFLEDI-QKCGPGECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDL 130          
BLAST of ADF-H domain-containing protein vs. Ensembl Fly
Match: CG6873 (gene:FBgn0030951 transcript:FBtr0074607)

HSP 1 Score: 74.7146 bits (182), Expect = 2.398e-17
Identity = 38/131 (29.01%), Postives = 74/131 (56.49%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEK---------NSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAND 367
            M++G+ +S  C   + +I+  +++RY +F + + ++ I V     REA Y+DF+ADL  A   N+  +AVY+YE   +           +LI ++W P +  ++ KMLY+ +   L+++  G++  I+A +
Sbjct:    1 MASGINLSRECQHVFEQIRKLKQHRYAVF-VIQDEREIKVEVLGVREANYDDFLADLQRA-GSNQCRFAVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFAVLKREFPGVQKCIQATE 129          
BLAST of ADF-H domain-containing protein vs. Ensembl Zebrafish
Match: cfl1 (cofilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-215])

HSP 1 Score: 53.1434 bits (126), Expect = 6.241e-9
Identity = 38/142 (26.76%), Postives = 69/142 (48.59%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM----------GRKYRYVLFGITEGDKLIDVTK-----KAPREATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++GV V       + E+K+           ++ + V+F +++  K I + +     +      Y  FV  L      N   YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+  GIK   + N +D
Sbjct:    1 MASGVTVEETVLTVFNEMKVRKAHCNEEEKSKRKKAVMFCLSDDKKHIIMEQGQEILQGDEGDPYLKFVKML----PPNDCRYALYDATYETKETKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGMD 138          
BLAST of ADF-H domain-containing protein vs. Ensembl Zebrafish
Match: cfl2 (cofilin 2 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1815])

HSP 1 Score: 52.373 bits (124), Expect = 1.157e-8
Identity = 40/147 (27.21%), Postives = 72/147 (48.98%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNE------AC-----AQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++GV VS    + + ++K+          ++ + VLF +++  K I V      E   +  V D+ +      AC       N   Y +Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+  GIK   + N +D
Sbjct:    1 MASGVTVSDEVIKVFNDMKVRKSSSSDEVKKRKKAVLFCLSDDKKKIIV------EEGRQILVGDIGDSVDDPYACFVKLLPLNDCRYGLYDATYETKESKKEDLVFIFWAPEGAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLD 141          
BLAST of ADF-H domain-containing protein vs. Ensembl Zebrafish
Match: cfl1l (cofilin 1 (non-muscle), like [Source:ZFIN;Acc:ZDB-GENE-040426-2770])

HSP 1 Score: 45.4394 bits (106), Expect = 4.919e-6
Identity = 23/58 (39.66%), Postives = 36/58 (62.07%), Query Frame = 2
Query:  203 YAVYEYELSEKNS---QLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAND 367
            YA+Y+ + + K S    L+F+   PD  P+R+KMLYA S+  L+ +L G+K   + ND
Sbjct:   79 YALYDCKYTNKESVKEDLVFIFSAPDDAPMRSKMLYASSKNALKAKLPGMKFEWQIND 136          
BLAST of ADF-H domain-containing protein vs. Ensembl Xenopus
Match: zc4h2 (zinc finger, C4H2 domain containing [Source:Xenbase;Acc:XB-GENE-941217])

HSP 1 Score: 56.9954 bits (136), Expect = 3.537e-10
Identity = 43/148 (29.05%), Postives = 72/148 (48.65%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIK---------MGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQ--------------NKGLY-AVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++GV V+    + + E+K         + ++ + VLF ++   K I V      E T +  V D+ EA                   GLY A YE + S+K   L+F+ W PD  P+++KM+YA S++ ++K+  GIK   + N +D
Sbjct:    1 MASGVTVNDEVIKVFNEMKVRKSSTPEEIKKRKKAVLFCLSPDKKEIIV------EETKQILVGDIGEAVPDPYRTFVNLLPLDDCRYGLYDATYETKESKK-EDLVFIFWAPDNAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLD 141          
BLAST of ADF-H domain-containing protein vs. Ensembl Xenopus
Match: zc4h2 (zinc finger, C4H2 domain containing [Source:Xenbase;Acc:XB-GENE-941217])

HSP 1 Score: 51.9878 bits (123), Expect = 1.800e-8
Identity = 40/123 (32.52%), Postives = 62/123 (50.41%), Query Frame = 2
Query:   50 EIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQ--------------NKGLY-AVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            EIK  ++ + VLF ++   K I V      E T +  V D+ EA                   GLY A YE + S+K   L+F+ W PD  P+++KM+YA S++ ++K+  GIK   + N +D
Sbjct:   11 EIK--KRKKAVLFCLSPDKKEIIV------EETKQILVGDIGEAVPDPYRTFVNLLPLDDCRYGLYDATYETKESKKE-DLVFIFWAPDNAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLD 124          
BLAST of ADF-H domain-containing protein vs. Ensembl Xenopus
Match: oat.2 (ornithine aminotransferase, gene 2 [Source:Xenbase;Acc:XB-GENE-1005707])

HSP 1 Score: 50.447 bits (119), Expect = 8.634e-8
Identity = 40/144 (27.78%), Postives = 73/144 (50.69%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLI-----------DVTKKAPREATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            M++GV+VS +  + + ++K+          ++ + V+F ++E  K+I           DV      +  Y+ FV  L     +N   YA+Y+  YE  E K   L+FV W P+   +++KM+YA S++ ++K+  GIK   + N
Sbjct:    1 MASGVMVSDDVIKVFNDMKVRHQLSPEEAKKRKKAVVFCLSEDKKMIILEPGKEILQGDVGCNV--DDPYKAFVKML----PRNDCRYALYDALYETKETKKEDLVFVFWAPEEASLKSKMIYASSKDAIKKRFPGIKHEWQTN 138          
BLAST of ADF-H domain-containing protein vs. Ensembl Xenopus
Match: oat.2 (ornithine aminotransferase, gene 2 [Source:Xenbase;Acc:XB-GENE-1005707])

HSP 1 Score: 48.521 bits (114), Expect = 5.528e-7
Identity = 39/143 (27.27%), Postives = 72/143 (50.35%), Query Frame = 2
Query:    5 STGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLI-----------DVTKKAPREATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            ++GV+VS +  + + ++K+          ++ + V+F ++E  K+I           DV      +  Y+ FV  L     +N   YA+Y+  YE  E K   L+FV W P+   +++KM+YA S++ ++K+  GIK   + N
Sbjct:    1 ASGVMVSDDVIKVFNDMKVRHQLSPEEAKKRKKAVVFCLSEDKKMIILEPGKEILQGDVGCNV--DDPYKAFVKML----PRNDCRYALYDALYETKETKKEDLVFVFWAPEEASLKSKMIYASSKDAIKKRFPGIKHEWQTN 137          
BLAST of ADF-H domain-containing protein vs. Ensembl Xenopus
Match: slc1a2 (solute carrier family 1 member 2 [Source:Xenbase;Acc:XB-GENE-1005169])

HSP 1 Score: 45.4394 bits (106), Expect = 5.769e-6
Identity = 30/108 (27.78%), Postives = 54/108 (50.00%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRY-VLFGITEGDKLIDVTKKAPREATYE---DFVADLNEACAQNKGLYAVYEYELSEKNS---QLIFVVWIPDVIPVRAKMLYA 304
            M++GV V       + E+K+ +  +  + F  TE ++ I + K+  +E   +   DF  +L     + K  YA+ +   S   S   +L+F++W PD   ++ KMLYA
Sbjct:    1 MASGVRVDDCINLQFQEMKLRKSNKKAIFFCFTEDERFITLDKE--KEILVDQKGDFFQNLKALFPEKKCCYALVDVSFSTVESAKEELLFIMWTPDCASIKQKMLYA 106          
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Match: Cfl1 (cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:101757])

HSP 1 Score: 55.4546 bits (132), Expect = 9.549e-10
Identity = 42/144 (29.17%), Postives = 74/144 (51.39%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLI-----------DVTKKAPREATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            M++GV VS    + + ++K+          ++ + VLF ++E  K I           DV +    +  Y  FV  L +   +    YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+L GIK  ++AN
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTV--DDPYTTFVKMLPDKDCR----YALYDATYETKESKKEDLVFIFWAPENAPLKSKMIYASSKDAIKKKLTGIKHELQAN 138          
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Match: Cfl1 (cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:101757])

HSP 1 Score: 55.4546 bits (132), Expect = 2.162e-9
Identity = 42/144 (29.17%), Postives = 74/144 (51.39%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLI-----------DVTKKAPREATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            M++GV VS    + + ++K+          ++ + VLF ++E  K I           DV +    +  Y  FV  L +   +    YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+L GIK  ++AN
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTV--DDPYTTFVKMLPDKDCR----YALYDATYETKESKKEDLVFIFWAPENAPLKSKMIYASSKDAIKKKLTGIKHELQAN 138          
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Match: Cfl2 (cofilin 2, muscle [Source:MGI Symbol;Acc:MGI:101763])

HSP 1 Score: 53.9138 bits (128), Expect = 3.738e-9
Identity = 37/142 (26.06%), Postives = 73/142 (51.41%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIK---------MGRKYRYVLFGITEGDKLIDVTKKAPR------EATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++GV V+    + + ++K         + ++ + VLF +++  + I + ++A +        T ED      +    N   YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+  GIK   + N +D
Sbjct:    1 MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQI-IVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLD 141          
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Match: Cfl1 (cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:101757])

HSP 1 Score: 48.9062 bits (115), Expect = 3.073e-7
Identity = 38/136 (27.94%), Postives = 68/136 (50.00%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLI-----------DVTKKAPREATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIG 340
            M++GV VS    + + ++K+          ++ + VLF ++E  K I           DV +    +  Y  FV  L +   +    YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+L G
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTV--DDPYTTFVKMLPDKDCR----YALYDATYETKESKKEDLVFIFWAPENAPLKSKMIYASSKDAIKKKLTG 130          
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Match: Dstn (destrin [Source:MGI Symbol;Acc:MGI:1929270])

HSP 1 Score: 48.521 bits (114), Expect = 3.268e-7
Identity = 21/57 (36.84%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  203 YAVYEYELSEKNS---QLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            YA+Y+     K S   +L+F +W P+  P+++KM+YA S++ ++K+  GIK   +AN
Sbjct:   82 YALYDASFETKESRKEELMFFLWAPEQAPLKSKMIYASSKDAIKKKFPGIKHEYQAN 138          
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9HF97|COFI_ZYGRO (Cofilin OS=Zygosaccharomyces rouxii OX=4956 GN=cof1 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.086e-24
Identity = 47/125 (37.60%), Postives = 78/125 (62.40%), Query Frame = 2
Query:    8 TGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELS-----EKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAND 367
            +GV V+    +A+ ++K+G+KY++VL+GI+E DK   V K+     +Y++F+  L E    N  LYA+Y++E        K S+++F  W PD  PVR+KM+YA S++ LR+ L G+ + I+  D
Sbjct:    4 SGVSVADESLQAFNDLKLGKKYKFVLYGISE-DKTTIVVKETSTSQSYDEFLGKLPE----NDCLYAIYDFEYEIGGNEGKRSKIVFFTWSPDTAPVRSKMVYASSKDALRRALTGVSSDIQGTD 123          
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Match: sp|P45594|CADF_DROME (Cofilin/actin-depolymerizing factor homolog OS=Drosophila melanogaster OX=7227 GN=tsr PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.126e-22
Identity = 48/132 (36.36%), Postives = 75/132 (56.82%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYEL---------SEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDV 370
            M++GV VS  C   Y EIK  +K+RYV+F I + +K IDV   A R A Y+ F+ D+ + C   +  Y ++++E          S K  +L  + W PD   V+ KMLY+ S + L+K L+G++  I+A D+
Sbjct:    1 MASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRD-EKQIDVETVADRNAEYDQFLEDI-QKCGPGECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDL 130          
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Match: sp|Q759P0|COFI_ASHGO (Cofilin OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=COF1 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 5.886e-22
Identity = 47/125 (37.60%), Postives = 76/125 (60.80%), Query Frame = 2
Query:    8 TGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVY--EYELSE---KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAND 367
            +GV V+     A+ ++K+G+KY++VLFG+   DK   + K+   E  Y+ F+    E   ++  LYAVY  EYE+S    K S+++F  W PD  P+R+KM+YA S++ LR+ L G+ + I+  D
Sbjct:    4 SGVAVADESLTAFNDLKLGKKYKFVLFGLN-ADKTSIIVKETSNERDYDVFL----EKLPEDDCLYAVYDFEYEISGAEGKRSKIVFFTWSPDTAPIRSKMVYASSKDALRRALNGVSSDIQGTD 123          
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Match: sp|P78929|COFI_SCHPO (Cofilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cof1 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 7.913e-22
Identity = 45/123 (36.59%), Postives = 76/123 (61.79%), Query Frame = 2
Query:    8 TGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEK---NSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAND 367
            +GV VSP C EA+ E+K+G+  RYV+F + +    I V KK+  +  ++ F+ DL E   +    YA+Y++E +      +++IF+ W PDV P+++KM+Y+ S++ LR+   GI   I+A D
Sbjct:    4 SGVKVSPECLEAFQELKLGKSLRYVVFKMNDTKTEIVVEKKST-DKDFDTFLGDLPEKDCR----YAIYDFEFNLGEGVRNKIIFISWSPDVAPIKSKMVYSSSKDTLRRAFTGIGTDIQATD 121          
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Match: sp|P37167|ACTP_ACACA (Actophorin OS=Acanthamoeba castellanii OX=5755 PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 1.075e-21
Identity = 39/123 (31.71%), Postives = 73/123 (59.35%), Query Frame = 2
Query:    8 TGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQ---LIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAND 367
            +G+ VS +C + + E+K+G ++RYV F +   +  + V       ATYEDF + L E   +    YA+++YE      Q   + F++W PD  P+++KM+Y  +++ ++K+L+GI+  ++A D
Sbjct:    2 SGIAVSDDCVQKFNELKLGHQHRYVTFKMNASNTEVVVEHVGGPNATYEDFKSQLPERDCR----YAIFDYEFQVDGGQRNKITFILWAPDSAPIKSKMMYTSTKDSIKKKLVGIQVEVQATD 120          
BLAST of ADF-H domain-containing protein vs. TrEMBL
Match: C1L849 (Putative Cofilin-1 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.056e-30
Identity = 53/124 (42.74%), Postives = 85/124 (68.55%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            MSTG+    +C EAY ++K+ +KYRY+LF I    + I V  +A REA Y+DF+ DL  A    +G YAVY+YEL EK + ++F++W+P  + V+ +M+YA S+  L+ +L+G+K  ++AND++
Sbjct:    1 MSTGIKCDKSCYEAYEDLKLLKKYRYILFHIYNNQE-IKVLHRAAREANYDDFMQDLITAMNAGEGRYAVYDYELKEKVNSIVFILWVPSSLDVKVRMIYAASKSALKAKLVGVKYEVEANDLE 123          
BLAST of ADF-H domain-containing protein vs. TrEMBL
Match: A0A2H1CVR1 (Cofilin/tropomyosin-type actin-binding protein OS=Fasciola hepatica OX=6192 GN=D915_00759 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.820e-29
Identity = 52/124 (41.94%), Postives = 83/124 (66.94%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++G+  S  C +A+ ++K  + +RY+L+ I + DK I V+ +A R AT+ DF+ DL  A  + K LYAVY+YE   K   L+F+VW P  I +R KM+YA S + ++++LIG+K  I+A+D+D
Sbjct:    1 MASGIKCSDTCVDAFNDMKFRKTHRYILYEICD-DKEIRVSYRAKRSATFSDFIQDLVSARKEKKALYAVYDYESPGKMPYLVFIVWTPTDIEIRKKMIYAASTDAIKRKLIGLKTTIQAHDLD 123          
BLAST of ADF-H domain-containing protein vs. TrEMBL
Match: A0A504Z805 (Putative Cofilin actophorin OS=Fasciola gigantica OX=46835 GN=FGIG_02872 PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 5.109e-29
Identity = 52/124 (41.94%), Postives = 83/124 (66.94%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++G+  S  C +A+ ++K  + +RY+L+ I + DK I V+ +A R AT+ DF+ DL  A  + K LYAVY+YE   K   L+F+VW P  I +R KM+YA S + ++++LIG+K  I+A+D+D
Sbjct:    1 MASGIKCSDTCVDAFNDMKFRKTHRYILYEICD-DKEIRVSYRAKRSATFGDFIQDLVSARKEKKALYAVYDYESPGKMPYLVFIVWTPTDIEIRKKMIYAASTDAIKRKLIGLKTTIQAHDLD 123          
BLAST of ADF-H domain-containing protein vs. TrEMBL
Match: A0A4V3SGQ5 (ADF-H domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001624 PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 5.220e-29
Identity = 54/124 (43.55%), Postives = 83/124 (66.94%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++GV    +C +AY E+K+ + +RY+LF I   ++ I V +KA R ATYEDF  DL  A  + +G YAVY+YE+  K   LIF+ W P  + ++ K++YA S++ +R +LIGIK  ++AND+D
Sbjct:    1 MASGVKCHQSCIDAYNELKLRKNHRYILFHIRNNEE-IQVLRKADRNATYEDFYQDLITAMDEGEGRYAVYDYEVPGKLPTLIFISWNPSPLSIKTKLIYAASKDAIRLKLIGIKHEVEANDID 123          
BLAST of ADF-H domain-containing protein vs. TrEMBL
Match: A0A504Y8J6 (Putative actin-depolymerizing factor OS=Fasciola gigantica OX=46835 GN=FGIG_03015 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 6.924e-29
Identity = 55/124 (44.35%), Postives = 82/124 (66.13%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++GV    +C +AY E+K+ + +RY+LF I   ++ I V + A R ATYE+FV +L +A    +G YAV++YE   K   LIFV+W P  +  R KMLYA S++ +R +LIGIK  ++AND+D
Sbjct:    1 MASGVKCHQSCIDAYNELKLRKNWRYILFHIKNNEE-IQVLRTADRSATYENFVDELTDAENLGQGRYAVFDYECPGKLPTLIFVLWNPSSLTTRTKMLYAASKDAIRLKLIGIKHEVEANDLD 123          
BLAST of ADF-H domain-containing protein vs. Ensembl Cavefish
Match: cfl1l (cofilin-2-like [Source:NCBI gene;Acc:103024737])

HSP 1 Score: 54.299 bits (129), Expect = 2.040e-9
Identity = 38/136 (27.94%), Postives = 70/136 (51.47%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM-------GRKYRYVLFGITEGDKLIDVTKKAP---REATYEDFV-ADLNEACAQNKGLYAVYE--YELSEK-NSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAND 367
            M++GV +S    E Y +I++         +++ V+  ++E  K I V  ++    ++   ED V   +     +    YA+Y+  YE  E     L+F++W P+  P+++KM+YA S+  LR +L G+K   + ND
Sbjct:    1 MASGVAISDEVVEHYTKIRVRYQGSEEKERFKIVIMRMSEDQKSIIVDHESSLKVKDVEKEDNVFKKILSTLPEKDCRYALYDCTYETKESLKEDLVFIMWAPEDAPLKSKMVYASSKGALRSKLPGLKFEWQVND 136          
BLAST of ADF-H domain-containing protein vs. Ensembl Cavefish
Match: cfl1 (cofilin-2 [Source:NCBI gene;Acc:103047533])

HSP 1 Score: 53.1434 bits (126), Expect = 5.510e-9
Identity = 40/146 (27.40%), Postives = 72/146 (49.32%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGR----------KYRYVLFGIT---------EGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++GV V  N    + E+K+ +          + + VLF ++         EG++++   +  P    Y  FV  L      +   YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+  GIK   + N +D
Sbjct:    1 MASGVTVEENVLTIFNEMKVRKAQANEEERRKRKKAVLFCLSDDKKKIVMEEGNEILQGDEGDP----YLKFVKML----PPDDCRYALYDATYETKETKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLD 138          
BLAST of ADF-H domain-containing protein vs. Ensembl Cavefish
Match: cfl2 (cofilin 2 [Source:NCBI gene;Acc:103041014])

HSP 1 Score: 51.9878 bits (123), Expect = 1.373e-8
Identity = 40/147 (27.21%), Postives = 72/147 (48.98%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNE------AC-----AQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++GV V+    + + ++K+          ++ + VLF +++  K I V      E   +  V D+ E      AC       N   Y +Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+  GIK   + N +D
Sbjct:    1 MASGVTVNDEVIKVFNDMKVRKSSTSDEVKKRKKAVLFCLSDDKKKIIV------EEGKQILVGDIGETVDDPYACFVKLLPLNDCRYGLYDATYETKESKKEDLVFIFWAPEGAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLD 141          
BLAST of ADF-H domain-containing protein vs. Ensembl Cavefish
Match: cfl1 (cofilin-2 [Source:NCBI gene;Acc:103047533])

HSP 1 Score: 51.2174 bits (121), Expect = 4.196e-8
Identity = 23/60 (38.33%), Postives = 39/60 (65.00%), Query Frame = 2
Query:  203 YAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+  GIK   + N +D
Sbjct:  106 YALYDATYETKETKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLD 165          
BLAST of ADF-H domain-containing protein vs. Ensembl Sea Lamprey
Match: cfl1 (cofilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-215])

HSP 1 Score: 55.0694 bits (131), Expect = 2.271e-10
Identity = 46/149 (30.87%), Postives = 77/149 (51.68%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM---------GRKYRYVLFGI---------TEGDKLI--DV--TKKAPREATYEDFVADLNEACAQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++GV+VS +  + +  +K+          ++ + VLF I          EG +++  DV  T K P    Y+ FV  L     ++   YA+Y+  YE  E K   L+F+ W PD  P+++KM+YA S+E ++K+  GIK   + N +D
Sbjct:    1 MASGVLVSDDVVQIFNNMKVRKSSTPEEVKKRKKAVLFCIGPDMRNIIAEEGKEILVGDVGETVKDP----YDTFVKLL----PKDDCRYALYDATYETRETKKEDLVFIFWAPDGAPLKSKMVYASSKEAIKKKFTGIKHEWQVNGLD 141          
BLAST of ADF-H domain-containing protein vs. Ensembl Sea Lamprey
Match: cfl2 (cofilin 2 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1815])

HSP 1 Score: 54.6842 bits (130), Expect = 2.760e-10
Identity = 39/143 (27.27%), Postives = 69/143 (48.25%), Query Frame = 2
Query:    5 STGVVVSPNCAEAYGEIK---------MGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQ-----------NKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            ++GV VS +    + ++K         + ++ + VLF +++  + I V      E + +  V D+ E               N   YA+Y+  YE  E K   L+FV W PD  P+++KM+YA S++ ++K+  GIK   + N
Sbjct:    2 ASGVSVSDDVIRVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIV------ETSRQILVGDIGETVEDPYGAFVKLLPLNDCRYALYDATYETRESKKEDLVFVFWAPDSAPLKSKMIYASSKDAIKKKFTGIKHEWQVN 138          
BLAST of ADF-H domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007240.1 (pep scaffold:Pmarinus_7.0:GL476479:38272:39885:-1 gene:ENSPMAG00000006535.1 transcript:ENSPMAT00000007240.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 3.952e-10
Identity = 40/143 (27.97%), Postives = 69/143 (48.25%), Query Frame = 2
Query:    5 STGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEAC-----------AQNKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            ++GV VS +    + ++K+          ++ + VLF ++   K I V      E   E  V D+ ++              N   YA+Y+  YE +E K   L+FV W PD  P+++KM+YA S++ ++K+  GIK   + N
Sbjct:    2 ASGVAVSDDVIRVFNDMKVRKASSAEEVKKRKKAVLFCLSPDKKQIIV------EPAKEILVGDIGQSVDDPYGAFVKLLPPNDCRYALYDATYETNESKKEDLVFVFWAPDSAPLKSKMIYASSKDAIKKKFTGIKHEWQVN 138          
BLAST of ADF-H domain-containing protein vs. Ensembl Yeast
Match: COF1 (Cofilin, involved in pH-dependent actin filament depolarization; binds both actin monomers and filaments and severs filaments; involved in the selective sorting, export of the secretory cargo from the late golgi; genetically interacts with pmr1; thought to be regulated by phosphorylation at SER4; ubiquitous and essential in eukaryotes [Source:SGD;Acc:S000003973])

HSP 1 Score: 88.1965 bits (217), Expect = 2.355e-23
Identity = 42/125 (33.60%), Postives = 74/125 (59.20%), Query Frame = 2
Query:    8 TGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELS-----EKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAND 367
            +GV V+     A+ ++K+G+KY+++LFG+ +    I V K+   + +Y+ F+    E   +N  LYA+Y++E        K S+++F  W PD  PVR+KM+YA S++ LR+ L G+   ++  D
Sbjct:    4 SGVAVADESLTAFNDLKLGKKYKFILFGLNDAKTEI-VVKETSTDPSYDAFL----EKLPENDCLYAIYDFEYEINGNEGKRSKIVFFTWSPDTAPVRSKMVYASSKDALRRALNGVSTDVQGTD 123          
BLAST of ADF-H domain-containing protein vs. Ensembl Nematostella
Match: EDO45331 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT59])

HSP 1 Score: 48.1358 bits (113), Expect = 3.426e-7
Identity = 33/114 (28.95%), Postives = 57/114 (50.00%), Query Frame = 2
Query:    8 TGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQ---LIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIG 340
            TG+  S +    +   K G   R +  GI E ++LI +T   P++    D+   +     + +  Y +Y   L  KN+Q    +F+ + PD  P+R KML+AG++  L+K+  G
Sbjct:    5 TGIQASEDLKSVFARSKDG-DIRMIKVGI-ENEELICITTTEPKKDWERDYDDAVVRHLEEKQPCYILYR--LDSKNNQGYEWLFIAYSPDFSPIRQKMLFAGTRATLKKEFGG 114          
BLAST of ADF-H domain-containing protein vs. Ensembl Nematostella
Match: EDO43372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYS8])

HSP 1 Score: 44.2838 bits (103), Expect = 3.021e-6
Identity = 28/137 (20.44%), Postives = 67/137 (48.91%), Query Frame = 2
Query:    8 TGVVVSPNCAEAYGEIKMGRK------YRYVLFGITEGDKLIDVTKK------APREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQL----IFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDV 370
            +G+ ++  C E + ++K+  K      ++Y +F +++ +  +++ +K      A      E+   +L    ++ +  + +Y+     K+  L    IF+ W  D  P++ KML   + E L+K+  G+K   +A+++
Sbjct:    6 SGIEMTEECIELFKDMKITTKGADRPRFKYAIFKLSDDNTKVELEEKVEAKCLANNREEDEEIFEELKGKLSKKEPRFILYDMRFCSKSGSLKEILIFIKWCSDEAPIKKKMLAGSTWEYLKKKFDGLKKYFEASEI 142          
BLAST of ADF-H domain-containing protein vs. Ensembl Medaka
Match: cfl2 (cofilin-2 [Source:NCBI gene;Acc:101159957])

HSP 1 Score: 53.5286 bits (127), Expect = 4.007e-9
Identity = 39/147 (26.53%), Postives = 70/147 (47.62%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM---------GRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQ-----------NKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++GV V+      + ++K+          ++ + V+F ++E  K I V      E   +  V D+ E               N   YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+  GIK   + N +D
Sbjct:    1 MASGVTVTDEVIRVFNDMKVRKSSTQDEVKKRKKAVMFCMSEDKKNIIV------EDGKQILVGDIGETVDDPYLCFVKLLPPNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLD 141          
BLAST of ADF-H domain-containing protein vs. Ensembl Medaka
Match: cfl2 (cofilin-2 [Source:NCBI gene;Acc:101159957])

HSP 1 Score: 51.2174 bits (121), Expect = 2.988e-8
Identity = 24/64 (37.50%), Postives = 40/64 (62.50%), Query Frame = 2
Query:  191 NKGLYAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            N   YA+Y+  YE  E K   L+F+ W P+  P+++KM+YA S++ ++K+  GIK   + N +D
Sbjct:   78 NDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLD 141          
BLAST of ADF-H domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000014865.2 (cofilin-2 [Source:NCBI gene;Acc:101164501])

HSP 1 Score: 49.6766 bits (117), Expect = 1.100e-7
Identity = 37/136 (27.21%), Postives = 63/136 (46.32%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKM-------GRKYRYVLFGITEGDKLIDVTKKAPREATY--EDFVADLNEACAQNKGLYAVYEYELSEKNS----QLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDV 370
            M++GV V  +      E+K+         + R V+  I +G     V +K  RE     +D           ++  Y +Y+     K S    +L+FV+W P+   ++ KM YA S++ L+K L GIK  ++ ND+
Sbjct:    1 MASGVQVHDDVKTIMDEMKVVKADSDQNERIRLVVLEIKDG---FIVIEKVLREKDLANQDVFKQFLSLLEPSRCCYILYDCHFETKESSRKEELVFVMWAPETGHIKEKMRYASSKDSLKKILTGIKHELQMNDL 133          
BLAST of ADF-H domain-containing protein vs. Ensembl Medaka
Match: cfl1 (cofilin 1 [Source:NCBI gene;Acc:101173715])

HSP 1 Score: 49.2914 bits (116), Expect = 1.580e-7
Identity = 22/57 (38.60%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  203 YAVYE--YELSE-KNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKAN 364
            YA+Y+  YE  E K   L+F+ W PD  P+++KM+YA S++ ++++  GIK   + N
Sbjct:   83 YALYDATYETKETKKEDLVFIFWAPDSAPLKSKMIYASSKDAIKRKFEGIKHEWQVN 139          
BLAST of ADF-H domain-containing protein vs. Planmine SMEST
Match: SMESG000080129.1 (SMESG000080129.1)

HSP 1 Score: 255.373 bits (651), Expect = 1.495e-88
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD
Sbjct:    1 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 124          
BLAST of ADF-H domain-containing protein vs. Planmine SMEST
Match: SMESG000022423.1 (SMESG000022423.1)

HSP 1 Score: 67.781 bits (164), Expect = 7.996e-15
Identity = 36/124 (29.03%), Postives = 68/124 (54.84%), Query Frame = 2
Query:    2 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVD 373
            M++GV   P+  E    IK+  K++Y+++G+ +    I   +       YE F   + E  A+ +G YA+Y+Y+       L F+ WIP+ + + ++M+ A S+  +  +++G+KA I+AN  D
Sbjct:    1 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAK-EGCYALYDYQ-----GTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSED 118          
BLAST of ADF-H domain-containing protein vs. Planmine SMEST
Match: SMESG000045466.1 (SMESG000045466.1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.791e-10
Identity = 21/53 (39.62%), Postives = 36/53 (67.92%), Query Frame = 2
Query:  188 QNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIK 346
            +  G YA+++Y L  K   LIF+ WIP  +PV+ +M+ A S++ ++K+L GI+
Sbjct:    5 KKDGAYAIFDYPLENKGDLLIFICWIPIDLPVKKRMILASSKDAIKKKLKGIR 57          
BLAST of ADF-H domain-containing protein vs. Planmine SMEST
Match: SMESG000045466.1 (SMESG000045466.1)

HSP 1 Score: 53.5286 bits (127), Expect = 5.350e-10
Identity = 21/53 (39.62%), Postives = 36/53 (67.92%), Query Frame = 2
Query:  188 QNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIK 346
            +  G YA+++Y L  K   LIF+ WIP  +PV+ +M+ A S++ ++K+L GI+
Sbjct:    7 KKDGAYAIFDYPLENKGDLLIFICWIPIDLPVKKRMILASSKDAIKKKLKGIR 59          
The following BLAST results are available for this feature:
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFL14.954e-1027.86cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874][more]
CFL16.105e-1028.47cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874][more]
CFL16.105e-1028.47cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874][more]
CFL11.708e-942.11cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874][more]
CFL13.616e-942.11cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874][more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
unc-601.848e-1330.23Actin-depolymerizing factor 2, isoform c [Source:... [more]
F53E2.22.788e-826.32Actin-depolymerizing factor 1, isoforms a/b [Sour... [more]
F53E2.22.788e-826.32Actin-depolymerizing factor 1, isoforms a/b [Sour... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tsr4.116e-2336.36gene:FBgn0011726 transcript:FBtr0072188[more]
CG68732.398e-1729.01gene:FBgn0030951 transcript:FBtr0074607[more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfl16.241e-926.76cofilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-215][more]
cfl21.157e-827.21cofilin 2 (muscle) [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
cfl1l4.919e-639.66cofilin 1 (non-muscle), like [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zc4h23.537e-1029.05zinc finger, C4H2 domain containing [Source:Xenbas... [more]
zc4h21.800e-832.52zinc finger, C4H2 domain containing [Source:Xenbas... [more]
oat.28.634e-827.78ornithine aminotransferase, gene 2 [Source:Xenbase... [more]
oat.25.528e-727.27ornithine aminotransferase, gene 2 [Source:Xenbase... [more]
slc1a25.769e-627.78solute carrier family 1 member 2 [Source:Xenbase;A... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfl19.549e-1029.17cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:1... [more]
Cfl12.162e-929.17cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:1... [more]
Cfl23.738e-926.06cofilin 2, muscle [Source:MGI Symbol;Acc:MGI:10176... [more]
Cfl13.073e-727.94cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:1... [more]
Dstn3.268e-736.84destrin [Source:MGI Symbol;Acc:MGI:1929270][more]
back to top
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HF97|COFI_ZYGRO1.086e-2437.60Cofilin OS=Zygosaccharomyces rouxii OX=4956 GN=cof... [more]
sp|P45594|CADF_DROME4.126e-2236.36Cofilin/actin-depolymerizing factor homolog OS=Dro... [more]
sp|Q759P0|COFI_ASHGO5.886e-2237.60Cofilin OS=Ashbya gossypii (strain ATCC 10895 / CB... [more]
sp|P78929|COFI_SCHPO7.913e-2236.59Cofilin OS=Schizosaccharomyces pombe (strain 972 /... [more]
sp|P37167|ACTP_ACACA1.075e-2131.71Actophorin OS=Acanthamoeba castellanii OX=5755 PE=... [more]
back to top
BLAST of ADF-H domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1L8491.056e-3042.74Putative Cofilin-1 OS=Schistosoma japonicum OX=618... [more]
A0A2H1CVR11.820e-2941.94Cofilin/tropomyosin-type actin-binding protein OS=... [more]
A0A504Z8055.109e-2941.94Putative Cofilin actophorin OS=Fasciola gigantica ... [more]
A0A4V3SGQ55.220e-2943.55ADF-H domain-containing protein OS=Opisthorchis fe... [more]
A0A504Y8J66.924e-2944.35Putative actin-depolymerizing factor OS=Fasciola g... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cfl1l2.040e-927.94cofilin-2-like [Source:NCBI gene;Acc:103024737][more]
cfl15.510e-927.40cofilin-2 [Source:NCBI gene;Acc:103047533][more]
cfl21.373e-827.21cofilin 2 [Source:NCBI gene;Acc:103041014][more]
cfl14.196e-838.33cofilin-2 [Source:NCBI gene;Acc:103047533][more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfl12.271e-1030.87cofilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-215][more]
cfl22.760e-1027.27cofilin 2 (muscle) [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
ENSPMAT00000007240.13.952e-1027.97pep scaffold:Pmarinus_7.0:GL476479:38272:39885:-1 ... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
COF12.355e-2333.60Cofilin, involved in pH-dependent actin filament d... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO453313.426e-728.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433723.021e-620.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cfl24.007e-926.53cofilin-2 [Source:NCBI gene;Acc:101159957][more]
cfl22.988e-837.50cofilin-2 [Source:NCBI gene;Acc:101159957][more]
ENSORLT00000014865.21.100e-727.21cofilin-2 [Source:NCBI gene;Acc:101164501][more]
cfl11.580e-738.60cofilin 1 [Source:NCBI gene;Acc:101173715][more]
back to top
BLAST of ADF-H domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000080129.11.495e-88100.00SMESG000080129.1[more]
SMESG000022423.17.996e-1529.03SMESG000022423.1[more]
SMESG000045466.14.791e-1039.62SMESG000045466.1[more]
SMESG000045466.15.350e-1039.62SMESG000045466.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001490 ID=SMED30001490|Name=ADF-H domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=507bp
AATGTCTACTGGAGTTGTCGTGTCGCCGAATTGTGCTGAAGCATATGGAG
AAATAAAAATGGGACGAAAGTACAGATATGTACTTTTTGGTATTACAGAG
GGAGATAAATTAATTGATGTGACTAAAAAAGCTCCTCGAGAAGCAACATA
TGAAGACTTTGTGGCTGATTTAAATGAGGCTTGTGCGCAGAATAAAGGTT
TATATGCCGTTTATGAATACGAATTATCTGAAAAGAATAGCCAGCTGATT
TTTGTTGTATGGATTCCAGATGTTATTCCAGTAAGAGCCAAAATGTTATA
TGCTGGCTCGCAAGAAGGATTAAGAAAACAACTAATTGGCATAAAAGCTG
TTATTAAAGCTAATGATGTTGATGAAATCAGTAAGGAAGAAATTGAAGCC
AAACTAAAATGATTGAAATTTAATGGTACTTATGTGAAACAAATGAAGAG
TTTGCTGTTTTCTATGATCGTTTTTTAATTAAATACATTTTGAACATAAT
AATAAAA
back to top

protein sequence of SMED30001490-orf-1

>SMED30001490-orf-1 ID=SMED30001490-orf-1|Name=SMED30001490-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=137bp
MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATY
EDFVADLNEACAQNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLY
AGSQEGLRKQLIGIKAVIKANDVDEISKEEIEAKLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0015629actin cytoskeleton
Vocabulary: INTERPRO
TermDefinition
IPR017904ADF/Cofilin
IPR002108ADF-H
IPR029006ADF-H/Gelsolin-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0030042actin filament depolymerization