Tudor domain-containing protein 12

Overview
NameTudor domain-containing protein 12
Smed IDSMED30001485
Length (bp)5107
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tudor domain-containing protein 12 (SMED30001485) t-SNE clustered cells

Violin plots show distribution of expression levels for Tudor domain-containing protein 12 (SMED30001485) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tudor domain-containing protein 12 (SMED30001485) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tudor domain-containing protein 12 (SMED30001485) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001485

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30001485h1SMcG0009920 SmedASXL_016033SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30001485h1SMcG0009920 SmedASXL_016033SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30001485h1SMcG0009920 Contig48927newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001485h1SMcG0009920 Contig48927uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30001485h1SMcG0009920 dd_Smed_v4_4638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001485h1SMcG0009920 dd_Smed_v4_4638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30001485h1SMcG0009920 dd_Smed_v4_4638_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tudor domain-containing protein 12 vs. Ensembl Human
Match: TDRD12 (tudor domain containing 12 [Source:HGNC Symbol;Acc:HGNC:25044])

HSP 1 Score: 173.711 bits (439), Expect = 7.382e-43
Identity = 188/733 (25.65%), Postives = 323/733 (44.07%), Query Frame = 3
Query:  954 VRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLL--MPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEIL--IYKRTGAIDRGSEPSQFITATV-WTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDIL-IYNAEIILHVD--VSEPSFGNRLNFLRDKYAKLSFLKSRNEPIE----KCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPG-CVKRHMVLSDIDKP------LLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKMKSNQSGGYVK---VKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVP 3086
            ++P L+  +  L A  LK+A+ ++        +SY  P I RG + + I+       + LL  + VLQT A  +  PSR   PLA+I+C  WKK   +    E    + + S  +    +    +    K T +P  +GCDV++ TP  LL  L       L    +  LD+ E +  E  E +  IL    K     +R S P Q +   V W   +E  +K  M D + I +    E A+   V+Q +  +  +E +    L+  L+   S  ++T+IF  +  +  +V K +   +   LKM    +    L  ++ +W +     +  IL ++D+   C  +L I +A  ++H     S   FG RL  + D      F   +  P E    K  S + +  T  +   A  + R+L R  +  P  L E +   +  KE  K    +CP +K FG CK    C  RH +  + D P       LP+ G+I+    Y+++ +++F RI +          +   Y +L  +M  YF +    +   +  V    L  +  K L  RV V ++   +    +    V+ ID+G   +V +  LL LP+    +PPQA+E  V  ++P DN+  ++ +   + +  +  K   A + L +G+T+WID +    + +  + +V D N+   +L   +   N +HIE+L +L   + D   P+ EES  +  P
Sbjct:  412 IKPCLTIDSSPLSAD-LKKALQRNKFPGPSHTESYSWPPIARGCDVVVISHCESNPLLYLLPVLTVLQTGACYKSLPSRN-GPLAVIVCPGWKKAQFIF---ELLGEYSMSSRPLHPVLLTIGLHKEEAKNTKLP--RGCDVIVTTPYSLLRLLACQSLLFLRLCHLI-LDEVEVLFLEANEQMFAILDNFKKNIEVEERESAPHQIVAVGVHWNKHIEHLIKEFMNDPY-IVITAMEEAALYGNVQQVV--HLCLECEKTSSLLQALDFIPSQAQKTLIFTCSVAETEIVCKVVESSSIFCLKMHKEMIF--NLQNVLEQWKKKLSSGSQIILALTDD---CVPLLAITDATCVIHFSFPASPKVFGGRLYCMSDH-----FHAEQGSPAEQGDKKAKSVLLL--TEKDASHAVGVLRYLERADAKVPAELYEFTAGVLEAKEDKKAGRPLCPYLKAFGFCKDKRICPDRHRINPETDLPRKLSSQALPSFGYIKIIPFYILNATNYFGRIVD---------KHMDLYATLNAEMNEYFKDS---NKTTVEKVEKFGLYGLAEKTLFHRVQVLEVNQKEDAWALDDILVEFIDEGRTGLVTRDQLLHLPEHFHTLPPQAVEFIVCRVKPADNEIEWNPKVTRYIHHKIVGKLHDAKVILALGNTVWIDPMVHITNLSSLKTSVIDYNVRAEILSMGMGIDNPEHIEQLKKL---REDAKIPACEESLSQTPP 1106          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Human
Match: TDRD12 (tudor domain containing 12 [Source:HGNC Symbol;Acc:HGNC:25044])

HSP 1 Score: 169.474 bits (428), Expect = 1.844e-41
Identity = 187/738 (25.34%), Postives = 322/738 (43.63%), Query Frame = 3
Query:  954 VRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLL--MPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEIL--IYKRTGAIDRGSEPSQFITATV-WTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDIL-IYNAEIILHVD--VSEPSFGNRLNFLRDKYAKLSFLKSRNEPIE----KCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECK------LPGCVKRHMVLSDIDKP------LLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKMKSNQSGGYVK---VKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVP 3086
            ++P L+  +  L A  LK+A+ ++        +SY  P I RG + + I+       + LL  + VLQT A  +  PSR   PLA+I+C  WKK   +    E    + + S  +    +    +    K T +P  +GCDV++ TP  LL  L       L    +  LD+ E +  E  E +  IL    K     +R S P Q +   V W   +E  +K  M D + I +    E A+   V+Q +  +  +E +    L+  L+   S  ++T+IF  +  +  +V K +   +   LKM    +    L  ++ +W +     +  IL ++D+   C  +L I +A  ++H     S   FG RL  + D      F   +  P E    K  S + +  T  +   A  + R+L R  +  P  L E +   +  KE  K    +CP +K FG C          C  RH +  + D P       LP+ G+I+    Y+++ +++F RI +          +   Y +L  +M  YF +    +   +  V    L  +  K L  RV V ++   +    +    V+ ID+G   +V +  LL LP+    +PPQA+E  V  ++P DN+  ++ +   + +  +  K   A + L +G+T+WID +    + +  + +V D N+   +L   +   N +HIE+L +L   + D   P+ EES  +  P
Sbjct:  412 IKPCLTIDSSPLSAD-LKKALQRNKFPGPSHTESYSWPPIARGCDVVVISHCESNPLLYLLPVLTVLQTGACYKSLPSRN-GPLAVIVCPGWKKAQFIF---ELLGEYSMSSRPLHPVLLTIGLHKEEAKNTKLP--RGCDVIVTTPYSLLRLLACQSLLFLRLCHLI-LDEVEVLFLEANEQMFAILDNFKKNIEVEERESAPHQIVAVGVHWNKHIEHLIKEFMNDPY-IVITAMEEAALYGNVQQVV--HLCLECEKTSSLLQALDFIPSQAQKTLIFTCSVAETEIVCKVVESSSIFCLKMHKEMIF--NLQNVLEQWKKKLSSGSQIILALTDD---CVPLLAITDATCVIHFSFPASPKVFGGRLYCMSD-----HFHAEQGSPAEQGDKKAKSVLLL--TEKDASHAVGVLRYLERADAKVPAELYEFTAGVLEAKEDKKAGRPLCPYLKAFGFCNHFIFRDKRICPDRHRINPETDLPRKLSSQALPSFGYIKIIPFYILNATNYFGRIVD---------KHMDLYATLNAEMNEYFKDS---NKTTVEKVEKFGLYGLAEKTLFHRVQVLEVNQKEDAWALDDILVEFIDEGRTGLVTRDQLLHLPEHFHTLPPQAVEFIVCRVKPADNEIEWNPKVTRYIHHKIVGKLHDAKVILALGNTVWIDPMVHITNLSSLKTSVIDYNVRAEILSMGMGIDNPEHIEQLKKL---REDAKIPACEESLSQTPP 1111          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Human
Match: TDRD12 (tudor domain containing 12 [Source:HGNC Symbol;Acc:HGNC:25044])

HSP 1 Score: 67.781 bits (164), Expect = 5.778e-11
Identity = 48/175 (27.43%), Postives = 87/175 (49.71%), Query Frame = 3
Query: 2571 LAAIKIKDLLERVVVSKMKSNQSGGYVK---VKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVP 3086
            L  +  K L  RV V ++   +    +    V+ ID+G   +V +  LL LP+    +PPQA+E  V  ++P DN+  ++ +   + +  +  K   A + L +G+T+WID +    + +  + +V D N+   +L   +   N +HIE+L +L   + D   P+ EES  +  P
Sbjct:   11 LYGLAEKTLFHRVQVLEVNQKEDAWALDDILVEFIDEGRTGLVTRDQLLHLPEHFHTLPPQAVEFIVCRVKPADNEIEWNPKVTRYIHHKIVGKLHDAKVILALGNTVWIDPMVHITNLSSLKTSVIDYNVRAEILSMGMGIDNPEHIEQLKKL---REDAKIPACEESLSQTPP 182          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Human
Match: DDX41 (DEAD-box helicase 41 [Source:HGNC Symbol;Acc:HGNC:18674])

HSP 1 Score: 60.4622 bits (145), Expect = 2.443e-8
Identity = 84/357 (23.53%), Postives = 144/357 (40.34%), Query Frame = 3
Query:  894 WTVQKY-------RTENETTDFNYL----GSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTI--ATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLET-LQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVN--DPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYR 1916
            WT  +Y       R E     ++ L    G   PI S+K  K  A  L+  + K        IQ   IP IL G + + IA    GK++   +PV+       K+L  S+   P  +I+C S +   +     E + R ++  D     R      G   K  M  +  G  +++ TP  L+  L Q +   L+      LD+A+ +I    E  ++ I  Y       +G   +   +AT+   +++++ K  +    +I V       L VI+ V     EY   E     K+V  LE  + +    +IFA    D+  +++YL+ K  V+   + G    EE    +  + + +
Sbjct:  146 WTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMKFPAAILR-GLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCR-LLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLL-QKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYF------KGQRQTLLFSATM-PKKIQNFAKSALVKPVTINVGRAGAASLDVIQEV-----EYVKEEA----KMVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKG-VEAVAIHGGKDQEERTKAIEAFREGK 482          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Human
Match: DDX4 (DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:18700])

HSP 1 Score: 58.151 bits (139), Expect = 1.117e-7
Identity = 46/175 (26.29%), Postives = 84/175 (48.00%), Query Frame = 3
Query:  963 ILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSR---TYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENII 1478
            IL+++   L  T L   ++K     L  +Q Y IP IL G + +A A    GK+   L+P+L  +    ++ SR      P  II+  + + V+++   A KF+            R V  Y G+    ++  ++QGC++L  TP  L+  + + E   L +++   LD+A+ ++
Sbjct:  138 ILTFEEANLCQT-LNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTC-------VRAVVIYGGTQLGHSIRQIVQGCNILCATPGRLMDIIGK-EKIGLKQIKYLVLDEADRML 303          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0301947)

HSP 1 Score: 68.5514 bits (166), Expect = 3.608e-11
Identity = 85/364 (23.35%), Postives = 159/364 (43.68%), Query Frame = 3
Query:  894 WTVQKYRTENETTDFNYLGSV-RPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLE-TLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQK-LVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDI 1976
            + VQ+YR E E T     G V  PI  +    L    +KE + +   K    IQ+   P  + G N + IA    GK++G ++P +  I  +Q    R   P+A++L  + +   ++   A +F      S  VR       + G+ K   M  + +GC+++I TP  L+ +L       L       LD+A+ ++    E  +++I+   R    DR +     + +  W   ++   +  +G+   I +   LEL+    ++Q +   ++   +   K L++ +  T  S  + IIF  T   +  + +++ +   V    + G  S  E + ++RE+    G  N  IL+ +D A R  D+
Sbjct:  115 YEVQRYREEQEIT---VRGQVPNPIQDFSEVHLPDYVMKE-IRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQ-PLQRGDGPIALVLAPTRELAQQIQQVATEFG----SSSYVRN---TCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGS-TNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRP---DRQT----LMWSATWPKEVKQLAEDFLGNYIQINIGS-LELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFI-RSFGVRCGAIHGDKSQSERDFVLREFRS--GKSN--ILVATDVAARGLDV 452          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078650)

HSP 1 Score: 68.5514 bits (166), Expect = 3.608e-11
Identity = 85/364 (23.35%), Postives = 159/364 (43.68%), Query Frame = 3
Query:  894 WTVQKYRTENETTDFNYLGSV-RPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLE-TLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQK-LVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDI 1976
            + VQ+YR E E T     G V  PI  +    L    +KE + +   K    IQ+   P  + G N + IA    GK++G ++P +  I  +Q    R   P+A++L  + +   ++   A +F      S  VR       + G+ K   M  + +GC+++I TP  L+ +L       L       LD+A+ ++    E  +++I+   R    DR +     + +  W   ++   +  +G+   I +   LEL+    ++Q +   ++   +   K L++ +  T  S  + IIF  T   +  + +++ +   V    + G  S  E + ++RE+    G  N  IL+ +D A R  D+
Sbjct:  115 YEVQRYREEQEIT---VRGQVPNPIQDFSEVHLPDYVMKE-IRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQ-PLQRGDGPIALVLAPTRELAQQIQQVATEFG----SSSYVRN---TCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGS-TNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRP---DRQT----LMWSATWPKEVKQLAEDFLGNYIQINIGS-LELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFI-RSFGVRCGAIHGDKSQSERDFVLREFRS--GKSN--ILVATDVAARGLDV 452          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078649)

HSP 1 Score: 68.5514 bits (166), Expect = 3.884e-11
Identity = 85/364 (23.35%), Postives = 159/364 (43.68%), Query Frame = 3
Query:  894 WTVQKYRTENETTDFNYLGSV-RPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLE-TLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQK-LVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDI 1976
            + VQ+YR E E T     G V  PI  +    L    +KE + +   K    IQ+   P  + G N + IA    GK++G ++P +  I  +Q    R   P+A++L  + +   ++   A +F      S  VR       + G+ K   M  + +GC+++I TP  L+ +L       L       LD+A+ ++    E  +++I+   R    DR +     + +  W   ++   +  +G+   I +   LEL+    ++Q +   ++   +   K L++ +  T  S  + IIF  T   +  + +++ +   V    + G  S  E + ++RE+    G  N  IL+ +D A R  D+
Sbjct:  118 YEVQRYREEQEIT---VRGQVPNPIQDFSEVHLPDYVMKE-IRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQ-PLQRGDGPIALVLAPTRELAQQIQQVATEFG----SSSYVRN---TCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGS-TNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRP---DRQT----LMWSATWPKEVKQLAEDFLGNYIQINIGS-LELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFI-RSFGVRCGAIHGDKSQSERDFVLREFRS--GKSN--ILVATDVAARGLDV 455          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078651)

HSP 1 Score: 68.5514 bits (166), Expect = 3.884e-11
Identity = 85/364 (23.35%), Postives = 159/364 (43.68%), Query Frame = 3
Query:  894 WTVQKYRTENETTDFNYLGSV-RPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLE-TLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQK-LVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDI 1976
            + VQ+YR E E T     G V  PI  +    L    +KE + +   K    IQ+   P  + G N + IA    GK++G ++P +  I  +Q    R   P+A++L  + +   ++   A +F      S  VR       + G+ K   M  + +GC+++I TP  L+ +L       L       LD+A+ ++    E  +++I+   R    DR +     + +  W   ++   +  +G+   I +   LEL+    ++Q +   ++   +   K L++ +  T  S  + IIF  T   +  + +++ +   V    + G  S  E + ++RE+    G  N  IL+ +D A R  D+
Sbjct:  118 YEVQRYREEQEIT---VRGQVPNPIQDFSEVHLPDYVMKE-IRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQ-PLQRGDGPIALVLAPTRELAQQIQQVATEFG----SSSYVRN---TCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGS-TNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRP---DRQT----LMWSATWPKEVKQLAEDFLGNYIQINIGS-LELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFI-RSFGVRCGAIHGDKSQSERDFVLREFRS--GKSN--ILVATDVAARGLDV 455          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078654)

HSP 1 Score: 68.5514 bits (166), Expect = 3.884e-11
Identity = 85/364 (23.35%), Postives = 159/364 (43.68%), Query Frame = 3
Query:  894 WTVQKYRTENETTDFNYLGSV-RPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLE-TLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQK-LVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDI 1976
            + VQ+YR E E T     G V  PI  +    L    +KE + +   K    IQ+   P  + G N + IA    GK++G ++P +  I  +Q    R   P+A++L  + +   ++   A +F      S  VR       + G+ K   M  + +GC+++I TP  L+ +L       L       LD+A+ ++    E  +++I+   R    DR +     + +  W   ++   +  +G+   I +   LEL+    ++Q +   ++   +   K L++ +  T  S  + IIF  T   +  + +++ +   V    + G  S  E + ++RE+    G  N  IL+ +D A R  D+
Sbjct:  118 YEVQRYREEQEIT---VRGQVPNPIQDFSEVHLPDYVMKE-IRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQ-PLQRGDGPIALVLAPTRELAQQIQQVATEFG----SSSYVRN---TCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGS-TNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRP---DRQT----LMWSATWPKEVKQLAEDFLGNYIQINIGS-LELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFI-RSFGVRCGAIHGDKSQSERDFVLREFRS--GKSN--ILVATDVAARGLDV 455          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Zebrafish
Match: tdrd12 (tudor domain containing 12 [Source:ZFIN;Acc:ZDB-GENE-121214-348])

HSP 1 Score: 146.362 bits (368), Expect = 1.441e-34
Identity = 163/701 (23.25%), Postives = 311/701 (44.37%), Query Frame = 3
Query: 1032 KFLL--------IIQSYMIPNILRGFNTLAIA----------PPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAE--KFTRFI--------IDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIY--KRTGAIDRGSEPSQFIT-ATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDV-SEPS-FGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPG-CVKRHMVLSDIDKPLLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHV----GLLAAIKIKDLLERVVVSKM--KSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKL 3014
            KFLL        + +SY  P + RGF+T+ ++          PP       LLM +LQT++      +RT  P+A+ILC  W+KV  + +  E  K T  +        +D D+ ++ +I                 + C +L+ TP  LL  L+   F  L    +  LD+A+ + ++  + +  IL +  +   A +R + P Q I     W++ ++  V+  M    ++ +    E A+  RV Q++    D   D    L++ L+      ++T+I  ++ ++   VYK ++  A   LK    +   ++ + ++ +W +        IL+ +++ L+   + I +A  ++H    S P  FG+RL  + + + KLS +    +      S + +  +  N+R    + R+L R G+  P  L + ++     KE+ K    +C  +K FG C+    C  RH + + +D+  LP+ G I    L++ + S +  RI                 +  K  +      QM +H  + R   V    G L AI+ ++   RV V ++  K  Q    V   LID+G    V+   LLQLP +  ++P QA+E  +  ++P+D +  ++ +     +  +  K   A + + +G+T+W+D + + +     +  + + N+   +L       N QH++ L
Sbjct:  446 KFLLWRKYSGPNVAESYCWPAVARGFDTVLVSHSGDNPLSYIPP-------LLM-ILQTVSVVSSLAART-GPVAVILCPGWEKVQTVLELLEDSKATHGLHPTSVLLGVDQDEPKKFKI----------------QKNCQLLVTTPFSLLRLLEAQCFLFLRLCHLV-LDEADLLYSQAPDQISIILKHFQQLVCAEERVACPRQIIAVGGRWSAGIDGLVREHMIHP-TVIITVMEEAALYGRVHQRVQLCLDC--DKVSVLLSSLDFQPPKPQKTLIITNSAEETEHVYKAVVNTAVFTLKAHEDAT--DQFDFIIDQWRKDISQGTQVILVTTNDCLKA--LGIRDATCVVHYGFPSTPKLFGSRLFCMSENFRKLSDMDHSEDWTPGAQSVLLL--SEQNVRHVCGVLRYLRRTGALLPPELLQFALGIQQAKEEQKTHRPLCCSLKSFGFCRDSTVCPDRHTINTSLDQTQLPDSGMIMVLPLFIKTASVYCGRI-----------------VRQKEDLYEDLATQMKLHYASERRCAVEVLKGALYAIQEENCYHRVRVLEVPEKGEQLFSSVTACLIDEGRTQEVKSHQLLQLPAQFQDLPGQAVEIILCRVQPVDGEVDWNPKVTRAVSLKIRGKLHQARVVMSLGNTIWVDPMVRMVRVPGLKTFINEYNVHTEILASGFGVSNPQHVDLL 1094          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Zebrafish
Match: tdrd12 (tudor domain containing 12 [Source:ZFIN;Acc:ZDB-GENE-121214-348])

HSP 1 Score: 146.362 bits (368), Expect = 1.571e-34
Identity = 163/701 (23.25%), Postives = 311/701 (44.37%), Query Frame = 3
Query: 1032 KFLL--------IIQSYMIPNILRGFNTLAIA----------PPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAE--KFTRFI--------IDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIY--KRTGAIDRGSEPSQFIT-ATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDV-SEPS-FGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPG-CVKRHMVLSDIDKPLLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHV----GLLAAIKIKDLLERVVVSKM--KSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKL 3014
            KFLL        + +SY  P + RGF+T+ ++          PP       LLM +LQT++      +RT  P+A+ILC  W+KV  + +  E  K T  +        +D D+ ++ +I                 + C +L+ TP  LL  L+   F  L    +  LD+A+ + ++  + +  IL +  +   A +R + P Q I     W++ ++  V+  M    ++ +    E A+  RV Q++    D   D    L++ L+      ++T+I  ++ ++   VYK ++  A   LK    +   ++ + ++ +W +        IL+ +++ L+   + I +A  ++H    S P  FG+RL  + + + KLS +    +      S + +  +  N+R    + R+L R G+  P  L + ++     KE+ K    +C  +K FG C+    C  RH + + +D+  LP+ G I    L++ + S +  RI                 +  K  +      QM +H  + R   V    G L AI+ ++   RV V ++  K  Q    V   LID+G    V+   LLQLP +  ++P QA+E  +  ++P+D +  ++ +     +  +  K   A + + +G+T+W+D + + +     +  + + N+   +L       N QH++ L
Sbjct:  487 KFLLWRKYSGPNVAESYCWPAVARGFDTVLVSHSGDNPLSYIPP-------LLM-ILQTVSVVSSLAART-GPVAVILCPGWEKVQTVLELLEDSKATHGLHPTSVLLGVDQDEPKKFKI----------------QKNCQLLVTTPFSLLRLLEAQCFLFLRLCHLV-LDEADLLYSQAPDQISIILKHFQQLVCAEERVACPRQIIAVGGRWSAGIDGLVREHMIHP-TVIITVMEEAALYGRVHQRVQLCLDC--DKVSVLLSSLDFQPPKPQKTLIITNSAEETEHVYKAVVNTAVFTLKAHEDAT--DQFDFIIDQWRKDISQGTQVILVTTNDCLKA--LGIRDATCVVHYGFPSTPKLFGSRLFCMSENFRKLSDMDHSEDWTPGAQSVLLL--SEQNVRHVCGVLRYLRRTGALLPPELLQFALGIQQAKEEQKTHRPLCCSLKSFGFCRDSTVCPDRHTINTSLDQTQLPDSGMIMVLPLFIKTASVYCGRI-----------------VRQKEDLYEDLATQMKLHYASERRCAVEVLKGALYAIQEENCYHRVRVLEVPEKGEQLFSSVTACLIDEGRTQEVKSHQLLQLPAQFQDLPGQAVEIILCRVQPVDGEVDWNPKVTRAVSLKIRGKLHQARVVMSLGNTIWVDPMVRMVRVPGLKTFINEYNVHTEILASGFGVSNPQHVDLL 1135          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Zebrafish
Match: tdrd12 (tudor domain containing 12 [Source:ZFIN;Acc:ZDB-GENE-121214-348])

HSP 1 Score: 144.821 bits (364), Expect = 3.330e-34
Identity = 160/672 (23.81%), Postives = 300/672 (44.64%), Query Frame = 3
Query: 1032 KFLL--------IIQSYMIPNILRGFNTLAIA----------PPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAE--KFTRFI--------IDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIY--KRTGAIDRGSEPSQFIT-ATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDV-SEPS-FGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPG-CVKRHMVLSDIDKPLLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHV----GLLAAIKIKDLLERVVVSKM--KSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQT 2927
            KFLL        + +SY  P + RGF+T+ ++          PP       LLM +LQT++      +RT  P+A+ILC  W+KV  + +  E  K T  +        +D D+ ++ +I                 + C +L+ TP  LL  L+   F  L    +  LD+A+ + ++  + +  IL +  +   A +R + P Q I     W++ ++  V+  M    ++ +    E A+  RV Q++    D   D    L++ L+      ++T+I  ++ ++   VYK ++  A   LK    +   ++ + ++ +W +        IL+ +++ L+   + I +A  ++H    S P  FG+RL  + + + KLS +    +      S + +  +  N+R    + R+L R G+  P  L + ++     KE+ K    +C  +K FG C+    C  RH + + +D+  LP+ G I    L++ + S +  RI                 +  K  +      QM +H  + R   V    G L AI+ ++   RV V ++  K  Q    V   LID+G    V+   LLQLP +  ++P QA+E  +  ++P+D +  ++ +     +  +  K   A + + +G+T+W+D + +  HH  T
Sbjct:  167 KFLLWRKYSGPNVAESYCWPAVARGFDTVLVSHSGDNPLSYIPP-------LLM-ILQTVSVVSSLAART-GPVAVILCPGWEKVQTVLELLEDSKATHGLHPTSVLLGVDQDEPKKFKI----------------QKNCQLLVTTPFSLLRLLEAQCFLFLRLCHLV-LDEADLLYSQAPDQISIILKHFQQLVCAEERVACPRQIIAVGGRWSAGIDGLVREHMIHP-TVIITVMEEAALYGRVHQRVQLCLDC--DKVSVLLSSLDFQPPKPQKTLIITNSAEETEHVYKAVVNTAVFTLKAHEDAT--DQFDFIIDQWRKDISQGTQVILVTTNDCLKA--LGIRDATCVVHYGFPSTPKLFGSRLFCMSENFRKLSDMDHSEDWTPGAQSVLLL--SEQNVRHVCGVLRYLRRTGALLPPELLQFALGIQQAKEEQKTHRPLCCSLKSFGFCRDSTVCPDRHTINTSLDQTQLPDSGMIMVLPLFIKTASVYCGRI-----------------VRQKEDLYEDLATQMKLHYASERRCAVEVLKGALYAIQEENCYHRVRVLEVPEKGEQLFSSVTACLIDEGRTQEVKSHQLLQLPAQFQDLPGQAVEIILCRVQPVDGEVDWNPKVTRAVSLKIRGKLHQARVVMSLGNTIWVDPMVRIRHHGAT 786          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Zebrafish
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 56.225 bits (134), Expect = 3.730e-7
Identity = 40/170 (23.53%), Postives = 78/170 (45.88%), Query Frame = 3
Query:  900 VQKYRTENETTDFNYLGSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWL 1409
            V +YR E E       G  +PI ++    +    L  A+ KH+ +    IQ+  IP I+ G + + IA    GK++  L+P+ + I   Q        PLA+I+  + +   ++    +KF++ +         R+V  Y G+     +  + +G ++++ TP  ++  L
Sbjct:  318 VSEYRLELEGISVKGKGCPKPIKTWVQCGISMKVLN-ALKKHNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHI-LDQRPVGEAEGPLAVIMTPTRELALQITKECKKFSKSLA-------LRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDML 478          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Zebrafish
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 55.8398 bits (133), Expect = 5.548e-7
Identity = 67/340 (19.71%), Postives = 140/340 (41.18%), Query Frame = 3
Query: 1047 IQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVL-QTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENI-----------IAEHLETLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLEL-AVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDI----LIYNAEIILHVDV 2015
            IQ   +P  L G + + IA    GK+   + P+L   +  K+L P     P+A+I+C + +   ++    ++F        K    R VA Y G         + +G ++++ TP  L+  +K+ +   L  +     D+A+ +           IA H+   ++ L++  T                 +  ++E   +  + D   +   D  E    I ++ + +   +D  G L ++LV +     +S    ++F +   +   +   L+Q+    L ++ G M   E N ++ ++ +     N+P+L+ +D A R  DI     + N ++   +D 
Sbjct:  281 IQCQGVPIALSGRDAIGIAKTGSGKTAAFIWPILVHIMDQKELEPGE--GPIAVIVCPTRELCQQIHAECKRFG-------KAYGLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK-KATSLQRVTFLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSAT-----------------FRKKIEKLARDILVDPIRVVQGDIGEANEDITQIVEVLQSGQDKWGWLTRRLVEF-----TSAGSVLVFVTKKANCEELATNLIQEG-YSLGLLHGDMDQSERNKVIADFKKK----NLPVLVATDVAARGLDIPSIRTVVNYDVARDIDT 583          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Xenopus
Match: smarcd3 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 [Source:Xenbase;Acc:XB-GENE-494884])

HSP 1 Score: 120.939 bits (302), Expect = 8.361e-27
Identity = 170/682 (24.93%), Postives = 273/682 (40.03%), Query Frame = 3
Query: 1050 QSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTI----ATKQLSPSRTYNPLAIILCSSWKK---VSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTM--IPVLQGCDVLIITPNCLLSWLK-------QHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFI-TATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDVSEPS--FGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLH-----RFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPGCVKRHMVLSDIDKPLLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKMKSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARL 3023
            +SY  P++ +GFNT+ I+P    K M  + P+L  +    A   L PSR   PLA ILCS WKK   V EL     K TR +        P ++      LK+     + + +GC+V++ TP  LL +LK       +     L+E++I  L     +I E LE     L  K   A  R   P Q + T T W   + S +++    +  I     +E A +    Q++I+   +  +    L+  L+ T    ++ +IF  +D++  LV+K  M    V  K    S        ++++W          +L++++E L   ++   +A  I+H    E    FG RL      Y+ L ++ S+ E +        +  + L +   +  H     R+L    +  P  L + +   +   E  K   +IC  IK FG                                       HFF RI         E  Y+     L  K      NQ+ +  VN     V  L A++   +  RV V   K         ++ ID G    V  A LLQLP +  +IPPQ+ E  V  ++PIDN+  +        +  ++ K   A + L IG+T W+D + QR   +     + + N+   +L   +   N QHI  L  L
Sbjct:  146 ESYSWPSVAQGFNTIVISP-DGMKPMNYIPPLLTFLHLASAVYTLLPSRN-GPLAAILCSGWKKAHFVHELLLKYSKHTRPL-------NPMLILV---GLKEEECENLNIRKGCEVIVTTPPSLLRYLKCKGLLLLRLCHLVLDEVDILFLKSGSQVI-EILE-----LFKKSVAAESRECAPQQIVATGTFWHKEMNSLLQYTTEPQVIIT---RMEQAAVYGNVQQVIQL-CLNCEKISVLLRNLDFTPDHAQKVLIFVESDEEAELVHKVSMN--IVHKKRYFSS--------VLQQWKNMLSRGTHIVLVVTNEYLPLLEVT--DATCIIHFSFPENENVFGLRL------YSLLDYIHSKTERVISLEDSFPVARSVLLMTEKHIHHSTDILRYLQHTEATIPPELSDLTQGILQANENRKFDKDICQHIKTFGV-------------------------------------FHFFGRI------VTKEDVYTHLLEDLN-KFYQIPGNQILVQEVN-----VSQLYAVQEGSVYHRVKVFSAKKENGVLNFSLQFIDDGRTDKVRDAQLLQLPSQFEKIPPQSAEFIVCRVQPIDNEAEWDPIVTRTISKAIKGKLHTAKVVLHIGNTYWLDPMVQRSKLSGFAACINELNVRHEILSTGMGVDNPQHISHLEEL 738          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Xenopus
Match: smarcd3 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 [Source:Xenbase;Acc:XB-GENE-494884])

HSP 1 Score: 116.316 bits (290), Expect = 2.004e-25
Identity = 169/679 (24.89%), Postives = 280/679 (41.24%), Query Frame = 3
Query: 1050 QSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTI----ATKQLSPSRTYNPLAIILCSSWKK---VSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTM--IPVLQGCDVLIITPNCLLSWLK-------QHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFI-TATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDVSEPS--FGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPGCVKRHMVLSDIDKPLLPNKGHIQF--RLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKMKSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARL 3023
            +SY  P++ +GFNT+ I+P    K M  + P+L  +    A   L PSR   PLA ILCS WKK   V EL     K TR +        P ++      LK+     + + +GC+V++ TP  LL +LK       +     L+E++I  L     +I E LE     L  K   A  R   P Q + T T W   + S +++    +  I     +E A +    Q++I+   +  +    L+  L+ T    ++ +IF  +D++  LV+K  M    V  K    S        ++++W          +L++++E L   ++   +A  I+H    E    FG RL      Y+ L ++ S+ E +        +  + L +   +  H                 S D +   + ++ +  I P                   LSD+ + +L    + +F   +L+++ P HFF RI         E  Y+     L  K      NQ+ +  VN     V  L A++   +  RV V   K         ++ ID G    V  A LLQLP +  +IPPQ+ E  V  ++PIDN+  +        +  ++ K   A + L IG+T W+D + QR   +     + + N+   +L   +   N QHI  L  L
Sbjct:  146 ESYSWPSVAQGFNTIVISP-DGMKPMNYIPPLLTFLHLASAVYTLLPSRN-GPLAAILCSGWKKAHFVHELLLKYSKHTRPL-------NPMLILV---GLKEEECENLNIRKGCEVIVTTPPSLLRYLKCKGLLLLRLCHLVLDEVDILFLKSGSQVI-EILE-----LFKKSVAAESRECAPQQIVATGTFWHKEMNSLLQYTTEPQVIIT---RMEQAAVYGNVQQVIQL-CLNCEKISVLLRNLDFTPDHAQKVLIFVESDEEAELVHKVSMN--IVHKKRYFSS--------VLQQWKNMLSRGTHIVLVVTNEYLPLLEVT--DATCIIHFSFPENENVFGLRL------YSLLDYIHSKTERVISLEDSFPVARSVLLMTEKHIHH-----------------STDILRYLQHTEAT--IPPE------------------LSDLTQGILQANENRKFDKDILHVLDPVHFFGRI------VTKEDVYTHLLEDLN-KFYQIPGNQILVQEVN-----VSQLYAVQEGSVYHRVKVFSAKKENGVLNFSLQFIDDGRTDKVRDAQLLQLPSQFEKIPPQSAEFIVCRVQPIDNEAEWDPIVTRTISKAIKGKLHTAKVVLHIGNTYWLDPMVQRSKLSGFAACINELNVRHEILSTGMGVDNPQHISHLEEL 735          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Xenopus
Match: polg2 (polymerase (DNA directed), gamma 2, accessory subunit [Source:Xenbase;Acc:XB-GENE-1009985])

HSP 1 Score: 63.5438 bits (153), Expect = 2.712e-9
Identity = 75/285 (26.32%), Postives = 131/285 (45.96%), Query Frame = 3
Query: 1008 EAMSKHDTKF----LLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSR---TYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFITAT--VWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSI-KRTIIFASTDDDILLVYKYLMQK 1832
            E +S++ TK     L  +Q + IP IL G + +A A    GK+   L+P+L  +  + ++ S+      P AII+  + + ++++   A KF+          RP +V  Y G      M  V +GC++L  TP  L+  + + E   L++L+   LD+A+ ++      + E LI    G   +    +   +AT      RL S  K    D   + V   L       V+Q I+E ++     Y+K    +E+ +SS  +RT+IF +T     ++  YL Q+
Sbjct:  192 ETLSRNVTKAGYVKLTPVQKHSIPIILAGRDLMACAQTGSGKTAAFLLPILSHMMNEGITASQFLPLQEPQAIIIAPTRELINQIYLDARKFSY-----GTCVRPVVV--YGGIHPVHAMRDVERGCNILCATPGRLMDIIGR-EKIGLSKLKYLVLDEADRMLDMGFAPVMENLI-GSPGMPAKEERQTLMFSATYPAEIQRLAS--KFLKSDHLFVVVG--LVGGACSDVEQTILEIQE-----YRKRDKLVEILQSSGNERTMIFVNTKKKADVIAGYLCQE 458          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Xenopus
Match: polg2 (polymerase (DNA directed), gamma 2, accessory subunit [Source:Xenbase;Acc:XB-GENE-1009985])

HSP 1 Score: 63.5438 bits (153), Expect = 2.779e-9
Identity = 75/285 (26.32%), Postives = 131/285 (45.96%), Query Frame = 3
Query: 1008 EAMSKHDTKF----LLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSR---TYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFITAT--VWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSI-KRTIIFASTDDDILLVYKYLMQK 1832
            E +S++ TK     L  +Q + IP IL G + +A A    GK+   L+P+L  +  + ++ S+      P AII+  + + ++++   A KF+          RP +V  Y G      M  V +GC++L  TP  L+  + + E   L++L+   LD+A+ ++      + E LI    G   +    +   +AT      RL S  K    D   + V   L       V+Q I+E ++     Y+K    +E+ +SS  +RT+IF +T     ++  YL Q+
Sbjct:  241 ETLSRNVTKAGYVKLTPVQKHSIPIILAGRDLMACAQTGSGKTAAFLLPILSHMMNEGITASQFLPLQEPQAIIIAPTRELINQIYLDARKFS-----YGTCVRPVVV--YGGIHPVHAMRDVERGCNILCATPGRLMDIIGR-EKIGLSKLKYLVLDEADRMLDMGFAPVMENLI-GSPGMPAKEERQTLMFSATYPAEIQRLAS--KFLKSDHLFVVVG--LVGGACSDVEQTILEIQE-----YRKRDKLVEILQSSGNERTMIFVNTKKKADVIAGYLCQE 507          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Xenopus
Match: polg2 (polymerase (DNA directed), gamma 2, accessory subunit [Source:Xenbase;Acc:XB-GENE-1009985])

HSP 1 Score: 63.5438 bits (153), Expect = 2.797e-9
Identity = 75/285 (26.32%), Postives = 131/285 (45.96%), Query Frame = 3
Query: 1008 EAMSKHDTKF----LLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSR---TYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFITAT--VWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSI-KRTIIFASTDDDILLVYKYLMQK 1832
            E +S++ TK     L  +Q + IP IL G + +A A    GK+   L+P+L  +  + ++ S+      P AII+  + + ++++   A KF+          RP +V  Y G      M  V +GC++L  TP  L+  + + E   L++L+   LD+A+ ++      + E LI    G   +    +   +AT      RL S  K    D   + V   L       V+Q I+E ++     Y+K    +E+ +SS  +RT+IF +T     ++  YL Q+
Sbjct:  261 ETLSRNVTKAGYVKLTPVQKHSIPIILAGRDLMACAQTGSGKTAAFLLPILSHMMNEGITASQFLPLQEPQAIIIAPTRELINQIYLDARKFS-----YGTCVRPVVV--YGGIHPVHAMRDVERGCNILCATPGRLMDIIGR-EKIGLSKLKYLVLDEADRMLDMGFAPVMENLI-GSPGMPAKEERQTLMFSATYPAEIQRLAS--KFLKSDHLFVVVG--LVGGACSDVEQTILEIQE-----YRKRDKLVEILQSSGNERTMIFVNTKKKADVIAGYLCQE 527          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Mouse
Match: Tdrd12 (tudor domain containing 12 [Source:MGI Symbol;Acc:MGI:1919231])

HSP 1 Score: 159.458 bits (402), Expect = 9.584e-39
Identity = 180/714 (25.21%), Postives = 313/714 (43.84%), Query Frame = 3
Query:  954 VRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIA--PPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPR-----IVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHE--FFKLNELEIFCLDDAENIIAEHLETLQEIL--IYKRTGAIDRGSEPSQFITATV-WTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDV-SEPS-FGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPG-CVKRHMVLSDIDKP------LLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVV---SKMKSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARL 3023
            + P L+ +   L A  LK+A+ ++         SY  P I RG + + I+         +  L+ +LQ     +  PSR   PLA+I+C  WKK       A+     + D     RP       +  +    K M +    +GCDV++ TP+ LL  L      F +L  L    LD+   +  E  E +  IL    K     +R S P Q +   V W   ++  V+  M D     V   LE A +    Q+++ +  +E +    L+  L+   S  ++T+IF  +  +   V K +   +   LKM         L  ++ +W +     +  +L ++D+ +    + I +A  ++H    S P   G RL  + D +  L+   S  E  +K    + +  T  N   A  + R+L R  +  P  L E +   +  KE  K    +CP +K FG CK    C  RH +  ++D P       LP  GHI+    Y+ + +++F RI +          +   Y +L  +M  YF    N      ++ ++GL   ++ K L +RV V   S+ +     G + VKLID+G   ++ +  LL LP++   +PPQA+E  V  ++P D++  ++ +   + +  +  K   A + L +G+TLWID +      +  + ++ D N+   +L   +   NS+H+E+L +L
Sbjct:  381 IEPCLTLEKSPLSAD-LKKALQRNKFPGPSHTASYSWPPIARGCDMVVISHCGNDPLLYLPPLLTILQMGGCYKSLPSRN-GPLAVIVCPGWKK-------AQFIFELLGDYSMSSRPLHPVLLTIGLHKDEAKNMKLP---RGCDVIVTTPHSLLRLLTYRSLLFLRLCHL---VLDEVHMLFFEANEQMFAILDNFKKNVEVEERESAPHQIVAVGVHWNKHIDHLVREFMKD--PCVVITALEEAALYGSVQQVV-HLCLECEKTSTLLQVLDFVPSQAQKTLIFTCSVAETETVCKVVESNSIFCLKMHKEMAF--NLKSILEQWKKKLSPGSHIVLTLTDDCIPL--LAITDATCVVHFSFPSSPKVLGGRLYCMSDHFQSLTEQGSPAEQGDKKTKSVLLL-TERNASHAVGILRYLERADAKIPSELYEFTAGVLEAKEDKKARRPLCPYLKAFGFCKDKRICPDRHHINPEMDIPRKLSNKTLPVFGHIRVIPFYISNATNYFGRIID---------KHVDLYETLNAEMNEYFKESSNKTSAE-KVENLGLYG-LEEKTLFQRVQVLEVSQKEDTWGLGSILVKLIDEGRTKLITRDQLLLLPEKFHTLPPQAVEFIVCRVKPADSEIEWNPKVTRYIHHKIVGKMHDAKVVLALGNTLWIDPMVHVTKLSNLKTSIIDYNVRAEILSMGMGIDNSEHLEQLKKL 1060          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Mouse
Match: Tdrd12 (tudor domain containing 12 [Source:MGI Symbol;Acc:MGI:1919231])

HSP 1 Score: 108.997 bits (271), Expect = 3.771e-23
Identity = 84/306 (27.45%), Postives = 147/306 (48.04%), Query Frame = 3
Query: 2136 TTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPG-CVKRHMVLSDIDKP------LLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVV---SKMKSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARL 3023
            T  N   A  + R+L R  +  P  L E +   +  KE  K    +CP +K FG CK    C  RH +  ++D P       LP  GHI+    Y+ + +++F RI +          +   Y +L  +M  YF    N      ++ ++GL   ++ K L +RV V   S+ +     G + VKLID+G   ++ +  LL LP++   +PPQA+E  V  ++P D++  ++ +   + +  +  K   A + L +G+TLWID +      +  + ++ D N+   +L   +   NS+H+E+L +L
Sbjct:  705 TERNASHAVGILRYLERADAKIPSELYEFTAGVLEAKEDKKARRPLCPYLKAFGFCKDKRICPDRHHINPEMDIPRKLSNKTLPVFGHIRVIPFYISNATNYFGRIID---------KHVDLYETLNAEMNEYFKESSNKTSAE-KVENLGLYG-LEEKTLFQRVQVLEVSQKEDTWGLGSILVKLIDEGRTKLITRDQLLLLPEKFHTLPPQAVEFIVCRVKPADSEIEWNPKVTRYIHHKIVGKMHDAKVVLALGNTLWIDPMVHVTKLSNLKTSIIDYNVRAEILSMGMGIDNSEHLEQLKKL 999          

HSP 2 Score: 53.9138 bits (128), Expect = 2.609e-6
Identity = 67/258 (25.97%), Postives = 107/258 (41.47%), Query Frame = 3
Query: 1053 SYMIPNILRGFNTLAIA--PPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRP-----RIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHE--FFKLNELEIFCLDDAENIIAEHLETLQEIL--IYKRTGAIDRGSEPSQFITATV-WTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFAST 1790
            SY  P I RG + + I+         +  L+ +LQ     +  PSR   PLA+I+C  WKK       A+     + D     RP       +  +    K M +    +GCDV++ TP+ LL  L      F +L  L    LD+   +  E  E +  IL    K     +R S P Q +   V W   ++  V+  M D     V   LE A +    Q+++ +  +E +    L+  L+   S  ++T+IF  +
Sbjct:  438 SYSWPPIARGCDMVVISHCGNDPLLYLPPLLTILQMGGCYKSLPSRN-GPLAVIVCPGWKK-------AQFIFELLGDYSMSSRPLHPVLLTIGLHKDEAKNMKLP---RGCDVIVTTPHSLLRLLTYRSLLFLRLCHL---VLDEVHMLFFEANEQMFAILDNFKKNVEVEERESAPHQIVAVGVHWNKHIDHLVREFMKD--PCVVITALEEAALYGSVQQVV-HLCLECEKTSTLLQVLDFVPSQAQKTLIFTCS 678          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Mouse
Match: Ddx41 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 [Source:MGI Symbol;Acc:MGI:1920185])

HSP 1 Score: 60.077 bits (144), Expect = 2.427e-8
Identity = 84/357 (23.53%), Postives = 144/357 (40.34%), Query Frame = 3
Query:  894 WTVQKY-------RTENETTDFNYL----GSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTI--ATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLET-LQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVN--DPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYR 1916
            WT  +Y       R E     ++ L    G   PI S+K  K  A  L+  + K        IQ   IP IL G + + IA    GK++   +PV+       K+L  S+   P  +I+C S +   +     E + R ++  D     R      G   K  M  +  G  +++ TP  L+  L Q +   L+      LD+A+ +I    E  ++ I  Y       +G   +   +AT+   +++++ K  +    +I V       L VI+ V     EY   E     K+V  LE  + +    +IFA    D+  +++YL+ K  V+   + G    EE    +  + + +
Sbjct:  157 WTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMKFPAAILR-GLKKKGILHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCR-LLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLL-QKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYF------KGQRQTLLFSATM-PKKIQNFAKSALVKPVTINVGRAGAASLDVIQEV-----EYVKEEA----KMVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKG-VEAVAIHGGKDQEERTKAIEAFREGK 493          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Mouse
Match: Ddx41 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 [Source:MGI Symbol;Acc:MGI:1920185])

HSP 1 Score: 59.6918 bits (143), Expect = 3.406e-8
Identity = 84/357 (23.53%), Postives = 144/357 (40.34%), Query Frame = 3
Query:  894 WTVQKY-------RTENETTDFNYL----GSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTI--ATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLET-LQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVN--DPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYR 1916
            WT  +Y       R E     ++ L    G   PI S+K  K  A  L+  + K        IQ   IP IL G + + IA    GK++   +PV+       K+L  S+   P  +I+C S +   +     E + R ++  D     R      G   K  M  +  G  +++ TP  L+  L Q +   L+      LD+A+ +I    E  ++ I  Y       +G   +   +AT+   +++++ K  +    +I V       L VI+ V     EY   E     K+V  LE  + +    +IFA    D+  +++YL+ K  V+   + G    EE    +  + + +
Sbjct:  146 WTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMKFPAAILR-GLKKKGILHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCR-LLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLL-QKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYF------KGQRQTLLFSATM-PKKIQNFAKSALVKPVTINVGRAGAASLDVIQEV-----EYVKEEA----KMVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKG-VEAVAIHGGKDQEERTKAIEAFREGK 482          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 57.3806 bits (137), Expect = 1.855e-7
Identity = 44/175 (25.14%), Postives = 84/175 (48.00%), Query Frame = 3
Query:  963 ILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSR---TYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENII 1478
            IL+++   L  T L   ++K     L  +Q Y IP +L G + +A A    GK+   L+P+L  +    ++ SR      P  II+  + + ++++   A KF+            R V  Y G+    ++  ++QGC++L  TP  L+  + + E   L +++   LD+A+ ++
Sbjct:  260 ILTFEEANLCQT-LNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTRELINQIYLEARKFSFGTC-------VRAVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGK-EKIGLKQVKYLVLDEADRML 425          
BLAST of Tudor domain-containing protein 12 vs. UniProt/SwissProt
Match: sp|Q587J7|TDR12_HUMAN (Putative ATP-dependent RNA helicase TDRD12 OS=Homo sapiens OX=9606 GN=TDRD12 PE=2 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 3.545e-42
Identity = 188/733 (25.65%), Postives = 323/733 (44.07%), Query Frame = 3
Query:  954 VRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLL--MPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEIL--IYKRTGAIDRGSEPSQFITATV-WTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDIL-IYNAEIILHVD--VSEPSFGNRLNFLRDKYAKLSFLKSRNEPIE----KCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPG-CVKRHMVLSDIDKP------LLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKMKSNQSGGYVK---VKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVP 3086
            ++P L+  +  L A  LK+A+ ++        +SY  P I RG + + I+       + LL  + VLQT A  +  PSR   PLA+I+C  WKK   +    E    + + S  +    +    +    K T +P  +GCDV++ TP  LL  L       L    +  LD+ E +  E  E +  IL    K     +R S P Q +   V W   +E  +K  M D + I +    E A+   V+Q +  +  +E +    L+  L+   S  ++T+IF  +  +  +V K +   +   LKM    +    L  ++ +W +     +  IL ++D+   C  +L I +A  ++H     S   FG RL  + D      F   +  P E    K  S + +  T  +   A  + R+L R  +  P  L E +   +  KE  K    +CP +K FG CK    C  RH +  + D P       LP+ G+I+    Y+++ +++F RI +          +   Y +L  +M  YF +    +   +  V    L  +  K L  RV V ++   +    +    V+ ID+G   +V +  LL LP+    +PPQA+E  V  ++P DN+  ++ +   + +  +  K   A + L +G+T+WID +    + +  + +V D N+   +L   +   N +HIE+L +L   + D   P+ EES  +  P
Sbjct:  412 IKPCLTIDSSPLSAD-LKKALQRNKFPGPSHTESYSWPPIARGCDVVVISHCESNPLLYLLPVLTVLQTGACYKSLPSRN-GPLAVIVCPGWKKAQFIF---ELLGEYSMSSRPLHPVLLTIGLHKEEAKNTKLP--RGCDVIVTTPYSLLRLLACQSLLFLRLCHLI-LDEVEVLFLEANEQMFAILDNFKKNIEVEERESAPHQIVAVGVHWNKHIEHLIKEFMNDPY-IVITAMEEAALYGNVQQVV--HLCLECEKTSSLLQALDFIPSQAQKTLIFTCSVAETEIVCKVVESSSIFCLKMHKEMIF--NLQNVLEQWKKKLSSGSQIILALTDD---CVPLLAITDATCVIHFSFPASPKVFGGRLYCMSDH-----FHAEQGSPAEQGDKKAKSVLLL--TEKDASHAVGVLRYLERADAKVPAELYEFTAGVLEAKEDKKAGRPLCPYLKAFGFCKDKRICPDRHRINPETDLPRKLSSQALPSFGYIKIIPFYILNATNYFGRIVD---------KHMDLYATLNAEMNEYFKDS---NKTTVEKVEKFGLYGLAEKTLFHRVQVLEVNQKEDAWALDDILVEFIDEGRTGLVTRDQLLHLPEHFHTLPPQAVEFIVCRVKPADNEIEWNPKVTRYIHHKIVGKLHDAKVILALGNTVWIDPMVHITNLSSLKTSVIDYNVRAEILSMGMGIDNPEHIEQLKKL---REDAKIPACEESLSQTPP 1106          
BLAST of Tudor domain-containing protein 12 vs. UniProt/SwissProt
Match: sp|Q1XG89|TDR12_BOMMO (Putative ATP-dependent RNA helicase TDRD12 OS=Bombyx mori OX=7091 GN=TDRD12 PE=1 SV=2)

HSP 1 Score: 155.221 bits (391), Expect = 2.590e-36
Identity = 214/872 (24.54%), Postives = 372/872 (42.66%), Query Frame = 3
Query: 1020 KHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSE--PSQFITAT-VWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDL-----YQKLVAYLELTES--SIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDVSE--PSFGNRLNFLRDKYAKLSFLKSRNEPIEKC--HSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKE---KSKGSNEICPRIKCFGEC-KLPGCVKRHMVLSDIDKPL--LPNKGHIQFRLLYLVSPSHFFVRI--NEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMN--IHGVNLRLVHVGLLAAI-KIKDLLERVVVSKMKS---NQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTF----LEEKDLY--AIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVPIMRKFTYTNNPIVFEALPVLDDDNQLETECVFSHIFSPSL-----IFLNNKTTIKSLRDLQLEINSLIDSIEALSISDIKIGSKVL--FYRDQCWHRGYVIKI--DCDVKIFSLDEGLIENYDHSREQLKKLPYEY-QQTPYQAILCNL 3503
            KH T+    +Q+     ILRG +T  I+PPR GK+MG L  V + +   +     +  P  II+C++ K VSE+    E+ ++ ++  +     ++ A Y+G         +L GCD+LI TP  ++  L+      L +L  F +DD E I   +   ++ +L   +    +R ++    Q + A+ +W   LE            I +  P  +  I    Q++I Y  I   +       K+   L+  +S    KRT++    D+++  V   L     V +     +M+  +L  +   W  +      PIL+  D  L    + + +A  ++H  +     +F  R + L D Y  +   +SR+  ++     S +   P  LN         FL RC  + P+ L E S + ILN++   K K    +C  +   G C     C +RH +  + D P   +P  G + F++LY  S   +  R+  N   G +  ++P +   LSLKM M  YF+ + +  +HG+ +    VG + A+ K ++   R  V K+ S   N +  YV +KLID+          L  LP E  ++    ++  +  I+P D D  +   SCL  N       + +DL+    + + +GS +++D++   +  +    TV   N    LL+ + V  N +H+  L  +C     I K                   TN  +V + +PVL        E   S ++  S+     +F+        ++ L +EIN  + S   + +    +G  VL  F  D  + R  +  I  +  VK F +D+G  +  D S   L  +   +  Q P+QAI C L
Sbjct:  601 KHPTR----LQTVSWGTILRGLSTFLISPPRSGKTMGYLPAVCRLVRDFRKESPDSCGPKCIIVCATSKSVSEV----ERISKMLLGLED----KVFACYSGMDNLSVTTALLNGCDLLICTPKSIVRLLQNDLSVDLRDLTTFVVDDCERISDVYSNEVKYVLYEIKNMLKNRVNKELKVQIVVASRIWCDFLE-----------PIVLKAPDSVVCIGAF-QELILYSKISTTVDFLRPENKIANVLQFIDSVQGPKRTVVVCRADNEVKAVESSLRYNNRV-VFACDNTMNIHDLYNLNVVWGDFEDPTLGPILVCCDSNL--VHLNVTDASYLIHYSLPALFSTFCKRFSVLNDNYPSIFKNESRDLKVKVLMDESNVEQLPKILN---------FLKRCTENVPKILDEVS-EKILNEKDLAKVKDLVPLCDNLLSLGICPDTWNCTERHRIFKECDSPADWIPKNGVVTFQILYFHSAVMYSARLLSNTVDGET-TKYPQTYSTLSLKMGM--YFSKESSRRLHGIPM----VGDVCAVSKKQNFFIRCQVVKIISFYKNGNPNYVVIKLIDEEKFEQSRDIYLYHLPDEFKDMKTYVVQVRLANIQPQDKDITF---SCLAKNELEKIVEKNEDLFMRGHVAMSVGSCIFVDTLEACLDLSSLSETVVRHNFKQELLNAHAV-PNPKHLSILEEMCEKSGLIVK-----------------AVTNEQVVPKPIPVLPAAQWAHLEDDLSSVYLASVEDMDKLFVRLVKFESCMKLLNIEINKYV-SENTVPLDGSNVGDIVLAKFPDDSMYERARIDHIYSEDKVKCFFVDQG--DWRDVSTNDLATITENFITQLPFQAIECRL 1404          
BLAST of Tudor domain-containing protein 12 vs. UniProt/SwissProt
Match: sp|Q9CWU0|TDR12_MOUSE (Putative ATP-dependent RNA helicase TDRD12 OS=Mus musculus OX=10090 GN=Tdrd12 PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 2.727e-22
Identity = 84/306 (27.45%), Postives = 147/306 (48.04%), Query Frame = 3
Query: 2136 TTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPG-CVKRHMVLSDIDKP------LLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVV---SKMKSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARL 3023
            T  N   A  + R+L R  +  P  L E +   +  KE  K    +CP +K FG CK    C  RH +  ++D P       LP  GHI+    Y+ + +++F RI +          +   Y +L  +M  YF    N      ++ ++GL   ++ K L +RV V   S+ +     G + VKLID+G   ++ +  LL LP++   +PPQA+E  V  ++P D++  ++ +   + +  +  K   A + L +G+TLWID +      +  + ++ D N+   +L   +   NS+H+E+L +L
Sbjct:  704 TERNASHAVGILRYLERADAKIPSELYEFTAGVLEAKEDKKARRPLCPYLKAFGFCKDKRICPDRHHINPEMDIPRKLSNKTLPVFGHIRVIPFYISNATNYFGRIID---------KHVDLYETLNAEMNEYFKESSNKTSAE-KVENLGLYG-LEEKTLFQRVQVLEVSQKEDTWGLGSILVKLIDEGRTKLITRDQLLLLPEKFHTLPPQAVEFIVCRVKPADSEIEWNPKVTRYIHHKIVGKMHDAKVVLALGNTLWIDPMVHVTKLSNLKTSIIDYNVRAEILSMGMGIDNSEHLEQLKKL 998          
BLAST of Tudor domain-containing protein 12 vs. UniProt/SwissProt
Match: sp|P19109|DDX17_DROME (ATP-dependent RNA helicase p62 OS=Drosophila melanogaster OX=7227 GN=Rm62 PE=1 SV=3)

HSP 1 Score: 67.781 bits (164), Expect = 7.212e-10
Identity = 85/364 (23.35%), Postives = 159/364 (43.68%), Query Frame = 3
Query:  894 WTVQKYRTENETTDFNYLGSV-RPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLE-TLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQK-LVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDI 1976
            + VQ+YR E E T     G V  PI  +    L    +KE + +   K    IQ+   P  + G N + IA    GK++G ++P +  I  +Q    R   P+A++L  + +   ++   A +F      S  VR       + G+ K   M  + +GC+++I TP  L+ +L       L       LD+A+ ++    E  +++I+   R    DR +     + +  W   ++   +  +G+   I +   LEL+    ++Q +   ++   +   K L++ +  T  S  + IIF  T   +  + +++ +   V    + G  S  E + ++RE+    G  N  IL+ +D A R  D+
Sbjct:  259 YEVQRYREEQEIT---VRGQVPNPIQDFSEVHLPDYVMKE-IRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQ-PLQRGDGPIALVLAPTRELAQQIQQVATEFG----SSSYVRN---TCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGS-TNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRP---DRQT----LMWSATWPKEVKQLAEDFLGNYIQINIGS-LELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFI-RSFGVRCGAIHGDKSQSERDFVLREFRS--GKSN--ILVATDVAARGLDV 596          
BLAST of Tudor domain-containing protein 12 vs. UniProt/SwissProt
Match: sp|Q755N4|DBP2_ASHGO (ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DBP2 PE=3 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 3.348e-8
Identity = 85/364 (23.35%), Postives = 153/364 (42.03%), Query Frame = 3
Query:  900 VQKYRTENETTDFNYLGSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMP-VLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLN--ELEIFCLDDAENIIAEHLE-TLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLEL-TESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDI 1976
            V+++R ENE     +    +PI ++         LKE   +   K    IQ    P  L G + + +A    GK++   +P ++   A   LSP     P+ ++L  + +   ++     KF R    S ++R       Y G  K   +  + +G ++LI TP  L+  L   E  K N   +    LD+A+ ++    E  +++I+   R    DR +     + +  W   ++   +  + D   + +   LELA    + Q +    D   D   +LV +LE+ ++    + IIFAST      +  YL Q     L +  G    +E + ++ E+   R     PI++ +D A R  D+
Sbjct:   93 VEQFRKENEMKIVGH-DVPKPIRTFDEAGFPEYVLKEVKEEGFEK-PTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSPGD--GPVVLVLAPTRELAVQIQKECSKFGR----SSRIRN---TCVYGGVPKSQQIRDLQRGVEILIATPGRLIDML---EIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRP---DRQT----LMWSATWPKEVQQLARDYLHDPIQVNIGS-LELAASHTITQLVEVVSDF--DKRDRLVKHLEIASKDKDSKIIIFASTKRTCDEITSYLRQDGWPALAIH-GDKQQQERDWVLNEFRTGRS----PIMVATDVAARGIDV 427          
BLAST of Tudor domain-containing protein 12 vs. TrEMBL
Match: A0A210PGL2 (Tudor domain-containing protein 12 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13850 PE=4 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 6.186e-64
Identity = 245/904 (27.10%), Postives = 430/904 (47.57%), Query Frame = 3
Query:  954 VRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSR-----TYN-PLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILI-YKRT--GAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIK---RTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDV--SEPSFGNRLNFLRDKYAKLSFLKSRN-EPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKS-KGSNEICPRIKCFGECKLPG-CVKRHMVLSDID-----KPLLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAI-KIKDLLERVVVSKMKS-NQSGGYVKVKL--IDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVPIMRKFTYTNNPIVFEALPVLDDDNQLETECVFSHIFSPSLIFLNNKTTIKSLRDLQLEINSLI--DSIEALSISDIKIGSKVLFYRDQCWHRGYVIK--IDCDVKIFSLDEGLIENYDHSREQLKKLPYEYQQTPYQAILCNLFFCSHLNNSYSD---DVIAAIKHY 3566
            ++PI +  +D  L   ++E +  +       +Q Y  P +LRG N + I+P   GK+   L P+L    T  L PS      T N P AIIL   WK    + D     T+ ++ +   R  R++ AY G  ++  ++P++ GC++LI TP  L S L Q ++  L  L    +DDAE ++ E  E +Q+ +I Y R     ++R +     + ++ W + + S++   + D  ++ +    E A+  RVKQ  + +        Q +  +LEL  S  +   + IIF S  +  L ++K L  ++   L +    M    L  +  EW          IL+ +DE++   ++ I +A  I+H ++  S+  FGNRL+ +   Y   S  +  N +P     S+I I  T  + R    + + L R  S  P  L   S+   LN+EK+  G  ++C  +K +G C+    C  RH +L ++D     +PL  N G ++  +  +V  SH+FVR+ E    +  +   S   L L+ KMA +F +    H      + +G + A+ + ++   RV V  +   N  G  +K +L  +D G +  V    L  LP  L ++P QA+E ++  ++P+D DE ++ ++ +F    L++K +   I L IG+TLW+D + +R++ +       +  +   LL       NS H++ L  LC GKI++ K +L+    E            N +  E LP    +++   +   S + SP+LI+L    T K L  +  EIN  +  + +  + I  +K GS  L   D  W+R  +++   D  V++F +D G  E    SR+ L+K+P E+ + P+QAI   L + +    ++ +   D+I  + H+
Sbjct:  599 LKPIYNI-HDTPLDPIIREGLDNYGIVAPKFVQCYTWPALLRGRNVVGISPSGSGKTFAYLAPLL----TDLLKPSNYKDIPTGNGPYAIILVPFWKSAQMVYDV----TKILLGNS--RSFRVLVAYGGGNEENQVVPLINGCELLITTPRSL-SRLLQQKYTHLERLCHVVIDDAEIVLEEFREEIQDFMISYSRVVEEHVERSAPREVLVFSSRWCNMVNSFIDAFIPDP-TLIITSRFEAAIYGRVKQIPLLWR-----TDQLVSQFLELVNSLAQENSKMIIFCSNVNTTLHIHKLLKSRSLYSL-LTHDKMDTLMLEQIGGEWEGPSD--KGKILICTDESVE--ELKIVDATAIVHYELPSSKTKFGNRLSTMSKYYHNSSSKEKINIDPT----SYILI--TEDSGRQVETILQLLKRTKSKIPRNLY--SMVMGLNQEKNCDGDKDLCVALKAYGSCRYQNKCPARHALLPEVDCKATQQPL--NSGEVKVLVTNVVDASHYFVRLLEHRPPTGDKVDTSMTMLDLRFKMAEWFGDLQ--HRSKYSSLCIGEMCAVSEDEETYHRVKVCDITGVNSPGDRIKAELMFVDDGRKSFVSPNKLYNLPPHLRDVPYQALEVFICRVQPVDLDEKWTSKASMFVYDLLDKKTMDGRIVLRIGNTLWLDPLVERVYLSDLHAYCTNLFVRSELLKNGFAVNNSNHMQLLYDLCKGKIEVPKLNLQSDRSEK----------KNEV--EILP----ESKEYHDVHLSAVNSPTLIYLQRSDTFKLLEKMNDEINERMKNEELTGMKIISLKTGSVCLGKWDDMWYRVRILEELEDNMVEVFHVDFGDSETV--SRDSLQKIPQEFLELPFQAIEAGLSYVAPQGETWEEAAGDLIWDLAHF 1449          
BLAST of Tudor domain-containing protein 12 vs. TrEMBL
Match: A0A2B4S274 (Putative ATP-dependent RNA helicase TDRD12 OS=Stylophora pistillata OX=50429 GN=TDRD12 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 3.707e-58
Identity = 211/859 (24.56%), Postives = 408/859 (47.50%), Query Frame = 3
Query: 1044 IIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVL-QTIATKQLS---PSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIY--KRTGAIDRGSEPSQ-FITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDVSEPSFGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECK----LPGCVKRHMVLSDIDKPL--LPNKGHIQFRLLYLVSPSHFFVRI----NEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKD-----LLERVVVSKMKSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVPIMRKFTYTNNPIVFEALPVLDDDNQLETECVFSHIFSPSLIFLNNKTTIKSLRDLQLEINSLIDSIEALSISDIKIGSKVL--FYRDQCWHRGYVI--KIDCDVKIFSLDEGLIENYDHSREQLKKLPYEYQQTPYQAILCNLFFCSHLNNSYSDD 3542
            ++Q++  P +LRG + + I      +    L+P++ Q +  +++    P  +  P  +IL  +W  V ++     +  R I+  +K  R +++  +    +   +IP+L GC++LI TP C L  L+++ +  L+ L      DA+ ++ E    ++ I+ +  K   +    S P Q  + A+ W++ + S VK  +G+   I + D +E A+   V+Q +    + + D+  +L+ YLE +  S K   +F ST  +   V + L       L +    + P EL+ + R+WN       MP+L+I+++ +    + I NA  ++H +      G+++ F +          S +E    C S IF+     N+     + + + R G + P+ L   +      KEK K   ++C  +K FG C+    +  C+KRH VL+++DKP   +P  G ++  ++ ++  + ++VRI       +    ++   S+++L L M ++ ++ +    H V   LV VG L A+K+ +      ++   V+K   ++    V+V+ +D+G+   V    LLQLP +    P QA+E +V  ++P+D D  +++E+  +    +E K++   + L +G+T+W+D + +R +     VT    N+ + LL +    +N QH+  L  LC G ID+      ++ +  V           P   E + + ++          S + +P L F+  K++ +SL DL+ +INS +  +E+   ++I IGS  +  F  D  W+R  V+  + D +  +F +D G  E     R  +        Q P QA+ C L     L   +S++
Sbjct:  669 LLQAHAWPTLLRGRDLVGICQANDAQIQAYLLPIIYQLVEEREVYADLPKLSSGPQFLILAPTWGAVVDI----HRQCRLILAKNKNIRVQLI--FAAGAEDNQIIPLLNGCEILIATPPCFLRMLRKY-YISLDRLCHLVFHDADIMVEEFTSEIKCIMRHYAKLLQSQPCLSAPRQGVVMASSWSAGVASLVKAYLGNPVVI-IPDMIEAAIYRGVQQIVTFCSESQRDV--ELLGYLE-SFISTKDICVFTSTAAEAEDVGQILNANCYFAL-VAHNFLPPHELDSIQRQWNTPHTTDTMPVLVIAEDVI--GQLNITNASCVIHFNFP----GSKMRFSKRLATLAGTFTSSDE--HGCVSVIFVT-DGRNMYHTPSIRQLVQRSGQEVPQLLDAMADLAEQEKEKVK---DLCYSLKAFGTCRYKRGIRNCLKRHSVLAELDKPAKGIPTSGIVKVLIMSVMDATCYWVRILGHKATDANQRNSQTADSTEFLELTMAVSRWYADPN--HRVKQELVSVGDLCAVKLNNSSSYNRVKVCFVTKEDHSKKPVEVRVQYVDRGNFECVHVDRLLQLPPQFRSCPFQAVEVFVCRLQPLDKDTDWTDETAAYVTRLIEGKEMEGKVVLSLGNTMWLDPLVERKYLPNINVTTNALNVRMELLREKRAAENKQHVRLLRNLCEGVIDLQPLEGGQTGLSDV--------CEQPTALETIVLPEEGFH---SVYVSAVENPGLFFVQLKSSEESLEDLKQKINSGVSKVESEE-NEISIGSLCVAKFSEDNLWYRARVLGSRPDKEYDVFYVDFGDREWVTADR--IVPAWNGILQLPLQAVECALVNVDPLEKEWSEE 1487          
BLAST of Tudor domain-containing protein 12 vs. TrEMBL
Match: C3XUE7 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_120982 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 3.033e-56
Identity = 207/853 (24.27%), Postives = 388/853 (45.49%), Query Frame = 3
Query:  999 FLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVL----QTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEIL-IYKRTGA--IDRGSEPSQFI-TATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVD--VSEPSFGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSA-NFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPG-CVKRHMVLSDIDKPL--LPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIK-IKDLLERVVVSKMKSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDI--WKPSLEESTIEHVPIMRKFTYTN-NPIVFEALPVLDDDNQLETECVFSHIFSPSLIFLNNKTTIKSLRDLQLEINSLIDSIEALSISDIKIG--SKVLFYRDQCWHRGYVIKIDCD--VKIFSLDEGLIENYDHSREQLKKLPYEYQQTPYQAI 3491
            F+++ +   D      +Q+Y  P I+RG + +A+AP + GK++  L+P++    QT   + L       P +IILC  W     + D   +   +I D    +   ++  +    +   MIP++ GCD+LI TP CLL  L++  +  L+ L    +DDA+ +   + + ++ ++ +Y +  A   DR S P Q +  A  WT+ +ES+ +  M     +     +E AV  +VKQ ++         Y +L++ L+  E +  + ++F  +D +   V + L   +   L   T  +   E++ + +EW+ +    + P+L+++D  ++  D+ I +A  ++H    +S   F  RL  +   + K +  + +  P   C S+I +  T          +   L R G    + L +      L K+  +  N  C  +K FG C     C  RH+VL ++D+P   +P  G+++  + ++V  + ++ RI +         P  +  L L   +  +++ Q N   V +    VG + A++ +++   RV V+K+ +       +V  +D+G    +E   LL            A+E ++ G+ PID D+ +++++  FT+  +  K+L   + LC+G TLW++S+ +R      + T    N+   L+   L + N  H+  L + C GKI +  +KP  +       P      Y+  NP     LP    D     E   S +  P L+++  K   + L  L  E+N+      A ++  +  G     +F +D  W+R  V ++  D   ++F LD G  +     R  LK+   E  Q P+QAI
Sbjct:  724 FIQQYLISQDFPAPSKVQAYCWPAIMRGRDLVAMAPAKMGKTLAYLLPLMTQLAQTAGMEGLPEGN--GPRSIILCPYWNTARYVYD---QCWNYIADRKSTK---VLLIFGAGAEDDQMIPLINGCDLLIATPRCLLRMLEKG-YTNLDRLCQLVVDDADTLTEVYTDEIKSLMRLYGKVIADQPDR-SAPRQIVLMARQWTAGIESFHRAYMTQPL-LVFTSKVEEAVYSKVKQFVLVVPSTL--RYTQLLSLLDQCEGAGHKIVVFVGSDTEAEDVTQLLKSYSHSTLYAHT-DLHQYEIDKVKKEWSTHHSRGSQPVLVMTDTVIQ--DLHIRDATCVIHYSFALSPLKFSARLGCMSHSFNKDATKEKKKSP--GCVSYILVTETCTTFPVGLQEIVTLLRRSGGHVLQELLDMCNKAWLAKQVGRVDNSFCHAMKAFGHCAEQARCKARHVVLPEVDQPGEGMPTVGYVKVLVTHVVDANCYYGRIVKHWDWDRRAVPRENTCLPLMADIGLHYSRQEN--KVPVLTAQVGDMCAVRDMQNTFHRVRVTKITATDFTSRARVFYVDEGKTEELEVTKLL------------AVEVFLCGVCPIDQDKQWTDKASAFTHALVSSKELDGRVALCLGHTLWMESLVERKVLPGIKATTNKHNIRRELVHVCLAENNPDHVSLLRQACDGKITLPEYKPPSKAP-----PAKSGLKYSRANPPPTATLPGGGFD-----EVYVSAVEHPGLMYVQRKHYARKLEVLTAEVNNEEKLAAAPALQQVAPGRLCVAVFPQDNRWYRARVEELQGDEMCEVFYLDHG--DTAIIPRSSLKEPWKEVMQLPFQAI 1532          
BLAST of Tudor domain-containing protein 12 vs. TrEMBL
Match: K1R0K8 (Tudor domain-containing protein 12 OS=Crassostrea gigas OX=29159 GN=CGI_10028859 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 2.231e-55
Identity = 222/899 (24.69%), Postives = 400/899 (44.49%), Query Frame = 3
Query:  975 KNDKLLATFLKEAMSK---HDTKFL--LIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYN--PLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAID--RGSEPSQFIT-ATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDV---SEPSFGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPGCVKRHMVLSDIDKPL--LPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKMKSNQSGG----YVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVPIMRKFTYTNNPIVFEALPVLDDDNQLETECVFSHIFSPSLIFLNNKTTIKSLRDLQLEINSLIDSIE--ALSISDIKIGSKVL--FYRDQCWHRGYVIKI--DCDVKIFSLDEGLIENYDHSREQLKKLPYEYQQTPYQAILCNLFFCSHLNNSYSD---DVIAAIKHYAIGTDKN 3587
            + D++LA       SK    D +F   ++IQ+Y  P IL+  + + I+P + GK+   L P+L  +   Q          PLA+IL SSWKK   + D      R      + RRPR +  Y G  +    IP++ GC++LI TP CL+  + +  +  L  L    +DDAE ++ E+ E +Q+I+ +      +    S P Q +   T WT  + S+ +  M D  +I +    E A+  +V Q++  +         +L+  L+   +   + IIF +T +D+  + + L++  S+    +   M   E+  ++ +W+      +  +L+ +DE +   D+ I +A  ++H D+   S+  FGNRL+ +R  YAK S  +     + K  S+I +   +                        + +S+  +L + K+    E+   +    + +   C  RH++L D+DKP       G ++  +  +V+ + ++ R+ E           S+  LS+  ++ N+F+ + N   + L  V  G + AI   D   RV +  +K + S G      +V  +D+G    V    L +LP  L   P Q +E Y+  +RPID DE ++  +  + +  L++K L+  I L IG T+W+D + +R H   ++ T+    +   LL       N QH++ L  LC G + +  P+LE             T  N+ +  E   +L +  +    C+ S    P LIF+     +K +  +   IN  +   E   +  S  K+G+  L  + +D  W+R  +++     + K+   D+G  E    +R  L  +P E  + P  AI C L         + +   D I  + H   G +K+
Sbjct:  559 QGDRILANLSGGVKSKLILKDFEFPSPMLIQAYGWPGILKLNHVVGISPVQTGKTFTYLCPLLSELLNPQSYQELAIGNGPLALILVSSWKKAQGVYDITRGLLR------EHRRPRPLIIYGGGCEHNQYIPLMNGCEILIATPPCLIRMINRR-YTDLQRLCHLVVDDAEIVLKEYSEEVQKIMEWFAEARKENLHKSVPYQVVAMGTQWTPPVLSFTQAYMLDP-TIVITSRFEAAIYGKVTQQV--HMCPSSLRSTRLLELLDAILNKGMKVIIFTTTVNDVCFIME-LLKSHSLCCNKIHHQMDSYEVEAVLHDWSSGLEKDSPKLLVCTDECV--DDMKIDDANAVIHFDLPSESKTRFGNRLSCMRKYYAKYSESEEEEGQLVKPMSYILMTEHSTG----------------------QARSVRDLLKRLKTPIPRELAAMLAGMKQSR---CPHRHIILPDVDKPANSFLTSGEVKICVANVVNATCYYARVLEHRAQDGTLTDLSTTTLSITFELKNWFSVEKNC--IRLGNVCAGDVCAIVEDDSFFRVQIQDIKWSNSPGSNIMQAQVFFVDEGRVKDVSIIKLYELPPHLKSYPFQTVEVYLCRLRPIDRDENWTSNADQYAHELLQDKVLFGRIVLSIGHTVWLDPLVERQHLKGSQTTINKMYIRSELLHNGYAVDNEQHVQNLYELCEGLLPV--PNLEN------------TQENSELSVET-DLLPESEEFHKVCI-SACDDPGLIFVQRCVFVKQMDAMVDTINDRLQKGEFTPMKASCCKVGTICLGKYTQDDTWYRVKILECLEGGEYKVIFCDQGDTEVLALNR--LNPIPQECFEIPMLAIECELAHVQPRGKKWDEKVGDAIWDMTHTVAGGNKH 1399          
BLAST of Tudor domain-containing protein 12 vs. TrEMBL
Match: A0A1S3IWQ2 (uncharacterized protein LOC106167688 OS=Lingula unguis OX=7574 GN=LOC106167688 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 6.537e-55
Identity = 254/1060 (23.96%), Postives = 488/1060 (46.04%), Query Frame = 3
Query: 1023 HDTKF--LLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTY-------NPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILI-YKRT-GAIDRGSEPSQFI-TATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDV--SEPSFGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECK-LPGCVKRHMVLSDIDKP-------LLPNKGHIQFRLLYLV-SPSHFFVRINEFSGNSEAEF-PYSSQYLSLKMKMANYF---NNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKMKSNQ--SGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVPIMRKFTYTNNPIVFEALPVLDDDNQLETECVFSHIFSPSLIFLNNKTTIKSLRDLQLEINSLIDSI-EALSISDIKIGSKV--LFYRDQCWHRGYVI--KIDCDVKIFSLDEGLIE--NYDHSREQLKKLPYEYQQTPYQAILCNLFFCSHLNNSYSDDVIAAIKHYAIGTDKNTSLIISVYKEENVDSKMFGDSEIFSQLNDDELFLFLKRYXXXXXXXXXXXXDRMLHYVLIRNQHILPSLTWIHDVLPESRPFSSRLERNGSIPHLSADILSTKDGAKRLRISQTIERIIENKIKSYEASGSINENMASFIHGLTILIHFMNEKSEFMCIYRSINRLLSL 4094
            +D KF   +++Q+Y+   ++R  + +A++PPR GK++  L+PV+  I  +      TY        PLA+I+  SWKK  ++ D    F     D+      + +  Y G  ++   IP+L GC +L+ TP CLL  +++  +  LN L    +DDA+ +  +  + + +++  Y +    ++  S P Q +   + WT  + S+    M D   I +   LE ++   VKQ +  Y  +     Q+L+  L       K+ IIF ++  D + + + L  ++   L      +S ++L  + ++WN      + P+L+++DE ++  ++ + NA   +H  +  ++ +F NR   + +     +F +S+ E      S+I I  T      A  + + L R  S  P+ L +  ++ +   ++ + S  +C  +K FG C+    C  RH+V+ + D P        LP  G ++  + +++ S S F+VR+ E    +E  F   ++ Y+ L + M  +F   +NQ+    +   +    + A    +    RV ++ +  ++  +   V+V+ +D G    V ++ +L+LP+   E+P QA+E Y+  I+P+D+D  ++ ++  F +  +E+K+L   I L +G+TLW++ V  R+    TR      +L   LL   L   N QH++KL  LC GK+DI + + +++  + +  +     T      E LP    +++   E   + I SP +  +  +   K +  L  EIN   + I +  S  DI  G+ V  LF  D  W+R  V+  +   +V +  +D G  E   +D    +++ LP +Y+  P+QAI C L   +     + +    A   + +  D     I  V K  N    M+G    +           +  Y       ++   D ++      + HI   +  I +V+  S+ +    ++   IP L A +  + D  +RL I++ ++R + N   S      I E     I G+ +L   +N+++   C+   +  L+S+
Sbjct: 1042 YDRKFGAPILVQAYIWRPMMRARHVVAVSPPRSGKTLAYLLPVISHILQRD-----TYKDVPAGNGPLALIVTPSWKKAQQVFDWCYDFLGGRPDA------KTLIIYGGGSEEDQYIPLLNGCKILVATPYCLLRMIEKG-YTNLNRLCHLVMDDADVLTEDFTDQICQLMTGYTQVLRTVESSSRPQQIVMVGSQWTPGMASFKDTFMVDPLVI-ITSKLEASIYAGVKQSV--YMCVAAQRDQQLLGILNTFVLQDKKAIIFTNSTRDAIDLSQVLKSQSMYVLVAHKELLS-DQLEDIQKDWNIDHREGSKPVLILTDECIK--ELKLTNATCTIHFSLPDTKKAFVNRYGCMLE-----NFKRSQQEEQIVLTSYIII--TDQCTEQAQTVLQLLLRTKSYVPKKL-QTMVEDVKKAKEEEKSKPLCHYLKSFGVCRERQRCEHRHVVVKEQDTPGISKHHISLPTSGEVKVLVTHVIDSASCFYVRLQELRSETEDSFKAMAAAYVQLVLDMNMWFQVKDNQI----IQDEICEGTVCAVQDGQKCYHRVQITCIPQSEFETVKEVQVQYVDVGKLEWVPKSSILKLPQHFLEVPFQAVEVYLCCIKPVDDDTEWTRKAVEFVHQLVEDKELDGRICLSLGNTLWLNPVVSRVKLQCTRSFFHQFSLRKDLLRNGLAVNNLQHLDKLYELCEGKVDIVQRAPKDNMDDSLQSVTVAMET------EILP----ESEEYHEVYVASIDSPGIFHVQKREMEKKIVALIDEINEESEHILQDTSYVDITCGTLVLALFPEDDRWYRAQVLATRGHSEVHVLFVDYGEREWLVFD----KIRNLPEKYRTLPFQAIECCLADLAPREGQWKEGDTDAF--WDLVLDDQDQKIALVAKVINRSPAMYGGCHRY----------HIVLYDTESEDVTINIGDTLVTQGRAVSLHIPEEV--IEEVIIGSKHYDYPYQK---IPDLCAALQISTDEMRRLFIAKALQRTVMN---SANFKDEIRE-----IGGIRLLCGLLNQETSSECVEYLLLTLISM 2032          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Cavefish
Match: tdrd12 (tudor domain containing 12 [Source:ZFIN;Acc:ZDB-GENE-121214-348])

HSP 1 Score: 144.821 bits (364), Expect = 2.160e-34
Identity = 167/684 (24.42%), Postives = 302/684 (44.15%), Query Frame = 3
Query: 1044 IIQSYMIPNILRGFNTLAIA----------PPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKK--MTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFITATV--WTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDV--SEPSFGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPG--CVKRHMVLSDIDKPLLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKM--KSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGK 3035
            + +SY  P++ RG +T+ +           PP        L+  LQ  +      +R   P+A+ILC  W+KV  + D  E       DS         A   G LKK       + + C +L+ TP  L   L+ H F  L    +  LD+   + +   + +  IL + R  A ++  E SQ I A    W+  L+  +   M     + V  P E AV   V Q ++   D        +++ L+ + S  ++T+I  ++ +++  VYK ++  A+  LK   G     + + +V +W +  G     IL+ ++++++   + I +A  ++H     S   FGNRL  + D +   +  K  + P+ +  S + +  +  N R  + + R+L R  +  P  L + S      KE+ K    +C  +K  G C+     C  RH++   +D PL P+ G +Q   LY+ S + ++ RI     +         Q+  L  +M +++  +     V  + V  G L A+  ++   RV V+K+  K ++    V    ID G    V+   LLQLP E   +P QA+E  +  ++PID +  ++ +     +  ++ K   A +  C+GST+W+D + +          + + N+   ++   +   NSQH+E L  LC G+
Sbjct:  340 LAESYAWPSVARGCDTVLVVHGGNDPLTYIPP--------LLAQLQMASVFSALNTRK-GPIAVILCPGWEKVQYVLDLLE-------DSQAAASLHPAAVLLG-LKKDEAKNAKIQKNCQLLVTTPFSLARLLEVHCFLFLRLCHLV-LDEVSELYSRAPDQVT-ILKHFREVAREKSLECSQQIVAVSNQWSRELDGLITEHMVSP-CVVVTVPEEAAVYGGVLQTVLLCLDCNKT--SVMLSSLDFSPSVPQKTLIVTNSVEEVEHVYK-VVNTAAFSLKAHEGLSY--QFDFVVEQWKKDIGSGTQVILVTTNDSMKA--LGIRDATCVVHYGFPGSPKLFGNRLFCMSDNFQNQA--KKSSSPVVR--SVMLL--SERNARHVSGVLRYLKRTCATLPPELLQFSEGVQQAKEEQKIGRALCSHLKSLGFCRWESAVCPDRHIINRTLDHPLHPDSGTVQVLPLYIKSANVYYGRIVSQKQD---------QFKDLAAEMNSHYTEER----VFAKDVVKGGLYAVHEEEEYHRVCVTKVPDKEDKLFSSVTAHFIDDGYVQEVKSHQLLQLPSEFQSLPGQAVEIILCRVQPIDGEMDWNPKVTRAISLKIKGKLHQAKLIKCLGSTVWVDPMIRVTRVPGLSSFINEYNVHDEIIATGMGTINSQHLELLKTLCFGE 977          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Cavefish
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:103041190])

HSP 1 Score: 54.6842 bits (130), Expect = 8.484e-7
Identity = 76/326 (23.31%), Postives = 137/326 (42.02%), Query Frame = 3
Query: 1047 IQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSR---TYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMG-DKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESS-IKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHV 2009
            +Q Y IP I    + +A A    GK+   L+P+LQ +    ++ S+      P AII+  + + ++++   A KF           RP +V  Y G     T+  VL+GC+VL  TP  LL  + + +   L++L    LD+A+ ++    E     L+   +  +    E    + +  +   ++      +  D   +AV   +       V+Q II+      D Y K    LEL +++  +RT++F  T      +  +L Q+  V    + G     E    + ++   +     P+L+ +  A R  DI     E + HV
Sbjct:  241 VQKYGIPIISAKRDLMACAQTGSGKTAAFLLPILQQLMADGVAASKFSEVQEPEAIIVAPTRELINQIYLEARKFAY-----GTCVRPVVV--YGGINTGYTIREVLKGCNVLCGTPGRLLDIIGRGK-VGLSKLRYLVLDEADRMLDMGFEPDMRKLV--SSPGMPAKEERQTLMFSATYPEDIQRLAADFLKVDYLFLAVG--VVGGACSDVEQHIIQV-----DQYSKREQLLELLKTTGTERTMVFVETKRSADFIATFLCQE-KVPTTSIHGDREQREREKALSDFRTGQ----CPVLVATSVAARGLDI-----EHVQHV 539          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Cavefish
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:103041190])

HSP 1 Score: 54.6842 bits (130), Expect = 9.541e-7
Identity = 76/326 (23.31%), Postives = 137/326 (42.02%), Query Frame = 3
Query: 1047 IQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSR---TYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMG-DKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESS-IKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHV 2009
            +Q Y IP I    + +A A    GK+   L+P+LQ +    ++ S+      P AII+  + + ++++   A KF           RP +V  Y G     T+  VL+GC+VL  TP  LL  + + +   L++L    LD+A+ ++    E     L+   +  +    E    + +  +   ++      +  D   +AV   +       V+Q II+      D Y K    LEL +++  +RT++F  T      +  +L Q+  V    + G     E    + ++   +     P+L+ +  A R  DI     E + HV
Sbjct:  262 VQKYGIPIISAKRDLMACAQTGSGKTAAFLLPILQQLMADGVAASKFSEVQEPEAIIVAPTRELINQIYLEARKFAY-----GTCVRPVVV--YGGINTGYTIREVLKGCNVLCGTPGRLLDIIGRGK-VGLSKLRYLVLDEADRMLDMGFEPDMRKLV--SSPGMPAKEERQTLMFSATYPEDIQRLAADFLKVDYLFLAVG--VVGGACSDVEQHIIQV-----DQYSKREQLLELLKTTGTERTMVFVETKRSADFIATFLCQE-KVPTTSIHGDREQREREKALSDFRTGQ----CPVLVATSVAARGLDI-----EHVQHV 560          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Cavefish
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:103041720])

HSP 1 Score: 53.5286 bits (127), Expect = 2.049e-6
Identity = 41/172 (23.84%), Postives = 79/172 (45.93%), Query Frame = 3
Query:  900 VQKYRTENETTDFNYLGSVRPILSYKNDKLLATFLK--EAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWL 1409
            V +YR E E       G  +PI ++       T +K   A+ KH+ +    IQS  IP I+ G + + IA    GK++  L+P+ + I   Q        P+A+I+  + +   ++    +KF++ +         R+V  Y G+     +  + +G ++++ TP  ++  L
Sbjct:  352 VNEYRLELEGITVKGKGCPKPIKTWVQ---CGTSMKVLNALKKHNYEKPTPIQSQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHI-LDQRPLEEGEGPIAVIMTPTRELALQITKECKKFSKPL-------GLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDML 512          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Cavefish
Match: DDX41 (DEAD-box helicase 41 [Source:NCBI gene;Acc:103035623])

HSP 1 Score: 52.7582 bits (125), Expect = 3.553e-6
Identity = 74/326 (22.70%), Postives = 133/326 (40.80%), Query Frame = 3
Query:  948 GSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTI--ATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLET-LQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVN--DPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQ 1910
            G   PI S++  K     LK  + K        IQ   IP IL G + + IA    GK++   +P++       K+L   +   P  +I+C S +   +     E + + + D +   + R      G   K  M  V  G  +++ TP  L+  L + +   L+      LD+A+ +I    E  ++ I  Y       +G   +   +AT+   +++++ K  +    +I V       L VI+ V     EY   E     K+V  LE  + +    +IFA    D+  +++YL+ K  V+   + G    EE    +  + +
Sbjct:  167 GIPAPIKSFREMKFPQAILK-GLKKKGIVHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPIIMFCLEQEKRLPFCKREGPYGLIICPSRELARQTHSIIEYYCKLLED-EGAPQMRSALCIGGMSVKEQMEVVKHGVHMMVATPGRLMDLLNK-KMVSLDICRYLALDEADRMIDMGFEEDIRTIFSY------FKGQRQTLLFSATM-PKKIQNFAKSALVKPITINVGRAGAASLDVIQEV-----EYVKEEA----KMVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKG-VEAVAIHGGKDQEERTKAIEAFKE 472          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 52.7582 bits (125), Expect = 8.344e-7
Identity = 39/176 (22.16%), Postives = 77/176 (43.75%), Query Frame = 3
Query:  882 KVKCWTVQKYRTENETTDFNYLGSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWL 1409
            K+    V  YR E E       G  +PI ++    +    L   + K + +    IQ+  IP I+ G + + IA    GK++G L+P+ + +   Q        P+ +I+  + +   ++A    KFT+ +         R+V  Y G+     +  + +G ++++ TP  ++  L
Sbjct:  341 KMTAEEVSAYRLEMEGVMVKGKGCPKPIKTWVQCGISMKILN-TLKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHV-MDQRPLEEGEGPIGVIMTPTRELALQIAKECRKFTKQLA-------LRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDML 507          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 57.3806 bits (137), Expect = 1.560e-8
Identity = 53/191 (27.75%), Postives = 88/191 (46.07%), Query Frame = 3
Query:  960 PILSYKN---DKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSP---------SRTYNPLAIILCSSWKKVSELADAAEKFT-RFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLE 1493
            PIL + +   D+LL   +K A     T     +Q Y IP + +G + +A A    GK+ G L P+   +     SP         SR   P A++L  + +  +++ + A KFT R  +      RP +V  Y G+     M  V +GCD+L+ TP  L   L++ +   L  ++   LD+A+ ++    E
Sbjct:  152 PILDFSSPPLDELLMENIKLASFTKPTP----VQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWV------RPCVV--YGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGK-VSLANIKYLVLDEADRMLDMGFE 329          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 53.5286 bits (127), Expect = 2.154e-7
Identity = 41/159 (25.79%), Postives = 71/159 (44.65%), Query Frame = 3
Query: 1047 IQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSP---------SRTYNPLAIILCSSWKKVSELADAAEKFT-RFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLE 1493
            +Q Y +P +  G + +A A    GK+ G L PVL        SP          R   P A+I+  + +  +++ D A+KFT R  +        +    Y GS     +  + +GCD+L+ TP  L   L++ +   L  ++   LD+A+ ++    E
Sbjct:  168 VQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWV--------KACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGK-ISLANVKYLVLDEADRMLDMGFE 317          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 52.7582 bits (125), Expect = 3.450e-7
Identity = 82/364 (22.53%), Postives = 152/364 (41.76%), Query Frame = 3
Query:  900 VQKYRTENETTDFNYLGSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMP-VLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLN--ELEIFCLDDAENIIAEHLE-TLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLE-LTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDI 1976
            + ++R ENE T  +     +PI ++         L E  ++   K    IQ    P  L G + + IA    GK++   +P ++   A   L+P     P+ ++L  + +   ++     KF      S ++R       Y G  K   +  + +G +++I TP  L+  L   E  K N   +    LD+A+ ++    E  +++I+   R    DR +     + +  W   ++      + D   + V   LEL+    + Q +    D E     +L  YLE  ++ +  +T+IFAST      + KYL +     L +  G     E + +++E+   R     PI++ +D A R  D+
Sbjct:   92 IAQFRKENEMT-ISGHDIPKPITTFDEAGFPDYVLNEVKAEGFDK-PTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGD--GPIVLVLAPTRELAVQIQTECSKFGH----SSRIRN---TCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDML---EIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRP---DRQT----LMWSATWPKEVKQLAADYLNDPIQVQVGS-LELSASHNITQIVEVVSDFE--KRDRLNKYLETASQDNEYKTLIFASTKRMCDDITKYLREDGWPALAIH-GDKDQRERDWVLQEFRNGRS----PIMVATDVAARGIDV 426          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Yeast
Match: PRP28 (RNA binding protein; involved in RNA isomerization at the 5' splice site and for exchange of U6 for U1 snRNA at the 5' splice site; similar to the RNA helicases of the DEAD-box family [Source:SGD;Acc:S000002651])

HSP 1 Score: 51.6026 bits (122), Expect = 9.292e-7
Identity = 65/289 (22.49%), Postives = 125/289 (43.25%), Query Frame = 3
Query: 1047 IQSYMIPNI-----LRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTY---NPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLE-TLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKF--SIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEE 1880
            IQ   IPN+      R F  L +A    GK++  ++P+L  ++     P        P A+IL  + + V ++    +K T+ I   +     ++++   G   +     + +GCD+L+ TP  L+  L+ H    + ++E   LD+A+ +I    E  +  IL      A    +  +   TAT+ T  +E      M      +I V    E  +     Q+++EY D + D ++KL   +   +  I   IIF +       + +   ++ ++ + ++ GS S E+
Sbjct:  200 IQRITIPNVCNMKQYRDF--LGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTK-IWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENH-LLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQTLMFTATM-TPVIEKIAAGYMQKPVYATIGVETGSEPLI-----QQVVEYADNDEDKFKKLKPIVAKYDPPI---IIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQ 475          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Yeast
Match: DRS1 (Nucleolar DEAD-box protein required for ribosome assembly and function; including synthesis of 60S ribosomal subunits; constituent of 66S pre-ribosomal particles [Source:SGD;Acc:S000003931])

HSP 1 Score: 48.521 bits (114), Expect = 8.285e-6
Identity = 68/330 (20.61%), Postives = 153/330 (46.36%), Query Frame = 3
Query: 1047 IQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLET-LQEILIYKRTGAIDRGSEPS---QFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQ---KIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDV 2015
            IQS  IP  L G + +A A    GK+   ++P+++ +  K   P++  +   I+L  + +   ++AD  ++  RF+     +     V   N  L++   + +    D++I TP   +  ++    F ++ +EI  +D+A+ ++ E  +  L EI+          G  PS     + +    S+++S V   +     I ++ P + A   ++ Q   +I + + ++  L   L+  L+ T    KR ++F +  +    + + +M    + +  + GS++ E+    +   N+++  + +P+L+ +D A R  D  I   E++++ D+
Sbjct:  257 IQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYK---PAKIASTRVIVLLPTRELAIQVADVGKQIARFV---SGITFGLAVGGLN--LRQQEQM-LKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIM----------GLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAAT--KLTQEFVRIRKRDHLKPALLFNLIRKLDPT--GQKRIVVFVARKETAHRL-RIIMGLLGMSVGELHGSLTQEQ---RLDSVNKFKN-LEVPVLICTDLASRGLD--IPKIEVVINYDM 556          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Nematostella
Match: EDO36108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ0])

HSP 1 Score: 66.6254 bits (161), Expect = 1.177e-10
Identity = 73/315 (23.17%), Postives = 127/315 (40.32%), Query Frame = 3
Query: 2604 RVVVSKMKSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDK------NLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVPIMRKFTYTNNPIVFEALPVLDDDNQLETECVFSHIFSPSLIFLNNKTTIKSLRDLQLEINSLIDSIEALSISDIKIGSKVL-------FYRDQCWHRGYVIKIDCDVKIFS--LDEGLIENYDHSREQLKKLPYEYQQTPYQAILCNL 3503
            R +++K   + SG +++VK +D G+       D+ +L  E   +P Q +EC   GIR  D  E + +ES +      E+K L A+I              +R    +  V ++D        +S  L+      K S+      R+   K    KP+     ++  P M  F+Y+   +          +   E +C+ +   SPS  ++   +    L  L ++I +  D    LS  D  +   V+       F  D CW+R  V ++    K+    +D G  E+     + +KKL   +   P Q I C+L
Sbjct:  293 RALITKDLRDASG-FIEVKFMDYGNIQRTPLTDVRELKDEFLSLPAQVVECLHHGIRQADGSEEWPKESLILFKKLTEDKHLVALI-------------DKRNAEGKYEVDLYDTTGDMDMQISQILIAAGYAVKTSEFNPNPLRIPAAKSTPPKPA--PVQVQASPQMPSFSYSKEQL----------NPGQEYKCLITACQSPSKFYIQLFSMASKLEKLMMDIENYYDR---LSADDEWLACPVVGDICCAKFSEDDCWYRAIVTEVQESKKVGVRFIDYGNCESL--PPKHIKKLVPRFSDLPCQGIECSL 576          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Nematostella
Match: EDO25716 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVP3])

HSP 1 Score: 55.0694 bits (131), Expect = 3.086e-8
Identity = 39/144 (27.08%), Postives = 73/144 (50.69%), Query Frame = 3
Query: 1047 IQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENII 1478
            IQ+  IP IL G + +A A    GK+ G  +P+L+ +     S ++  +  A+IL  + +  +++AD    + +++    +V        + G      M+ + +G DVL+ TP  LL  L Q    K ++LE+  LD+A+ ++
Sbjct:   27 IQAQAIPAILAGKDVMAAAQTGTGKTAGFTLPILENLVKG--SRAKPNHVRALILTPTRELAAQVADNIATYGQYLPLRSQV-------VFGGVGINPQMMNLRKGADVLVATPGRLLD-LYQQNAVKFSQLEVLVLDEADRML 160          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Nematostella
Match: EDO49247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX3])

HSP 1 Score: 49.6766 bits (117), Expect = 9.886e-6
Identity = 74/343 (21.57%), Postives = 144/343 (41.98%), Query Frame = 3
Query:  960 PILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQ-TIATKQLSP-SRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLET-LQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVN--DPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSD 1973
            P+ ++K  K     L  A+ K        IQ   +P +L G + + IA    GK++   +P++  ++  ++  P  R   P  +I+  S +   +  +    F+R  +++      R      GS  K     + +G  +++ TP  L+  L +     L+      LD+A+ +I    E  ++ I  Y +       S+    + +     +++++ K  +    ++ V       L VI+ V     EY   E     K+V  LE  + +    +IFA    D+  +++YL+ K  V+   + G  S EE    +RE++Q     N  +L+ +D A +  D
Sbjct:   45 PVKTFKEMKFPRPILA-ALKKKGITHPTPIQVQGLPAVLTGRDMIGIAFTGSGKTLVFTLPIIMFSLEQEKAMPFQRNEGPYGMIVVPSRELARQTFEVITHFSR-ALEAHGFPSLRTNLCIGGSSIKEQSDAMKRGVHMVVATPGRLMDLLDKR-IITLDVCRYLVLDEADRMIDMGFEEDVRTIFSYFK-------SQRQTLLFSATMPKKIQNFAKSALVKPVTVNVGRAGAASLDVIQEV-----EYVKQEA----KVVYLLECLQKTPPPVLIFAEKKSDVDDIHEYLLLKG-VEAVAIHGDKSQEERVHAIREFHQG----NKDVLVATDVASKGLD 363          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Medaka
Match: tdrd12 (tudor domain containing 12 [Source:ZFIN;Acc:ZDB-GENE-121214-348])

HSP 1 Score: 137.502 bits (345), Expect = 5.148e-32
Identity = 150/665 (22.56%), Postives = 282/665 (42.41%), Query Frame = 3
Query: 1056 YMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEIL--IYKRTGAIDRGSEPSQFI-TATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVD--VSEPSFGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPG-CVKRHMVLSDIDKPLLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKMKSNQSGGY--VKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLC 3026
            Y  P + +G N+  I      + +  L P+L  +    L     Y P+ ++LC  W++V  +    E+ TR    S+ +R    +        K   +P  + C +L+ TP   +  L  H       L    LD+A+ + A   + +  IL   +K T   ++   P Q +  A  W+  +E+ V   M    SI +  P E  +   V+Q       +       L+  L+ +  S ++T+I A++  D+  +Y+ +  K++  LK  T      +   + ++W++  G  +  IL+ +DE L+C  + I +A  ++H +   +   FG RL  +   +  LS    +      C +   +  +  N R    + R+L R  +  P  L       +  +++ K S  +C  +K FG C+    C  RH     +D+  LP  G I+   L++ S S F  R+       + EF        +   MA+Y++++        R +  G L A++  D   RV +  +  N    +  V V+ ID G E  V+   +L+LP+    +P QA+E  V G++P D +  +  +     +  +      A   L +G+T+++D + +       +  + + N+   +L   +  +N  H+  L  LC
Sbjct:  297 YSWPAVAQG-NSTVIISHSSDQPLSFLAPLLSHVLQNSL-----YTPMGLLLCPGWERVQMVFSMLEE-TRV---SESLRPATALLGVGKDEAKNFKLP--KNCRMLVTTPFTAVRLLSCHCRL-FQRLYHLVLDEADQLFARAPDQMTTILQHFHKVTTGEEKALFPQQLVCVAKRWSPHMEAMVAAYMPYP-SIVITIPEEAGLYGNVQQ-------VRQFCGHSLLGVLDFSPLSCQKTLIIANSAQDVEYIYEAVSSKSAFCLK--THEDLTHQFTSVAQQWSKVTGPGSPLILVTTDECLKC--LGITDATCVIHYEFPTAPKGFGRRLFCMFKNFRNLS----QQTQSSSCAARSVLLISEKNSRHIIGVMRYLRRTDALLPPELLAFERGVLKARDEQKTSRPLCSYLKSFGVCRDSSVCPDRHTFSPQLDRSALPAAGIIEVLPLFIKSASVFGGRLIR---KEDREFD------EMVSGMASYYSDKKP----EARELQEGGLYAVQEDDTFHRVKILSLPKNGKSQFFCVYVRFIDVGREKEVKSYQMLKLPESFHSLPEQAVEIIVCGVKPADAETDWHPKVIRTISQKIRGLQHRARAVLSVGNTVFVDPMVRVTQVPGMKTLINEYNIQSEILKTGMGIRNPDHLVLLKALC 919          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Medaka
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:100049226])

HSP 1 Score: 56.225 bits (134), Expect = 2.936e-7
Identity = 46/180 (25.56%), Postives = 86/180 (47.78%), Query Frame = 3
Query:  963 ILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSR---TYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLE 1493
            I++++  KL  + LK  +S+        +Q Y +P I  G + +A A    GK+   L+P+LQ +    ++ SR      P A+I+  + + ++++   A KF+          RP +V  Y G      M  + +GC+VL  TP  LL  + + +   L+++    LD+A+ ++    E
Sbjct:  180 IMTFEEAKLCES-LKNNISRSGYVKPTPVQKYGLPIISAGRDLMACAQTGSGKTAAFLLPILQQLMADGVAASRFSEIQEPEAVIVAPTRELINQIYQEARKFS-----FGTCVRPVVV--YGGVNTGYQMREIEKGCNVLCGTPGRLLDMIGRGK-VGLSKVRHLVLDEADRMLDMGFE 350          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Medaka
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:100049226])

HSP 1 Score: 55.4546 bits (132), Expect = 5.686e-7
Identity = 45/175 (25.71%), Postives = 85/175 (48.57%), Query Frame = 3
Query:  963 ILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSR---TYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENII 1478
            I++++  KL  + LK  +S+        +Q Y +P I  G + +A A    GK+   L+P+LQ +    ++ SR      P A+I+  + + ++++   A KF+          RP +V  Y G      M  + +GC+VL  TP  LL  + + +   L+++    LD+A+ ++
Sbjct:  290 IMTFEEAKLCES-LKNNISRSGYVKPTPVQKYGLPIISAGRDLMACAQTGSGKTAAFLLPILQQLMADGVAASRFSEIQEPEAVIVAPTRELINQIYQEARKFS-----FGTCVRPVVV--YGGVNTGYQMREIEKGCNVLCGTPGRLLDMIGRGK-VGLSKVRHLVLDEADRML 455          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Medaka
Match: DDX41 (DEAD-box helicase 41 [Source:NCBI gene;Acc:101175087])

HSP 1 Score: 53.1434 bits (126), Expect = 2.471e-6
Identity = 79/357 (22.13%), Postives = 143/357 (40.06%), Query Frame = 3
Query:  894 WTVQKY-------RTENETTDFNYL----GSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTI--ATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLET-LQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVN--DPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYR 1916
            W   +Y       R E     F+ L    G   PI S++  K     LK  + K        IQ   IP +L G + + IA    GK++   +P++       K+L   +   P  +I+C S +   +     E + + +++ +   + R      G   K  M  V  G  +++ TP  L+  L Q +   L+      LD+A+ +I    E  ++ I  Y       +G   +   +AT+   +++++ K  +    +I V       L VI+ V     EY   E     K+V  LE  + +    +IFA    D+  +++YL+ K  V+   + G    EE    +  + + +
Sbjct:  138 WKAPRYILNMPETRHERVRKKFHILVDGDGIPAPIKSFREMKFPPAILK-GLKKKGIVHPTPIQIQGIPTVLSGRDMIGIAFTGSGKTLVFTLPIIMFALEQEKRLPFFKREGPYGLIICPSRELARQTHSIIEYYCK-LLEEEGAPQLRTALCIGGMSVKEQMEVVKHGVHMMVATPGRLMDLL-QKKMVSLDICRYLALDEADRMIDMGFEEDIRTIFSYF------KGQRQTLLFSATM-PKKIQNFAKSALVKPVTINVGRAGAASLDVIQEV-----EYVKEEA----KMVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKG-VEAVAIHGGKDQEERTKAIEAFKEGK 474          
BLAST of Tudor domain-containing protein 12 vs. Ensembl Medaka
Match: ddx42 (DEAD-box helicase 42 [Source:NCBI gene;Acc:101174023])

HSP 1 Score: 51.9878 bits (123), Expect = 6.765e-6
Identity = 68/340 (20.00%), Postives = 138/340 (40.59%), Query Frame = 3
Query: 1047 IQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVL-QTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENI-----------IAEHLETLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLEL-AVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDI----LIYNAEIILHVDV 2015
            IQ   +P  L G + + IA    GK+   + P+L   +  K+L P     P+A+I+C + +   ++    ++F        K    R VA Y G         + +G ++++ TP  L+  +K+ +   L  +     D+A+ +           IA H+   ++ L++  T                 +  ++E   +  + D   +   D  E    + +V + ++   D    L ++LV +     +S    +IF +   +   +   L Q+    L ++ G M   E N ++ ++ +     N+PIL+ +D A R  DI     + N ++   +D 
Sbjct:  299 IQCQGVPIALSGRDMIGIAKTGSGKTAAFIWPMLVHIMDQKELEPGE--GPIAVIVCPTRELCQQIHAECKRFG-------KAYSLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK-KATSLQRVTYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSAT-----------------FRKKIERLARDILVDPIRVVQGDIGEANEDVTQVVEILLSGSDKWAWLTRRLVEF-----TSAGSVLIFVTKKANSDELAANLTQEG-YSLGLLHGDMDQSERNKVISDFKKK----NLPILVATDVAARGLDIPSIRTVVNYDVARDIDT 601          
BLAST of Tudor domain-containing protein 12 vs. Planmine SMEST
Match: SMESG000065057.1 (SMESG000065057.1)

HSP 1 Score: 3419.4 bits (8865), Expect = 0.000e+0
Identity = 1697/1697 (100.00%), Postives = 1697/1697 (100.00%), Query Frame = 3
Query:    3 MVKFQVIKVEQPNCFVGKDLELFATINSSCQELRQSNSKILPCSEVVIQKIYLANLITEIVRIRVLQCINSNTFRCLLIDHGRIEEIRKQKIYNIPLNKLDMDPAVKMIKIPGVRPAGMNDVLNGPMITVHLSESDKWMPASFKFVSRIFEENSVIHVKYLKQVSKDKVFVDVLVNYLNQRENLKNLLVAQGYAFISKEHDIDIMENHLNHVCINEKETHKSATDKFDSVSIDSLENESISIVIEKMKGDDQMNSTEPNTTYQLNYWKTPENSSGNQSIHGTLDELSLDIINLKVKCWTVQKYRTENETTDFNYLGSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDVSEPSFGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPGCVKRHMVLSDIDKPLLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKMKSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVPIMRKFTYTNNPIVFEALPVLDDDNQLETECVFSHIFSPSLIFLNNKTTIKSLRDLQLEINSLIDSIEALSISDIKIGSKVLFYRDQCWHRGYVIKIDCDVKIFSLDEGLIENYDHSREQLKKLPYEYQQTPYQAILCNLFFCSHLNNSYSDDVIAAIKHYAIGTDKNTSLIISVYKEENVDSKMFGDSEIFSQLNDDELFLFLKRYXXXXXXXXXXXXDRMLHYVLIRNQHILPSLTWIHDVLPESRPFSSRLERNGSIPHLSADILSTKDGAKRLRISQTIERIIENKIKSYEASGSINENMASFIHGLTILIHFMNEKSEFMCIYRSINRLLSLAYKTIPMSNVENENERFTIKSITTLMLSYESFIFHMLRHLEITARTHPIDNCHVILDNLRMILLDPFTVTVLFEEPSWYVVMATCVASLQNDCNHYNLLMDILVQLVMLWKSNKTVLGDILIHCCLSLQKSDSPVIWTASLALITCFVNKQNYASIFRNIKFFEILFDKFVSYYEQIDRWEEFHENALDILSNMWRNGSANSREILRRRILSTDIDVVCRKNPRNTTLSRLLTEILREESCNSSHDDTVRAPTISKNAPDKDAIDWIEGREFIEKKHRSSYKRIYYGXXXXXXXXXXXXXXXXXXXXXVGATPFLKDDLNPADEDNVLCFVKP 5093
            MVKFQVIKVEQPNCFVGKDLELFATINSSCQELRQSNSKILPCSEVVIQKIYLANLITEIVRIRVLQCINSNTFRCLLIDHGRIEEIRKQKIYNIPLNKLDMDPAVKMIKIPGVRPAGMNDVLNGPMITVHLSESDKWMPASFKFVSRIFEENSVIHVKYLKQVSKDKVFVDVLVNYLNQRENLKNLLVAQGYAFISKEHDIDIMENHLNHVCINEKETHKSATDKFDSVSIDSLENESISIVIEKMKGDDQMNSTEPNTTYQLNYWKTPENSSGNQSIHGTLDELSLDIINLKVKCWTVQKYRTENETTDFNYLGSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDVSEPSFGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPGCVKRHMVLSDIDKPLLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKMKSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVPIMRKFTYTNNPIVFEALPVLDDDNQLETECVFSHIFSPSLIFLNNKTTIKSLRDLQLEINSLIDSIEALSISDIKIGSKVLFYRDQCWHRGYVIKIDCDVKIFSLDEGLIENYDHSREQLKKLPYEYQQTPYQAILCNLFFCSHLNNSYSDDVIAAIKHYAIGTDKNTSLIISVYKEENVDSKMFGDSEIFSQLNDDELFLFLKRYSVTVSKPSVKPSDRMLHYVLIRNQHILPSLTWIHDVLPESRPFSSRLERNGSIPHLSADILSTKDGAKRLRISQTIERIIENKIKSYEASGSINENMASFIHGLTILIHFMNEKSEFMCIYRSINRLLSLAYKTIPMSNVENENERFTIKSITTLMLSYESFIFHMLRHLEITARTHPIDNCHVILDNLRMILLDPFTVTVLFEEPSWYVVMATCVASLQNDCNHYNLLMDILVQLVMLWKSNKTVLGDILIHCCLSLQKSDSPVIWTASLALITCFVNKQNYASIFRNIKFFEILFDKFVSYYEQIDRWEEFHENALDILSNMWRNGSANSREILRRRILSTDIDVVCRKNPRNTTLSRLLTEILREESCNSSHDDTVRAPTISKNAPDKDAIDWIEGREFIEKKHRSSYKRIYYGSSTESSSNDHSNSEADSDSSDVGATPFLKDDLNPADEDNVLCFVKP
Sbjct:    1 MVKFQVIKVEQPNCFVGKDLELFATINSSCQELRQSNSKILPCSEVVIQKIYLANLITEIVRIRVLQCINSNTFRCLLIDHGRIEEIRKQKIYNIPLNKLDMDPAVKMIKIPGVRPAGMNDVLNGPMITVHLSESDKWMPASFKFVSRIFEENSVIHVKYLKQVSKDKVFVDVLVNYLNQRENLKNLLVAQGYAFISKEHDIDIMENHLNHVCINEKETHKSATDKFDSVSIDSLENESISIVIEKMKGDDQMNSTEPNTTYQLNYWKTPENSSGNQSIHGTLDELSLDIINLKVKCWTVQKYRTENETTDFNYLGSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDILIYNAEIILHVDVSEPSFGNRLNFLRDKYAKLSFLKSRNEPIEKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEKSKGSNEICPRIKCFGECKLPGCVKRHMVLSDIDKPLLPNKGHIQFRLLYLVSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLRLVHVGLLAAIKIKDLLERVVVSKMKSNQSGGYVKVKLIDKGSEMIVEQADLLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLYAIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQHIEKLARLCTGKIDIWKPSLEESTIEHVPIMRKFTYTNNPIVFEALPVLDDDNQLETECVFSHIFSPSLIFLNNKTTIKSLRDLQLEINSLIDSIEALSISDIKIGSKVLFYRDQCWHRGYVIKIDCDVKIFSLDEGLIENYDHSREQLKKLPYEYQQTPYQAILCNLFFCSHLNNSYSDDVIAAIKHYAIGTDKNTSLIISVYKEENVDSKMFGDSEIFSQLNDDELFLFLKRYSVTVSKPSVKPSDRMLHYVLIRNQHILPSLTWIHDVLPESRPFSSRLERNGSIPHLSADILSTKDGAKRLRISQTIERIIENKIKSYEASGSINENMASFIHGLTILIHFMNEKSEFMCIYRSINRLLSLAYKTIPMSNVENENERFTIKSITTLMLSYESFIFHMLRHLEITARTHPIDNCHVILDNLRMILLDPFTVTVLFEEPSWYVVMATCVASLQNDCNHYNLLMDILVQLVMLWKSNKTVLGDILIHCCLSLQKSDSPVIWTASLALITCFVNKQNYASIFRNIKFFEILFDKFVSYYEQIDRWEEFHENALDILSNMWRNGSANSREILRRRILSTDIDVVCRKNPRNTTLSRLLTEILREESCNSSHDDTVRAPTISKNAPDKDAIDWIEGREFIEKKHRSSYKRIYYGSSTESSSNDHSNSEADSDSSDVGATPFLKDDLNPADEDNVLCFVKP 1697          
BLAST of Tudor domain-containing protein 12 vs. Planmine SMEST
Match: SMESG000072404.1 (SMESG000072404.1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.532e-10
Identity = 69/292 (23.63%), Postives = 133/292 (45.55%), Query Frame = 3
Query:  933 DF-NYLGSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRI-VAAYNGSLKKMTMIPVLQ-GCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEH-LETLQEILIYKRTGAIDRGSEPSQ--FITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFAST 1790
            DF N L     + S+ + K+    LK  M  + TK    IQ   IP  L+  +  A A    GK++  L+P+++ +        R   P A++L  + +   ++ + A+   +F         P++ V   +G L +      L+ G D++I TP  L+  +     F L ++E F LD+A+ ++ E+ +E ++E+L         +G  P++   + +   T  ++  +   + D F I VN   ++A  + ++Q++I       +  + ++  L +     KRTIIF  T
Sbjct:   86 DFKNILTEYVTVASFMDMKISKPILKALMDSNITK-PTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKF--------SPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVL---------KGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVA--DNLQQEVIRIRSHRAEDREAMLMAL-ICRGFSKRTIIFLPT 356          
BLAST of Tudor domain-containing protein 12 vs. Planmine SMEST
Match: SMESG000049071.1 (SMESG000049071.1)

HSP 1 Score: 58.5362 bits (140), Expect = 3.624e-8
Identity = 61/265 (23.02%), Postives = 126/265 (47.55%), Query Frame = 3
Query:  999 FLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIA-TKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEH--LETLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLE-LTESSIKRTIIF 1781
            FL+  +   D K L  +Q Y IP I  G + +A A    GK+M  L+P+++ I+     S S   +P  +I+  + +   ++   A +  +   DS      +   +Y G   + +M+ + + CD+L+ TP  L++ L+      L+++    LD+A+ ++     +E+++  L+Y+++  +          +AT + + ++   +  + D   +AV   L  A    +KQ +++        + KL A LE LT +   +T++F
Sbjct:  131 FLRLNIKSSDYKKLTPVQKYTIPMINSGRDLMACAQTGSGKTMAFLVPIIKNISENPDTSSSGKNSPKCLIVVPTRELCRQIFTVAHRLCK---DS----SVKCSYSYGGVEMRTSMMKLYK-CDILVSTPGRLVANLESAA-ISLDKIRYLVLDEADRLLQNEKFMESIK--LVYEKSKLVGVDKFHVSMFSAT-FPAEIQQLGESLLSDHLFVAVG--LVGAANTDIKQTVLQVNS-----HDKLNASLEYLTNNKTGKTLVF 376          
BLAST of Tudor domain-containing protein 12 vs. Planmine SMEST
Match: SMESG000012031.1 (SMESG000012031.1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.760e-6
Identity = 80/361 (22.16%), Postives = 160/361 (44.32%), Query Frame = 3
Query:  900 VQKYRTENETTDFNYLGSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYN-PLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLET-LQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDILLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISDEALRCSDI 1976
            V+K+R EN  T         P+L ++  +    F+  A+  +       IQS   P  L G + + IA    GK+   L+P +  I  +   P ++ + P+ +IL  +     ELA   EK     I+  +  + +I   Y G+ +   +  + +  +V+I TP  L+ +L   +   L       LD+A+ ++    E  +++I+   R    DR +     + +  W + +++     + +   I V   L L     +KQK+   ++ E +  ++L+    L ++  KR+++F+ T   +  + + +++K  +D   M G     E   +++++   R YV    L+ +D A R  DI
Sbjct:   56 VEKFRKENNITIIGE-NVPNPVLCFEEVQF-PNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQ--PPVQSGDGPICLILVPT----RELAQQVEKVA---IEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFL-NDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRP---DRQT----LMWSATWPNEVQNLASDFLKNYVQINVGS-LYLHANPDIKQKVEILDEKEKE--ERLIEI--LCDNKRKRSLVFSETKRKVDDLCRIIVRKG-IDCMAMHGDKVQREREKVLQDFRDGRCYV----LIATDVASRGLDI 387          
BLAST of Tudor domain-containing protein 12 vs. Planmine SMEST
Match: SMESG000011907.1 (SMESG000011907.1)

HSP 1 Score: 51.9878 bits (123), Expect = 4.724e-6
Identity = 54/232 (23.28%), Postives = 98/232 (42.24%), Query Frame = 3
Query: 1047 IQSYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLAIILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIPVLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQEILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPLELAVIERVKQKIIEYEDIEGDLYQKLVAYL 1742
            IQ    P ++ G + + IA    GK++  L+P    I  +     +   P  +IL  + +   ++ +  +K+T   IDS        V  Y G+ K+  +  + +  ++++ TP  +   LK      L ++    LD+A+ ++    E     LIY    A+ R  +    +T+  W   ++      M +   + V   L+L     VKQ  +EY D   D  Q+LV  L
Sbjct:  382 IQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIEGQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDS--------VVCYGGADKRDQIYQLKENPEIVVGTPGRIQD-LKDSGVLNLKDVSYLVLDEADRMLDMGFEIQVVNLIY----AVRRQRQ--TVMTSATWPFGVQRIALTHMKNPVQVNVG-TLDLNACHTVKQH-VEYVDYH-DKTQRLVEIL 595          
The following BLAST results are available for this feature:
BLAST of Tudor domain-containing protein 12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TDRD127.382e-4325.65tudor domain containing 12 [Source:HGNC Symbol;Acc... [more]
TDRD121.844e-4125.34tudor domain containing 12 [Source:HGNC Symbol;Acc... [more]
TDRD125.778e-1127.43tudor domain containing 12 [Source:HGNC Symbol;Acc... [more]
DDX412.443e-823.53DEAD-box helicase 41 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX41.117e-726.29DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Tudor domain-containing protein 12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein 12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rm623.608e-1123.35gene:FBgn0003261 transcript:FBtr0301947[more]
Rm623.608e-1123.35gene:FBgn0003261 transcript:FBtr0078650[more]
Rm623.884e-1123.35gene:FBgn0003261 transcript:FBtr0078649[more]
Rm623.884e-1123.35gene:FBgn0003261 transcript:FBtr0078651[more]
Rm623.884e-1123.35gene:FBgn0003261 transcript:FBtr0078654[more]
back to top
BLAST of Tudor domain-containing protein 12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdrd121.441e-3423.25tudor domain containing 12 [Source:ZFIN;Acc:ZDB-GE... [more]
tdrd121.571e-3423.25tudor domain containing 12 [Source:ZFIN;Acc:ZDB-GE... [more]
tdrd123.330e-3423.81tudor domain containing 12 [Source:ZFIN;Acc:ZDB-GE... [more]
ddx463.730e-723.53DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ddx425.548e-719.71DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
back to top
BLAST of Tudor domain-containing protein 12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcd38.361e-2724.93SWI/SNF related, matrix associated, actin dependen... [more]
smarcd32.004e-2524.89SWI/SNF related, matrix associated, actin dependen... [more]
polg22.712e-926.32polymerase (DNA directed), gamma 2, accessory subu... [more]
polg22.779e-926.32polymerase (DNA directed), gamma 2, accessory subu... [more]
polg22.797e-926.32polymerase (DNA directed), gamma 2, accessory subu... [more]
back to top
BLAST of Tudor domain-containing protein 12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tdrd129.584e-3925.21tudor domain containing 12 [Source:MGI Symbol;Acc:... [more]
Tdrd123.771e-2327.45tudor domain containing 12 [Source:MGI Symbol;Acc:... [more]
Ddx412.427e-823.53DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 [Source:... [more]
Ddx413.406e-823.53DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 [Source:... [more]
Ddx41.855e-725.14DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
back to top
BLAST of Tudor domain-containing protein 12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q587J7|TDR12_HUMAN3.545e-4225.65Putative ATP-dependent RNA helicase TDRD12 OS=Homo... [more]
sp|Q1XG89|TDR12_BOMMO2.590e-3624.54Putative ATP-dependent RNA helicase TDRD12 OS=Bomb... [more]
sp|Q9CWU0|TDR12_MOUSE2.727e-2227.45Putative ATP-dependent RNA helicase TDRD12 OS=Mus ... [more]
sp|P19109|DDX17_DROME7.212e-1023.35ATP-dependent RNA helicase p62 OS=Drosophila melan... [more]
sp|Q755N4|DBP2_ASHGO3.348e-823.35ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii... [more]
back to top
BLAST of Tudor domain-containing protein 12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PGL26.186e-6427.10Tudor domain-containing protein 12 OS=Mizuhopecten... [more]
A0A2B4S2743.707e-5824.56Putative ATP-dependent RNA helicase TDRD12 OS=Styl... [more]
C3XUE73.033e-5624.27Uncharacterized protein OS=Branchiostoma floridae ... [more]
K1R0K82.231e-5524.69Tudor domain-containing protein 12 OS=Crassostrea ... [more]
A0A1S3IWQ26.537e-5523.96uncharacterized protein LOC106167688 OS=Lingula un... [more]
back to top
BLAST of Tudor domain-containing protein 12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdrd122.160e-3424.42tudor domain containing 12 [Source:ZFIN;Acc:ZDB-GE... [more]
ddx48.484e-723.31DEAD-box helicase 4 [Source:NCBI gene;Acc:10304119... [more]
ddx49.541e-723.31DEAD-box helicase 4 [Source:NCBI gene;Acc:10304119... [more]
ddx462.049e-623.84DEAD-box helicase 46 [Source:NCBI gene;Acc:1030417... [more]
DDX413.553e-622.70DEAD-box helicase 41 [Source:NCBI gene;Acc:1030356... [more]
back to top
BLAST of Tudor domain-containing protein 12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ddx468.344e-722.16DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
back to top
BLAST of Tudor domain-containing protein 12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBP11.560e-827.75Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
DED12.154e-725.79ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
DBP23.450e-722.53ATP-dependent RNA helicase of the DEAD-box protein... [more]
PRP289.292e-722.49RNA binding protein; involved in RNA isomerization... [more]
DRS18.285e-620.61Nucleolar DEAD-box protein required for ribosome a... [more]
back to top
BLAST of Tudor domain-containing protein 12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO361081.177e-1023.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257163.086e-827.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO492479.886e-621.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tudor domain-containing protein 12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdrd125.148e-3222.56tudor domain containing 12 [Source:ZFIN;Acc:ZDB-GE... [more]
ddx42.936e-725.56DEAD-box helicase 4 [Source:NCBI gene;Acc:10004922... [more]
ddx45.686e-725.71DEAD-box helicase 4 [Source:NCBI gene;Acc:10004922... [more]
DDX412.471e-622.13DEAD-box helicase 41 [Source:NCBI gene;Acc:1011750... [more]
ddx426.765e-620.00DEAD-box helicase 42 [Source:NCBI gene;Acc:1011740... [more]
back to top
BLAST of Tudor domain-containing protein 12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065057.10.000e+0100.00SMESG000065057.1[more]
SMESG000072404.12.532e-1023.63SMESG000072404.1[more]
SMESG000049071.13.624e-823.02SMESG000049071.1[more]
SMESG000012031.11.760e-622.16SMESG000012031.1[more]
SMESG000011907.14.724e-623.28SMESG000011907.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001485 ID=SMED30001485|Name=Tudor domain-containing protein 12|organism=Schmidtea mediterranea sexual|type=transcript|length=5107bp
AGATGGTTAAGTTCCAGGTTATTAAAGTTGAACAACCAAATTGCTTTGTT
GGCAAAGACTTGGAATTATTTGCCACTATTAATTCTTCATGCCAAGAATT
AAGACAAAGCAATTCAAAAATTTTGCCATGTAGTGAAGTTGTTATTCAAA
AGATTTATTTAGCTAACTTAATCACCGAAATAGTAAGAATTCGAGTACTT
CAATGTATAAATTCAAATACATTTCGATGCTTGCTAATAGATCATGGTCG
AATAGAAGAAATAAGGAAACAAAAGATTTATAATATTCCATTAAACAAGC
TCGACATGGATCCTGCAGTGAAAATGATAAAAATTCCCGGAGTAAGACCG
GCTGGTATGAATGATGTGCTAAATGGTCCAATGATAACTGTTCATTTAAG
TGAATCTGATAAATGGATGCCAGCTAGTTTTAAGTTTGTCTCAAGAATTT
TTGAAGAGAATTCGGTGATACATGTCAAATATCTAAAACAAGTATCAAAA
GATAAAGTGTTTGTAGATGTTTTAGTTAATTATCTTAATCAACGGGAGAA
CTTAAAGAATTTGTTAGTTGCTCAAGGATATGCTTTCATTTCGAAAGAAC
ACGACATCGACATTATGGAAAATCATCTTAACCACGTTTGTATTAATGAA
AAGGAGACTCATAAATCTGCAACTGACAAATTTGATTCTGTATCGATTGA
TTCATTGGAGAATGAATCAATATCTATTGTGATTGAAAAAATGAAAGGCG
ATGATCAAATGAATTCAACCGAGCCAAATACTACATACCAACTCAATTAT
TGGAAAACCCCAGAGAATTCGTCCGGTAACCAATCCATCCACGGAACTCT
CGATGAATTATCTTTGGACATAATAAATTTGAAAGTTAAATGTTGGACAG
TTCAGAAATATCGAACAGAAAATGAAACGACAGACTTCAATTACTTGGGT
TCTGTGCGACCGATATTATCATATAAGAACGATAAACTTCTAGCAACATT
TTTGAAAGAAGCAATGTCAAAACATGACACGAAATTCCTGTTGATTATAC
AATCGTACATGATACCAAACATTCTACGGGGCTTCAACACACTTGCTATT
GCACCTCCGAGGAAGGGCAAATCCATGGGTTTACTCATGCCAGTTCTACA
GACAATCGCCACAAAGCAACTGTCACCATCGAGAACGTATAACCCGTTAG
CAATAATTTTGTGCTCAAGTTGGAAAAAAGTCAGTGAATTGGCCGATGCG
GCGGAAAAGTTTACGAGATTTATTATCGACTCTGATAAAGTGAGAAGACC
CCGAATCGTGGCAGCATATAACGGCTCGTTGAAAAAAATGACAATGATTC
CGGTATTGCAGGGCTGTGATGTGCTTATAATCACTCCGAATTGTCTCTTG
AGCTGGCTTAAACAGCACGAATTTTTCAAATTGAATGAATTGGAGATTTT
CTGTCTTGATGACGCTGAAAATATAATCGCAGAGCATTTGGAAACCTTGC
AGGAAATATTGATTTACAAACGAACCGGTGCCATCGATCGGGGCAGTGAA
CCCAGCCAATTTATTACTGCAACTGTGTGGACATCACGATTAGAGTCGTA
TGTAAAACACGAGATGGGAGATAAATTCAGTATTGCCGTCAATGATCCTC
TGGAACTCGCTGTTATCGAACGCGTCAAACAAAAAATTATTGAATATGAA
GATATCGAAGGAGACCTCTATCAAAAATTGGTTGCTTACCTAGAACTAAC
GGAATCATCGATCAAACGAACGATTATATTTGCGAGCACCGATGACGACA
TTCTATTAGTTTATAAGTATTTAATGCAAAAAGCAAGTGTCGACCTTAAG
ATGATGACTGGATCGATGAGTCCAGAGGAATTAAATTTAATGGTGAGAGA
ATGGAATCAATATCGAGGATATGTAAACATGCCAATTTTATTGATATCAG
ACGAAGCTCTTCGCTGTAGCGATATATTGATTTATAATGCTGAAATAATT
CTTCATGTCGATGTCTCTGAGCCATCATTCGGCAATCGATTAAATTTCCT
ACGGGATAAGTATGCGAAATTGTCGTTTTTAAAATCGCGAAATGAGCCGA
TTGAGAAATGCCATTCATTTATATTCATTTGTCCAACGACACTGAATTTG
CGATCAGCAAACTTTCTCCATCGATTTCTTGGTCGATGTGGATCAGACCG
CCCTGAATGGTTGAAAGAAAAATCAATTGATTTTATTTTAAATAAAGAAA
AATCTAAAGGATCAAATGAAATTTGTCCCCGAATAAAGTGCTTTGGAGAA
TGTAAATTACCCGGATGCGTTAAACGACATATGGTATTATCGGATATTGA
TAAACCTCTGTTACCAAATAAAGGTCACATACAATTTCGCTTGTTATACT
TGGTGTCTCCTTCTCATTTCTTTGTCCGAATCAATGAATTCAGTGGTAAT
TCAGAAGCGGAATTTCCCTATAGTTCCCAATATTTGAGTTTGAAAATGAA
AATGGCCAATTATTTCAACAATCAAATGAATATTCACGGAGTAAATCTCA
GATTGGTGCATGTAGGACTTCTTGCGGCGATTAAAATCAAAGATCTGCTG
GAACGAGTAGTTGTTAGTAAAATGAAATCAAACCAATCGGGAGGGTATGT
AAAAGTGAAATTAATCGATAAAGGATCAGAAATGATTGTCGAACAAGCTG
ATCTCCTTCAGTTACCTAAGGAATTGGGTGAAATACCGCCACAGGCAATA
GAATGTTATGTGACTGGTATAAGACCAATTGATAACGATGAGATTTATAG
TGAAGAGAGCTGTTTATTTACGAATACATTTCTCGAAGAAAAAGATCTTT
ACGCTATTATAAGACTTTGTATCGGATCAACGCTATGGATCGATAGTGTG
ACACAACGTATTCACCATGCACAAACTCGTGTGACGGTTTTCGATAAAAA
TTTATCCGTTACACTTTTAGACAAGAATTTAGTCGATAAAAATAGTCAAC
ATATTGAAAAACTTGCACGTTTGTGTACGGGTAAAATCGATATTTGGAAG
CCAAGTCTTGAAGAAAGTACAATAGAGCATGTACCAATCATGCGGAAATT
CACTTACACTAATAATCCCATTGTTTTTGAAGCACTTCCCGTTCTTGATG
ATGATAACCAACTTGAGACTGAATGCGTTTTTTCTCATATTTTTTCTCCC
AGTTTGATTTTCCTCAACAACAAAACCACTATTAAATCCCTTAGAGATCT
TCAACTTGAAATCAATTCATTAATAGATTCTATTGAGGCTTTATCTATTT
CGGACATAAAAATAGGATCAAAAGTTCTTTTTTACAGAGATCAATGCTGG
CATAGAGGCTATGTTATCAAAATCGATTGTGATGTCAAGATATTTTCTCT
CGATGAAGGTTTGATTGAAAATTATGATCATAGTCGAGAACAATTAAAAA
AACTTCCTTACGAATACCAACAAACTCCTTATCAAGCAATTCTATGCAAT
CTTTTCTTTTGTTCTCATCTCAATAACTCATATTCAGATGATGTTATTGC
TGCTATCAAACATTATGCGATTGGAACTGATAAAAACACTTCATTGATTA
TCTCTGTATACAAAGAAGAAAATGTCGATAGCAAAATGTTTGGTGATTCG
GAAATATTTTCTCAGCTGAATGATGATGAATTATTCCTATTCCTGAAACG
GTACTCTGTGACAGTGTCTAAACCAAGTGTAAAGCCTTCGGATCGTATGC
TGCATTATGTGTTGATTCGTAATCAACACATACTGCCATCTTTGACTTGG
ATTCATGATGTTTTACCGGAAAGTAGACCATTTTCCAGTCGATTAGAAAG
AAATGGTTCGATTCCTCACTTGTCTGCGGATATTCTAAGTACAAAGGACG
GTGCAAAGAGATTGCGAATTTCTCAGACTATTGAACGAATAATTGAAAAC
AAAATCAAAAGTTATGAGGCTTCTGGATCAATTAATGAAAATATGGCATC
TTTTATTCATGGCTTGACGATTTTAATACATTTTATGAATGAAAAATCGG
AATTTATGTGCATTTATCGATCTATAAATAGACTACTATCTCTAGCTTAT
AAAACCATTCCAATGTCAAATGTAGAAAATGAAAACGAGAGATTTACTAT
TAAATCTATTACAACATTGATGTTATCCTATGAATCGTTCATATTCCACA
TGCTCAGACATCTGGAAATCACTGCTAGAACTCATCCAATTGATAATTGC
CATGTTATCTTAGATAATTTACGGATGATTTTATTGGATCCTTTTACAGT
CACTGTTCTTTTTGAGGAGCCTTCTTGGTACGTTGTTATGGCTACATGTG
TTGCATCTCTTCAAAACGATTGCAACCACTATAATTTGCTAATGGATATA
TTGGTTCAACTTGTAATGCTATGGAAATCTAACAAAACTGTATTGGGAGA
TATTTTAATACATTGTTGTCTCTCATTACAGAAAAGTGATTCTCCTGTCA
TTTGGACTGCAAGTTTAGCTTTAATAACATGTTTTGTGAATAAACAAAAT
TATGCATCAATATTTCGAAATATTAAATTTTTTGAAATTCTTTTTGACAA
ATTTGTGTCATATTATGAGCAAATTGATCGATGGGAGGAATTTCATGAAA
ATGCATTAGACATATTGTCCAATATGTGGAGAAACGGTTCGGCCAATTCT
CGGGAAATACTTAGAAGGAGGATATTGTCTACGGATATTGATGTAGTGTG
CAGAAAAAATCCAAGAAATACCACACTAAGCCGACTTCTGACCGAAATTC
TACGGGAAGAAAGTTGTAATTCGTCTCACGATGATACGGTTCGTGCTCCT
ACAATTAGTAAAAACGCGCCTGATAAAGATGCTATTGATTGGATTGAAGG
AAGAGAATTTATTGAAAAGAAACACAGAAGTAGTTATAAGAGAATATATT
ATGGCAGTAGTACAGAATCATCTAGTAATGATCATAGTAATTCTGAAGCC
GATTCTGATTCATCAGATGTTGGCGCAACTCCTTTTCTAAAGGATGATCT
GAATCCTGCCGACGAAGATAATGTTCTATGTTTTGTGAAGCCTTGAGTTG
CATGTGA
back to top

protein sequence of SMED30001485-orf-1

>SMED30001485-orf-1 ID=SMED30001485-orf-1|Name=SMED30001485-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1698bp
MVKFQVIKVEQPNCFVGKDLELFATINSSCQELRQSNSKILPCSEVVIQK
IYLANLITEIVRIRVLQCINSNTFRCLLIDHGRIEEIRKQKIYNIPLNKL
DMDPAVKMIKIPGVRPAGMNDVLNGPMITVHLSESDKWMPASFKFVSRIF
EENSVIHVKYLKQVSKDKVFVDVLVNYLNQRENLKNLLVAQGYAFISKEH
DIDIMENHLNHVCINEKETHKSATDKFDSVSIDSLENESISIVIEKMKGD
DQMNSTEPNTTYQLNYWKTPENSSGNQSIHGTLDELSLDIINLKVKCWTV
QKYRTENETTDFNYLGSVRPILSYKNDKLLATFLKEAMSKHDTKFLLIIQ
SYMIPNILRGFNTLAIAPPRKGKSMGLLMPVLQTIATKQLSPSRTYNPLA
IILCSSWKKVSELADAAEKFTRFIIDSDKVRRPRIVAAYNGSLKKMTMIP
VLQGCDVLIITPNCLLSWLKQHEFFKLNELEIFCLDDAENIIAEHLETLQ
EILIYKRTGAIDRGSEPSQFITATVWTSRLESYVKHEMGDKFSIAVNDPL
ELAVIERVKQKIIEYEDIEGDLYQKLVAYLELTESSIKRTIIFASTDDDI
LLVYKYLMQKASVDLKMMTGSMSPEELNLMVREWNQYRGYVNMPILLISD
EALRCSDILIYNAEIILHVDVSEPSFGNRLNFLRDKYAKLSFLKSRNEPI
EKCHSFIFICPTTLNLRSANFLHRFLGRCGSDRPEWLKEKSIDFILNKEK
SKGSNEICPRIKCFGECKLPGCVKRHMVLSDIDKPLLPNKGHIQFRLLYL
VSPSHFFVRINEFSGNSEAEFPYSSQYLSLKMKMANYFNNQMNIHGVNLR
LVHVGLLAAIKIKDLLERVVVSKMKSNQSGGYVKVKLIDKGSEMIVEQAD
LLQLPKELGEIPPQAIECYVTGIRPIDNDEIYSEESCLFTNTFLEEKDLY
AIIRLCIGSTLWIDSVTQRIHHAQTRVTVFDKNLSVTLLDKNLVDKNSQH
IEKLARLCTGKIDIWKPSLEESTIEHVPIMRKFTYTNNPIVFEALPVLDD
DNQLETECVFSHIFSPSLIFLNNKTTIKSLRDLQLEINSLIDSIEALSIS
DIKIGSKVLFYRDQCWHRGYVIKIDCDVKIFSLDEGLIENYDHSREQLKK
LPYEYQQTPYQAILCNLFFCSHLNNSYSDDVIAAIKHYAIGTDKNTSLII
SVYKEENVDSKMFGDSEIFSQLNDDELFLFLKRYSVTVSKPSVKPSDRML
HYVLIRNQHILPSLTWIHDVLPESRPFSSRLERNGSIPHLSADILSTKDG
AKRLRISQTIERIIENKIKSYEASGSINENMASFIHGLTILIHFMNEKSE
FMCIYRSINRLLSLAYKTIPMSNVENENERFTIKSITTLMLSYESFIFHM
LRHLEITARTHPIDNCHVILDNLRMILLDPFTVTVLFEEPSWYVVMATCV
ASLQNDCNHYNLLMDILVQLVMLWKSNKTVLGDILIHCCLSLQKSDSPVI
WTASLALITCFVNKQNYASIFRNIKFFEILFDKFVSYYEQIDRWEEFHEN
ALDILSNMWRNGSANSREILRRRILSTDIDVVCRKNPRNTTLSRLLTEIL
REESCNSSHDDTVRAPTISKNAPDKDAIDWIEGREFIEKKHRSSYKRIYY
GSSTESSSNDHSNSEADSDSSDVGATPFLKDDLNPADEDNVLCFVKP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035437SNase_OB-fold_sf
IPR011545DEAD/DEAH_box_helicase_dom
IPR027417P-loop_NTPase
IPR002999Tudor
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003676nucleic acid binding
GO:0004386helicase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1080..1100
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 292..547
e-value: 9.9E-21
score: 76.0
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 1086..1154
e-value: 3.5E-9
score: 38.7
coord: 833..907
e-value: 3.8E-11
score: 45.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1650..1671
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1650..1683
NoneNo IPR availablePANTHERPTHR22655UNCHARACTERIZEDcoord: 147..1104
NoneNo IPR availableCDDcd17948DEADc_DDX28coord: 334..503
e-value: 1.15296E-13
score: 70.088
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 1078..1168
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 824..923
IPR035437SNase-like, OB-fold superfamilyGENE3DG3DSA:2.40.50.90coord: 1061..1205
e-value: 3.5E-9
score: 38.7
IPR035437SNase-like, OB-fold superfamilyGENE3DG3DSA:2.40.50.90coord: 801..953
e-value: 3.8E-11
score: 45.1
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 349..506
e-value: 4.3E-10
score: 39.6
IPR002999Tudor domainPFAMPF00567TUDORcoord: 1055..1167
e-value: 3.9E-10
score: 39.8
coord: 793..920
e-value: 9.4E-11
score: 41.8
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 320..525