Hexosyltransferase

Overview
NameHexosyltransferase
Smed IDSMED30001483
Uniprot Best hitN-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=B3gnt4 PE=2 SV=2 (E=1.67078e-25)
Length (bp)1945
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hexosyltransferase (SMED30001483) t-SNE clustered cells

Violin plots show distribution of expression levels for Hexosyltransferase (SMED30001483) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hexosyltransferase (SMED30001483) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hexosyltransferase (SMED30001483) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001483

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30001483SMESG000060671.1 OX_Smed_1.0.21905ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001483SMESG000060671.1 SMESG000060669.1 dd_Smed_v4_5936_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30001483SMESG000060671.1 SMESG000060669.1 dd_Smed_v4_5936_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT1 (beta-1,3-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:916])

HSP 1 Score: 107.842 bits (268), Expect = 6.172e-25
Identity = 80/292 (27.40%), Postives = 141/292 (48.29%), Query Frame = 3
Query:  801 IKDYKFTSLVNAVPFTCGNQVTLVLVVLCET-SNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMG--AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQS-KKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            I  + F  L+N  P  C   +  +++++  T   ++ R+ IR TWG   N K                 +   +F++G  A  +  + V+Q+         F+DI+     +D+Y NLTLKTL G+      C+KA + +K D+D+FVN+  L+   ++ L  S K +         N   IRD  +KWY+P ++Y  + +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    +    N  F + +   ++  C  R +I  H+I+P +M  +WN+++S
Sbjct:   58 INPHSFEFLINE-PNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFK---------------GIKIATLFLLGKNADPVLNQMVEQESQI------FHDII-VEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLI---YKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIF-SADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSL--CRYRRVITVHQISPEEMHRIWNDMSS 320          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GNT4 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:15683])

HSP 1 Score: 106.301 bits (264), Expect = 3.295e-24
Identity = 77/291 (26.46%), Postives = 129/291 (44.33%), Query Frame = 3
Query:  840 PFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQ---WLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVEL-----IDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICSFSP 1688
            P  C     L+L +  +  + E+R  IR+TWG+   W   +                 + KLVF++G       +  Q L +   E  F+DI+ +    + + NLTLK L         C +A F LK D DVFV+VP +L            + ++VG+    A   R+   K+++P  +Y   ++PPY  G GY+++   +  +       + LF  +DV V GM    + L        K F     ++ +D C  R ++L HR++P +M ++W  +T     C+  P
Sbjct:   86 PSGCSKDTFLLLAIKSQPGHVERRAAIRSTWGRVGGWARGR-----------------QLKLVFLLGVAGSAPPA--QLLAYESRE--FDDILQW-DFTEDFFNLTLKELHLQRWVVAACPQAHFMLKGDDDVFVHVPNVLEFLD---GWDPAQDLLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGGYVMSRATVRRLQAIMEDAE-LFPIDDVFV-GMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMWALVTDEGLKCAAGP 349          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GNT4 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:15683])

HSP 1 Score: 106.301 bits (264), Expect = 3.295e-24
Identity = 77/291 (26.46%), Postives = 129/291 (44.33%), Query Frame = 3
Query:  840 PFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQ---WLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVEL-----IDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICSFSP 1688
            P  C     L+L +  +  + E+R  IR+TWG+   W   +                 + KLVF++G       +  Q L +   E  F+DI+ +    + + NLTLK L         C +A F LK D DVFV+VP +L            + ++VG+    A   R+   K+++P  +Y   ++PPY  G GY+++   +  +       + LF  +DV V GM    + L        K F     ++ +D C  R ++L HR++P +M ++W  +T     C+  P
Sbjct:   86 PSGCSKDTFLLLAIKSQPGHVERRAAIRSTWGRVGGWARGR-----------------QLKLVFLLGVAGSAPPA--QLLAYESRE--FDDILQW-DFTEDFFNLTLKELHLQRWVVAACPQAHFMLKGDDDVFVHVPNVLEFLD---GWDPAQDLLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGGYVMSRATVRRLQAIMEDAE-LFPIDDVFV-GMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMWALVTDEGLKCAAGP 349          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GNT4 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:15683])

HSP 1 Score: 105.916 bits (263), Expect = 5.713e-24
Identity = 77/291 (26.46%), Postives = 129/291 (44.33%), Query Frame = 3
Query:  840 PFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQ---WLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVEL-----IDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICSFSP 1688
            P  C     L+L +  +  + E+R  IR+TWG+   W   +                 + KLVF++G       +  Q L +   E  F+DI+ +    + + NLTLK L         C +A F LK D DVFV+VP +L            + ++VG+    A   R+   K+++P  +Y   ++PPY  G GY+++   +  +       + LF  +DV V GM    + L        K F     ++ +D C  R ++L HR++P +M ++W  +T     C+  P
Sbjct:  111 PSGCSKDTFLLLAIKSQPGHVERRAAIRSTWGRVGGWARGR-----------------QLKLVFLLGVAGSAPPA--QLLAYESRE--FDDILQW-DFTEDFFNLTLKELHLQRWVVAACPQAHFMLKGDDDVFVHVPNVLEFLD---GWDPAQDLLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGGYVMSRATVRRLQAIMEDAE-LFPIDDVFV-GMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMWALVTDEGLKCAAGP 374          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GNT7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:HGNC Symbol;Acc:HGNC:18811])

HSP 1 Score: 103.605 bits (257), Expect = 4.339e-23
Identity = 82/320 (25.62%), Postives = 139/320 (43.44%), Query Frame = 3
Query:  747 SYEPLQKYTNELFLMKYFIKDYKFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDV------AVTGMYSTNVELIDNKLFRYEEYMNT---IDSCNMRIIILAHRITPSKMISLWNEITSNTTICS 1679
            +++P  +     F    F +  ++  ++   P  C   V L++VV    + +++R+ IR TWG            R   S        + +F++G  S   +           +  + DI+ + G LDT+ NLTLK +  L      C    F  K D DVFVN   LL        Q     + VG+   +A  IR K+ K+Y+P  +Y K  +PPY  G G+L+ + ++   +  A     L+  +DV       V G+  T  E    K F      N+    + C  R +++ H++ P +++++W  + SN T CS
Sbjct:   96 THQPWFQVLEPQFRQFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWG------------RERQSAGGGRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYGDILQW-GFLDTFFNLTLKEIHFLKWLDIYCPHVPFIFKGDDDVFVNPTNLLEFLADRQPQEN---LFVGDVLQHARPIRRKDNKYYIPGALYGKASYPPYAGGGGFLM-AGSLARRLHHACDTLELYPIDDVFLGMCLEVLGVQPTAHEGF--KTFGISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLT-CS 395          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: B0024.15 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q8MQG4])

HSP 1 Score: 90.1225 bits (222), Expect = 2.374e-19
Identity = 77/270 (28.52%), Postives = 124/270 (45.93%), Query Frame = 3
Query:  771 TNELFLMKYFIKDYKFTSLVNAVPF-TCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDF-IQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAI--IVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELID----NKLFRY 1556
            TN+ +  ++  KD   T     VP   C N   L + +L    N++ R+ IR TW    NS++  N            N  ++ F++       K+  + L+F +Q E    D M    L ++Y  L LK    L+  +  C  A F LK D D+ V++  L    ++ L   K+ +I  I G    N+P +R+K  +WYVP  +YS+ +FPPY+ G  YL+   A+  ++  A    +    EDV  TG+    +++      N L RY
Sbjct:   56 TNQFYHAQF--KDQNHTYQFITVPKKQCSNNTKLQITILSTAGNFDIRQAIRETWANPNNSEHVAN------------NDVRISFIIS------KTSNEFLNFALQKEIEKFDDMIVTDLYESYELLILKVHAILSYKQSHCQLADFQLKIDDDMAVDMDGL----YRSLEDKKQASINGISGIIWKNSPPVREKKHRWYVPKTLYSEKFFPPYIDGPIYLIGKNAVPRMLEEAKNYNQWII-EDVFWTGVIGKALKIKQINWANHLLRY 300          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: B0024.15 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q8MQG4])

HSP 1 Score: 90.1225 bits (222), Expect = 2.374e-19
Identity = 77/270 (28.52%), Postives = 124/270 (45.93%), Query Frame = 3
Query:  771 TNELFLMKYFIKDYKFTSLVNAVPF-TCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDF-IQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAI--IVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELID----NKLFRY 1556
            TN+ +  ++  KD   T     VP   C N   L + +L    N++ R+ IR TW    NS++  N            N  ++ F++       K+  + L+F +Q E    D M    L ++Y  L LK    L+  +  C  A F LK D D+ V++  L    ++ L   K+ +I  I G    N+P +R+K  +WYVP  +YS+ +FPPY+ G  YL+   A+  ++  A    +    EDV  TG+    +++      N L RY
Sbjct:   56 TNQFYHAQF--KDQNHTYQFITVPKKQCSNNTKLQITILSTAGNFDIRQAIRETWANPNNSEHVAN------------NDVRISFIIS------KTSNEFLNFALQKEIEKFDDMIVTDLYESYELLILKVHAILSYKQSHCQLADFQLKIDDDMAVDMDGL----YRSLEDKKQASINGISGIIWKNSPPVREKKHRWYVPKTLYSEKFFPPYIDGPIYLIGKNAVPRMLEEAKNYNQWII-EDVFWTGVIGKALKIKQINWANHLLRY 300          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: E03H4.11 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O17750])

HSP 1 Score: 81.6481 bits (200), Expect = 2.379e-16
Identity = 67/255 (26.27%), Postives = 111/255 (43.53%), Query Frame = 3
Query:  849 CGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAH 1613
               +  ++++V   T +Y +R  +R TW    +S+   N             R K +F++G    + K  +     +Q    + DI+    + DTY  LT K+L  L     K  +     K D DV     +L  L  Q +  +          Q  A + RDKN +WYVP   YS + FP YV+G  Y++  +A   I + ++K +     EDV +TG+ + ++ +    L ++ +Y N ID      II  H
Sbjct:  111 ASQEKDILMIVASRTDSYARRNIMRQTWMNKSDSEIVAN------------GRMKPLFLVGLTPGDYKMKKM---VMQEAKLYGDIIVV-DMNDTYEELTYKSLAILLYGVSKAPRYQMIGKIDEDVIFFPDKLTALYEQGIIDATPLCAYGYKIQAGARIFRDKNDRWYVPESSYSCSKFPEYVSGMLYMVTWEAAQQI-IKSTKYRDFIQVEDVFLTGILAEDLGISVRNLPKFYKYPNDIDESKSVDIIAWH 348          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: C54C8.3 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O02231])

HSP 1 Score: 77.7962 bits (190), Expect = 2.283e-15
Identity = 65/249 (26.10%), Postives = 107/249 (42.97%), Query Frame = 3
Query:  867 LVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAH 1613
            ++++V   T +Y +R  +R TW    NS+   N             R K +F++G      K  +     +Q    + DI+    + D Y  LT K+L  L     K  +     K D DV     +L  L  Q    +    I     Q  A + RDK  +WYVP   YS + FP YV+G  Y++  +A   I + ++K +     EDV +TG+ + ++ +    L  + +Y + I+  N   +I  H
Sbjct:   78 ILIIVASRTDSYARRNILRQTWMSKANSEIVAN------------GRMKPLFLVGLTPGEYKMKKM---VMQEAKLYGDIIVV-DMNDNYEELTYKSLAILLYGVSKAPRYQMIGKIDEDVMFFPDKLTELYDQGFIDATPLRIYGLKMQSGANIFRDKTHRWYVPESSYSCSKFPEYVSGMLYMVTWEAAQQI-IKSTKYRDFIQVEDVFLTGILAEDLGISVKNLPEFYKYPSDIEESNPGDVIAWH 309          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: F14B6.4 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O62163])

HSP 1 Score: 71.633 bits (174), Expect = 4.165e-13
Identity = 54/222 (24.32%), Postives = 94/222 (42.34%), Query Frame = 3
Query:  867 LVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVEL 1532
            ++++V   T ++ +R  +R TW    NS+   +             R K +F++G    +   +++    +  E      M    L DTY  L  K+LT L     K ++     K D D+     ++L L  Q+L     ++I          V RDK  +W+VP   Y  + FPPY  G  YL+   A   I + A+K +     ED  + G+ + + ++
Sbjct:   90 ILMIVASRTDSFARRNVLRKTWMNPENSEIIKD------------GRMKALFLVGMTDGDDSRMRK---VVMEEARIYGDMVVVDLKDTYEELPFKSLTTLLYGTSKASEFKLIGKIDEDIMFFPDKILPLLEQNLIDPSSESIYGMLFAEGGYVYRDKEHRWFVPDSTYGCDMFPPYTGGLFYLVTQDAAKKI-LNATKHRIFIPIEDALINGILANDCKI 295          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: GalT1 (gene:FBgn0053145 transcript:FBtr0088048)

HSP 1 Score: 103.99 bits (258), Expect = 2.983e-23
Identity = 86/323 (26.63%), Postives = 142/323 (43.96%), Query Frame = 3
Query:  849 CGNQVTLVLVVLCETSNYEQRKTIRNTWGQ--------------WLNSKYSINLPRSINSI-DYYSNR-------TKLVFVMGAKSINLKSVQQDLDFIQNETH-FNDIMYFPGLLDTYMNLTLKTLTGLNVARQKC-TKATFFLKADTDVFVNVPRLLGLC--------------HQH------LAQSKKKA---IIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            C N+  LV+ V     N+ QR TIR TWG                L   Y   LP  +    DY S          ++VF++G +        + L+ I  E+  +NDI+     +D+Y NLTLK++  L    + C   A +FLK D D FVN+P LL                 H          Q++ KA   ++ G++  N   + + ++KWY+P  +Y    +P Y++G GYL++   +  +   AS    L Y EDV +TG+ +   + I+        + ++   C  +  I  H++    M+S WN +++ +  C
Sbjct:  129 CRNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQ-ENFVDSYNNLTLKSVMALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRL-FEASLNTTLVYLEDVYITGLCAQKAK-INRHHHPLFSFAHSKQMCAFKGTITQHQLKDDSMVSAWNYVSNYSIKC 448          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG30036 (gene:FBgn0050036 transcript:FBtr0088050)

HSP 1 Score: 100.138 bits (248), Expect = 2.837e-22
Identity = 91/344 (26.45%), Postives = 146/344 (42.44%), Query Frame = 3
Query:  801 IKDY----KFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQ--------------WLNSKYSINLPRSINSIDYY--------SNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCT-KATFFLKADTDVFVNVPRLLGLC--------------HQHLAQSKK---------KAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYS--TNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            I DY    K T+L+    F C ++  LV+ V     ++EQR  IR TWG                L  KY   +P  +     Y        + + ++VF++G +S N    + D  F ++  H NDI+     +D+Y NLTLK++  L    Q C  +A FFLK D D FVNVP LL                 H       K         + ++ G++  N   + D  + WY+PY ++    +P Y++G GYL++   +  +   A     L + EDV VTG+ +    +      LF    Y++    C  +  I  H +    M+  W  +++ +  C
Sbjct:   35 IGDYLDQGKNTALIVPRDF-CKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDSLTAKIRIVFILG-RSKNDSKRELDKLFRESIQH-NDIIQ-ENFVDSYHNLTLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTS-LVHLEDVFVTGICAKKAGIRRRHQPLF---NYVHGKPLCIFKGTITMHPVPLHSMLDAWAFVSNYSIKC 370          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG30037 (gene:FBgn0050037 transcript:FBtr0088049)

HSP 1 Score: 100.138 bits (248), Expect = 3.296e-22
Identity = 83/341 (24.34%), Postives = 146/341 (42.82%), Query Frame = 3
Query:  798 FIKDYKFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQW--------------LNSKYSINLPRSI--------NSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKAT-FFLKADTDVFVNVPRLL-------------------GLCHQHLAQSKK----KAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYS--TNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            ++   K T+L+    F C ++  L + V     ++E+R+ IR  WG +              L  +Y   LP  +           D      +LVF++G +  NL S+ ++         +ND++     +DTY NLT+K +  L    Q C   T F+ K D D FVNVP +L                   G  ++  +  K+    + ++ G +  N P   +K  KWY+P  ++    +P Y+ G GYLL+   +  +   AS   R+ + ED+ VTG+ +    ++  ++ LFR        + C ++     HR   + M   W  +T+ ++ C
Sbjct:   68 YLDPTKDTALIVPRHF-CRSKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDSLRASIRLVFIVGRR--NLASLLENEAVAIEAQKYNDVIQ-ENFIDTYNNLTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRL-YKASLGTRIVHLEDMFVTGLCAEKAGIKRTNHPLFRSSYPYEGDEQCALKGSFTVHRAKDNVMWEAWYRVTNFSSKC 403          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG8668 (gene:FBgn0031988 transcript:FBtr0339671)

HSP 1 Score: 100.138 bits (248), Expect = 1.013e-21
Identity = 82/282 (29.08%), Postives = 137/282 (48.58%), Query Frame = 3
Query:  852 GNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNR-TKLVFVMGA---KSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKLFRYEEYMN---TIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            G  + L++++    S+   R +IR TW                  + Y + R   + FV+G    ++IN K++ Q+ +FI     + D++     +D+Y NLTLKT++ L  A   C KA + LK D D+F+NVP+LL    +H    K K  I G        IR+K +K+YV  + ++   FP + TG  Y+L    +  + V + K   L   EDV  TG+ + ++ +   K  +  E++N   + + CN+R  I  H I  ++   LW ++   TT C
Sbjct:  337 GEFIKLLVLISSAMSHDAARMSIRQTW------------------MHYGTRRDVGMAFVLGRGTNETIN-KALTQE-NFI-----YGDLIRG-NFIDSYNNLTLKTISTLEWADVHCPKAKYILKTDDDMFINVPKLLTFLDKH----KDKRTIYGRLAKKWKPIRNKKSKYYVSVDQFAAGVFPSFTTGPAYVLTGDIVHELYVRSLKTVYL-KLEDVFTTGIVAKSLNV---KRVQANEFVNRRISFNPCNIRNAISVHMIKSNEQFDLWKKLLDQTTKC 584          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG8668 (gene:FBgn0031988 transcript:FBtr0079576)

HSP 1 Score: 100.138 bits (248), Expect = 1.013e-21
Identity = 82/282 (29.08%), Postives = 137/282 (48.58%), Query Frame = 3
Query:  852 GNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNR-TKLVFVMGA---KSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKLFRYEEYMN---TIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            G  + L++++    S+   R +IR TW                  + Y + R   + FV+G    ++IN K++ Q+ +FI     + D++     +D+Y NLTLKT++ L  A   C KA + LK D D+F+NVP+LL    +H    K K  I G        IR+K +K+YV  + ++   FP + TG  Y+L    +  + V + K   L   EDV  TG+ + ++ +   K  +  E++N   + + CN+R  I  H I  ++   LW ++   TT C
Sbjct:  337 GEFIKLLVLISSAMSHDAARMSIRQTW------------------MHYGTRRDVGMAFVLGRGTNETIN-KALTQE-NFI-----YGDLIRG-NFIDSYNNLTLKTISTLEWADVHCPKAKYILKTDDDMFINVPKLLTFLDKH----KDKRTIYGRLAKKWKPIRNKKSKYYVSVDQFAAGVFPSFTTGPAYVLTGDIVHELYVRSLKTVYL-KLEDVFTTGIVAKSLNV---KRVQANEFVNRRISFNPCNIRNAISVHMIKSNEQFDLWKKLLDQTTKC 584          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:ZFIN;Acc:ZDB-GENE-021210-4])

HSP 1 Score: 110.153 bits (274), Expect = 2.593e-25
Identity = 87/305 (28.52%), Postives = 147/305 (48.20%), Query Frame = 3
Query:  816 FTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWG--QWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETH-FNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKK-KAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVE-------------LIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICS 1679
            F  L+N  P  C  ++ L++V+    + +++R+ IR TWG  Q LN K                 R K +F++G KS NL+        ++ E + + DI+ +   +D++ NLTLK +  L      C K  +  K D DVFV+VP +     ++L  S   K + VG+  F A  IR K  K+Y+P  +Y+K  +PPY  G G+L++  A+   +  A +   L+  +DV + GM    ++             L+ NK  R        + C  + +I+ H++ P  ++S+W  + S+  ICS
Sbjct:  139 FPMLINH-PEKCSGEIDLLIVIKSVITQFDRREVIRKTWGKEQVLNGK-----------------RIKTLFLLG-KSSNLEERANHQKLLEYEDYIYGDILQW-DFMDSFFNLTLKEIHFLKWFSSYCPKTQYIFKGDDDVFVSVPNIF----EYLEISGNLKDLFVGDVLFKAKPIRKKQNKYYIPQALYNKTLYPPYAGGGGFLMDG-ALARKLYGACETLELYPIDDVFL-GMCLEVLQVTPIKHNAFKTFGLVKNKTSRLNR-----EPCFFKSLIVVHKLLPPDLMSMWKLVNSD-LICS 411          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3galt1a (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-120215-203])

HSP 1 Score: 99.7525 bits (247), Expect = 2.016e-22
Identity = 76/292 (26.03%), Postives = 142/292 (48.63%), Query Frame = 3
Query:  801 IKDYKFTSLVNAVPFTCGNQVT-LVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKL-VFVMG--AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            +  + F  L+N  P  C +    LVL++      ++ R+ IR TWG                  + +SN   L +F++G   + +  + V+Q+         F+DI+     +D+Y NLTLKTL G+      C  A + +K D+D+FVN+  L+    +  A+ +++         N   IRD ++KW++P E+Y  + +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    ++   N  F +  +  T   C  R ++  H+I+P +++ +WN++++
Sbjct:   60 LNPHNFKFLINE-PKKCESTTPFLVLLISTNHKEFDARQAIRETWGD----------------ENTFSNVHILTLFLLGYSTEPVLNQMVEQESQI------FHDIL-VEDFVDSYHNLTLKTLMGMRWVSLFCPNAQYVMKTDSDIFVNMDNLVFNLLRPNAKPRRR--FFTGHVINGGPIRDVHSKWFMPRELYPDSRYPPFCSGTGYVY-SGDMAELLYKTSLHTRLLHLEDVYVGLCLRKLGIQPFQNNGFNH--WKMTYSLCRYRKVLTVHQISPEEILRIWNDMSN 322          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: CABZ01072312.1 (beta-1,3-galactosyltransferase 2-like [Source:NCBI gene;Acc:100333524])

HSP 1 Score: 97.4413 bits (241), Expect = 9.128e-22
Identity = 83/298 (27.85%), Postives = 144/298 (48.32%), Query Frame = 3
Query:  804 KDYKFTSLVNAVPFTCGNQVTLVLVVL-CETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNK------LFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            ++YKF   +  +P  C  Q   V++++     N E R  IR TWG     +  I L               ++F++G++S N +++Q+ L   QNE+  +  +      DTY NLT+KTL  +    +KC +A++  K D DV +NV  LL +       + ++  I G       V+RD  +K+Y+P++VY ++ +PPY  G  Y+  S  +   ++  S+  R  + ED A  GM    + +   K      L R  E+++      + I IL    +PS++IS W ++ S+  +C
Sbjct:   42 QNYKF---ILDLPEKCQQQEPFVVIIVPVAPENIEARNAIRTTWGNEGLVRDKIVL---------------VLFLLGSRSGN-ETLQEQL---QNESQQHGDLLQSSFQDTYRNLTVKTLVMMEWLSRKCPQASYAAKVDADVLLNVKNLLYMLVS--LNTLERNYITGLVLSVNNVMRDPTSKFYIPHDVYPRSRYPPYPQGMCYIF-SMDLPEKILHISRFVRPIFIED-AYIGMCLRRLGIRPEKLNFGQFLIRPPEHLDRFYYSGL-IAILTQ--SPSQLISYWMDVQSSNKLC 310          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3gnt5a (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5a [Source:NCBI gene;Acc:336526])

HSP 1 Score: 97.8265 bits (242), Expect = 2.082e-21
Identity = 64/219 (29.22%), Postives = 110/219 (50.23%), Query Frame = 3
Query:  849 CGNQ-VTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKS--INLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDV 1496
            C N+ V L+L V     N+++R+ IR+TWG   N  Y   + + +  +       K+VF MG +      K++Q++L   ++  H + I      LDT+ NLT+K L       + C  A F + AD DVF++VP L+    Q L     + + VG+    AP +R +++K+Y+P+++Y  + +P Y  G GY+++      I      +    Y +DV
Sbjct:   83 CKNKDVLLLLFVKSSPGNFKRRQAIRSTWG---NESY---ISQELGVV------VKVVFAMGVRPDRSGHKTMQRELR-KEHMAHHDLIQ--QDFLDTFHNLTVKLLLQFRWTHENCAHAHFLMSADDDVFIHVPNLVHYL-QELKSQNVRNLWVGHVHRGAPPVRKRDSKYYMPFDMYQWSSYPDYTAGAGYVVSGDVAAKIYQATQSLNASMYIDDV 285          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3gnt5a (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5a [Source:NCBI gene;Acc:336526])

HSP 1 Score: 97.8265 bits (242), Expect = 2.082e-21
Identity = 64/219 (29.22%), Postives = 110/219 (50.23%), Query Frame = 3
Query:  849 CGNQ-VTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKS--INLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDV 1496
            C N+ V L+L V     N+++R+ IR+TWG   N  Y   + + +  +       K+VF MG +      K++Q++L   ++  H + I      LDT+ NLT+K L       + C  A F + AD DVF++VP L+    Q L     + + VG+    AP +R +++K+Y+P+++Y  + +P Y  G GY+++      I      +    Y +DV
Sbjct:   83 CKNKDVLLLLFVKSSPGNFKRRQAIRSTWG---NESY---ISQELGVV------VKVVFAMGVRPDRSGHKTMQRELR-KEHMAHHDLIQ--QDFLDTFHNLTVKLLLQFRWTHENCAHAHFLMSADDDVFIHVPNLVHYL-QELKSQNVRNLWVGHVHRGAPPVRKRDSKYYMPFDMYQWSSYPDYTAGAGYVVSGDVAAKIYQATQSLNASMYIDDV 285          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000004498.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:98847617:98849399:-1 gene:ENSXETG00000000266.1 transcript:ENSXETT00000004498.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 2.813e-26
Identity = 82/298 (27.52%), Postives = 136/298 (45.64%), Query Frame = 3
Query:  816 FTSLVNAVPFTCGN-----QVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDV------AVTGMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            F  L+++ P  CG      +V+L+L +    +NYE+R+ +R TWG          + ++ N       + K +F++G      +     L  I+++  +ND++ +    D++ NLTLK +  L     KC  A +    D DVFVN   ++   +       K  + VG    N P IR  N K+YVP  ++  N F PY  G G L+ S    SI+  +  +  LF  +DV      A  G+  +N E I     R    +++ D C  R +++ HR  P +M+ +WN +      C
Sbjct:   78 FPQLLDS-PMKCGGPANSKEVSLLLAIKSSPANYERREAVRKTWG----------VEKTYNGF-----QVKRIFLIGTPKQKYEKRMMQLLTIESQL-YNDVLQW-DFYDSFYNLTLKQVLFLTWFEAKCPGAKYIFDGDDDVFVNTVNVITYLNSLSKDGNKHHLFVGALNTNMPPIRQTNRKYYVPQALFKGNKFDPYCGGGGILIASFTAHSIIRESQYIP-LFPIDDVYLGMCLARAGLKPSNHEGIKTLGIRLPN-VDSFDPCYYRHMLVVHRFVPYEMLIMWNALQITELKC 355          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: tcp11l1 (t-complex 11, testis-specific-like 1 [Source:Xenbase;Acc:XB-GENE-5887205])

HSP 1 Score: 109.768 bits (273), Expect = 1.082e-25
Identity = 75/290 (25.86%), Postives = 141/290 (48.62%), Query Frame = 3
Query:  801 IKDYKFTSLVNAVPFTCGNQVTLVLVVLCET-SNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETH-FNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            I  + F  ++N  P  CG     +++++  T   ++ R+ IR TWG               N  ++   +   +F++G  S  + +       ++ E+  F+DI+     +D+Y NLTLKTL G+      C+KA + +K D+D+FVN+  L+    +   + +++         N   IRD  +KWY+P ++Y ++ +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    +    N  F + +   ++  C  R +I  H+I P +M  +WN+++S
Sbjct:   56 INPHSFEFVINE-PEKCGKDGPFLVILISTTHKEFDARQAIRETWG---------------NESNFKGIKIVTLFLLGKNSDPVLN-----QMVEQESQIFHDIV-VEDFIDSYHNLTLKTLMGMRWVATFCSKAKYIMKTDSDIFVNMDNLIYKLLKPTTKPRRRYFT--GYVINGGPIRDVRSKWYMPRDLYPESNYPPFCSGTGYIF-SADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSL--CRYRRVITVHQIGPEEMHRIWNDMSS 318          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: B3GNT4 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Source:NCBI gene;Acc:100491670])

HSP 1 Score: 109.383 bits (272), Expect = 2.695e-25
Identity = 89/313 (28.43%), Postives = 149/313 (47.60%), Query Frame = 3
Query:  774 NELFLMKYFIKDYKFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINL--KSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVN----VPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDN-----KLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICS 1679
            + LFLM    ++  F++L+   P  C     L+L +     N E+R  IRNTWG+                 D  S + KL+F++G     L  KS++Q L +   E  F D++ +   +D + NLTLK +  L    ++C+ A F LK D DVF+N    V  L GL       +  K + VG+   NA  IR+   K+++P+ +YS  ++P Y  G GY+++ K    ++ +A +   LF  +DV V GM    + +        K F  +   N  D C  + +++ H++ P+ M  +W+ +      C+
Sbjct:   77 HRLFLMYKHCRN--FSTLLK--PSKCEKDTFLLLAIKSLPINIERRIAIRNTWGK---------------QQDIQSKKIKLLFLLGKTDSTLPAKSLRQLLSYESIE--FKDLIQW-DFVDNFFNLTLKEIHLLRWLNKECSHAKFVLKGDDDVFINTFNIVEFLDGL-------NPDKDLFVGDVITNAVPIRNTKVKYFIPHSMYSAPHYPLYAGGGGYVMSRKTTKGLLSSA-ETTDLFPIDDVFV-GMCLEKINVKPQFHAGFKTFGIQRPGNPFDPCLYKGLMVVHKLNPTDMWIMWSLVKDEELRCA 358          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000004482.1 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3, gene 1 [Source:NCBI gene;Acc:100380117])

HSP 1 Score: 105.531 bits (262), Expect = 7.491e-24
Identity = 81/299 (27.09%), Postives = 137/299 (45.82%), Query Frame = 3
Query:  816 FTSLVNAVPFTCGN-----QVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMG-AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWED------VAVTGMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            F  L+++ P  CG      +V+L+L +    +NYE+R+ +R TWG          + ++ N       + K +F++G  K  + +     L  I+++  +ND++ +    D++ NLTLK +  L     KC  A F    D DVFVN   ++   +       K  + VG      P IR  N+K+YV   ++  N F PY  G G L+ S    SI+  +  +  LF  +D      +A  G+  +N E I     R    +++ D C  R +++ HR  P +M+ +WN +      C
Sbjct:   95 FPQLLDS-PMKCGGPANSKEVSLLLAIKSSPANYERREAVRKTWG----------VEKTYNGF-----QVKRIFLIGTPKQKDEEKRMMQLLTIESQL-YNDVLQW-DFYDSFYNLTLKQVLFLTWFEAKCPGAKFIFNGDDDVFVNTVNVITYLNSLNNDGNKHHLFVGALNIGMPPIRQPNSKYYVSEALFKGNEFDPYCGGGGILIASFTAHSIIRESQYIP-LFPIDDAYLGMCLARAGLKPSNHEGIKTLGIRLPN-VDSFDPCYYRHMLVVHRFVPYEMLIMWNALQITELKC 373          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000004465.1 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3, gene 1 [Source:NCBI gene;Acc:100380117])

HSP 1 Score: 105.531 bits (262), Expect = 1.125e-23
Identity = 81/299 (27.09%), Postives = 137/299 (45.82%), Query Frame = 3
Query:  816 FTSLVNAVPFTCGN-----QVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMG-AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWED------VAVTGMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            F  L+++ P  CG      +V+L+L +    +NYE+R+ +R TWG          + ++ N       + K +F++G  K  + +     L  I+++  +ND++ +    D++ NLTLK +  L     KC  A F    D DVFVN   ++   +       K  + VG      P IR  N+K+YV   ++  N F PY  G G L+ S    SI+  +  +  LF  +D      +A  G+  +N E I     R    +++ D C  R +++ HR  P +M+ +WN +      C
Sbjct:  129 FPQLLDS-PMKCGGPANSKEVSLLLAIKSSPANYERREAVRKTWG----------VEKTYNGF-----QVKRIFLIGTPKQKDEEKRMMQLLTIESQL-YNDVLQW-DFYDSFYNLTLKQVLFLTWFEAKCPGAKFIFNGDDDVFVNTVNVITYLNSLNNDGNKHHLFVGALNIGMPPIRQPNSKYYVSEALFKGNEFDPYCGGGGILIASFTAHSIIRESQYIP-LFPIDDAYLGMCLARAGLKPSNHEGIKTLGIRLPN-VDSFDPCYYRHMLVVHRFVPYEMLIMWNALQITELKC 407          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3gnt4 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Source:MGI Symbol;Acc:MGI:2680208])

HSP 1 Score: 112.079 bits (279), Expect = 2.389e-26
Identity = 74/287 (25.78%), Postives = 130/287 (45.30%), Query Frame = 3
Query:  840 PFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQ---WLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT----GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICS 1679
            P  C     L+LV+  + ++ EQR  IR+TWG+   W   +                 + KLVF++G        V      +     F+DI+ +    + + NLTLK L         CT+A F LK D DVF++VP +L            +  +VG+    A   R+   K+++P+ +Y   ++PPY  G GY+++   +  + +   + + LF  +DV V      +  T +     K F  ++ +N  D C  + ++L HR++P +M ++W  +T     C+
Sbjct:   85 PSECARDTFLLLVIKSQPAHIEQRSAIRSTWGRAGSWARGR-----------------QLKLVFLLGVAG----PVPPAQLLVYESWQFDDILQW-DFAEDFFNLTLKELHVQRWIAAACTQAHFILKGDDDVFIHVPNVLEFLE---GWDPAQDFLVGDVIRLARPNRNTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHMAMEEAE-LFPIDDVFVGMCLRKLGVTPIHHAGFKTFGIQQPLNPRDPCLYKGLLLVHRLSPLEMWTMWALVTDERLKCA 345          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt1 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1349403])

HSP 1 Score: 107.842 bits (268), Expect = 4.237e-25
Identity = 80/292 (27.40%), Postives = 141/292 (48.29%), Query Frame = 3
Query:  801 IKDYKFTSLVNAVPFTCGNQVTLVLVVLCET-SNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMG--AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQS-KKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            I  + F  L+N  P  C   +  +++++  T   ++ R+ IR TWG   N K                 +   +F++G  A  +  + V+Q+         F+DI+     +D+Y NLTLKTL G+      C+KA + +K D+D+FVN+  L+   ++ L  S K +         N   IRD  +KWY+P ++Y  + +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    +    N  F + +   ++  C  R +I  H+I+P +M  +WN+++S
Sbjct:   58 INPHSFEFLINE-PNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFK---------------GIKIATLFLLGKNADPVLNQMVEQESQI------FHDII-VEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLI---YKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIF-SADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSL--CRYRRVITVHQISPEEMHRIWNDMSS 320          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt1 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1349403])

HSP 1 Score: 107.842 bits (268), Expect = 4.237e-25
Identity = 80/292 (27.40%), Postives = 141/292 (48.29%), Query Frame = 3
Query:  801 IKDYKFTSLVNAVPFTCGNQVTLVLVVLCET-SNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMG--AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQS-KKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            I  + F  L+N  P  C   +  +++++  T   ++ R+ IR TWG   N K                 +   +F++G  A  +  + V+Q+         F+DI+     +D+Y NLTLKTL G+      C+KA + +K D+D+FVN+  L+   ++ L  S K +         N   IRD  +KWY+P ++Y  + +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    +    N  F + +   ++  C  R +I  H+I+P +M  +WN+++S
Sbjct:   58 INPHSFEFLINE-PNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFK---------------GIKIATLFLLGKNADPVLNQMVEQESQI------FHDII-VEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLI---YKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIF-SADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSL--CRYRRVITVHQISPEEMHRIWNDMSS 320          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3gnt6 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 (core 3 synthase) [Source:MGI Symbol;Acc:MGI:3039603])

HSP 1 Score: 103.219 bits (256), Expect = 3.612e-23
Identity = 84/317 (26.50%), Postives = 142/317 (44.79%), Query Frame = 3
Query:  786 LMKYFIKDY-------KFTSLVNAVPFTCGNQ-VTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKL-VFVMGAKSINLKSVQQDL-DFIQNET-HFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKLFRYEEY--------MNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICS 1679
            L+   I+D+       +F  L +A P   G + V L+L V    ++YE+R+ IR TWGQ           RS      YS R  L +F++G       + +  L D +  E   + D++ +    DT++NLTLK L  L+   + C   +F L  D DVFV+   +L        QS +  +  G     +  +R+  +K++VP +++    +P Y +G G+LL+   + ++   A  V  LF  +D A  GM      L  +       +          ++D C  R ++L HR  P +M+ +W  + +    CS
Sbjct:   79 LLPARIQDFLRYRHCRRFPQLWDAPPKCAGPRGVFLLLAVKSSPAHYERRELIRRTWGQE----------RS------YSGRQVLRLFLVGTSPPEEAAREPQLADLLSLEAREYGDVLQW-DFSDTFLNLTLKHLHLLDWTAEHCPGVSFLLSCDDDVFVHTANVLSFLE---VQSPEHHLFTGQLMVGSVPVRESGSKYFVPPQIFPGVAYPAYCSGGGFLLSRYTVRNLRSAAHHVP-LFPIDD-AYMGMCLQQAGLAPSSHQGIRPFGVQLPNVQRLSLDPCMYRELLLVHRFAPYEMLLMWKALHNPALHCS 373          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3gnt2 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 [Source:MGI Symbol;Acc:MGI:1889505])

HSP 1 Score: 100.908 bits (250), Expect = 2.392e-22
Identity = 83/293 (28.33%), Postives = 133/293 (45.39%), Query Frame = 3
Query:  822 SLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKL-VFVMG--AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNK-----LFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            SL+   P  C  +  L+L +     ++ +R+ IR +WG+  N                  N+T + VF++G      N   +   L F +++ H + +M+     DT+ NL+LK +  L      C  A F  K D DVFVN   +L   +  L++SK K + +G+   NA   RDK  K+Y+P EV+    +PPY  G G+L +      +    S+V    Y  D   TGM    + L+  K      F  EE  N  + C+   ++L H   P +MI +W+++ S    C
Sbjct:  129 SLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRESWGRETN----------------VGNQTVVRVFLLGKTPPEDNHPDLSDMLKF-ESDKHQDILMW--NYRDTFFNLSLKEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNS-LSKSKAKDLFIGDVIHNAGPHRDKKLKYYIP-EVFYTGVYPPYAGGGGFLYSGPLALRLYSATSRVH--LYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEE-KNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC 397          
BLAST of Hexosyltransferase vs. UniProt
Match: sp|Q1RLK6|B3GN4_MOUSE (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=B3gnt4 PE=2 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.671e-25
Identity = 74/287 (25.78%), Postives = 130/287 (45.30%), Query Frame = 3
Query:  840 PFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQ---WLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT----GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICS 1679
            P  C     L+LV+  + ++ EQR  IR+TWG+   W   +                 + KLVF++G        V      +     F+DI+ +    + + NLTLK L         CT+A F LK D DVF++VP +L            +  +VG+    A   R+   K+++P+ +Y   ++PPY  G GY+++   +  + +   + + LF  +DV V      +  T +     K F  ++ +N  D C  + ++L HR++P +M ++W  +T     C+
Sbjct:   85 PSECARDTFLLLVIKSQPAHIEQRSAIRSTWGRAGSWARGR-----------------QLKLVFLLGVAG----PVPPAQLLVYESWQFDDILQW-DFAEDFFNLTLKELHVQRWIAAACTQAHFILKGDDDVFIHVPNVLEFLE---GWDPAQDFLVGDVIRLARPNRNTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHMAMEEAE-LFPIDDVFVGMCLRKLGVTPIHHAGFKTFGIQQPLNPRDPCLYKGLLLVHRLSPLEMWTMWALVTDERLKCA 345          
BLAST of Hexosyltransferase vs. UniProt
Match: sp|Q9MYM7|B3GT1_PONPY (Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus OX=9600 GN=B3GALT1 PE=3 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.964e-24
Identity = 80/292 (27.40%), Postives = 141/292 (48.29%), Query Frame = 3
Query:  801 IKDYKFTSLVNAVPFTCGNQVTLVLVVLCET-SNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMG--AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQS-KKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            I  + F  L+N  P  C   +  +++++  T   ++ R+ IR TWG   N K                 +   +F++G  A  +  + V+Q+         F+DI+     +D+Y NLTLKTL G+      C+KA + +K D+D+FVN+  L+   ++ L  S K +         N   IRD  +KWY+P ++Y  + +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    +    N  F + +   ++  C  R +I  H+I+P +M  +WN+++S
Sbjct:   58 INPHSFEFLINE-PNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFK---------------GIKIATLFLLGKNADPVLNQMVEQESQI------FHDII-VEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLI---YKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIF-SADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSL--CRYRRVITVHQISPEEMHRIWNDMSS 320          
BLAST of Hexosyltransferase vs. UniProt
Match: sp|Q7JK26|B3GT1_PANTR (Beta-1,3-galactosyltransferase 1 OS=Pan troglodytes OX=9598 GN=B3GALT1 PE=3 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.964e-24
Identity = 80/292 (27.40%), Postives = 141/292 (48.29%), Query Frame = 3
Query:  801 IKDYKFTSLVNAVPFTCGNQVTLVLVVLCET-SNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMG--AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQS-KKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            I  + F  L+N  P  C   +  +++++  T   ++ R+ IR TWG   N K                 +   +F++G  A  +  + V+Q+         F+DI+     +D+Y NLTLKTL G+      C+KA + +K D+D+FVN+  L+   ++ L  S K +         N   IRD  +KWY+P ++Y  + +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    +    N  F + +   ++  C  R +I  H+I+P +M  +WN+++S
Sbjct:   58 INPHSFEFLINE-PNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFK---------------GIKIATLFLLGKNADPVLNQMVEQESQI------FHDII-VEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLI---YKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIF-SADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSL--CRYRRVITVHQISPEEMHRIWNDMSS 320          
BLAST of Hexosyltransferase vs. UniProt
Match: sp|Q7JK25|B3GT1_PANPA (Beta-1,3-galactosyltransferase 1 OS=Pan paniscus OX=9597 GN=B3GALT1 PE=3 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.964e-24
Identity = 80/292 (27.40%), Postives = 141/292 (48.29%), Query Frame = 3
Query:  801 IKDYKFTSLVNAVPFTCGNQVTLVLVVLCET-SNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMG--AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQS-KKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            I  + F  L+N  P  C   +  +++++  T   ++ R+ IR TWG   N K                 +   +F++G  A  +  + V+Q+         F+DI+     +D+Y NLTLKTL G+      C+KA + +K D+D+FVN+  L+   ++ L  S K +         N   IRD  +KWY+P ++Y  + +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    +    N  F + +   ++  C  R +I  H+I+P +M  +WN+++S
Sbjct:   58 INPHSFEFLINE-PNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFK---------------GIKIATLFLLGKNADPVLNQMVEQESQI------FHDII-VEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLI---YKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIF-SADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSL--CRYRRVITVHQISPEEMHRIWNDMSS 320          
BLAST of Hexosyltransferase vs. UniProt
Match: sp|O54904|B3GT1_MOUSE (Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 2.964e-24
Identity = 80/292 (27.40%), Postives = 141/292 (48.29%), Query Frame = 3
Query:  801 IKDYKFTSLVNAVPFTCGNQVTLVLVVLCET-SNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMG--AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQS-KKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            I  + F  L+N  P  C   +  +++++  T   ++ R+ IR TWG   N K                 +   +F++G  A  +  + V+Q+         F+DI+     +D+Y NLTLKTL G+      C+KA + +K D+D+FVN+  L+   ++ L  S K +         N   IRD  +KWY+P ++Y  + +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    +    N  F + +   ++  C  R +I  H+I+P +M  +WN+++S
Sbjct:   58 INPHSFEFLINE-PNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFK---------------GIKIATLFLLGKNADPVLNQMVEQESQI------FHDII-VEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLI---YKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIF-SADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSL--CRYRRVITVHQISPEEMHRIWNDMSS 320          
BLAST of Hexosyltransferase vs. TrEMBL
Match: gnl|BL_ORD_ID|22325834 (tr|A0A4Y2DLC0|A0A4Y2DLC0_ARAVE Hexosyltransferase OS=Araneus ventricosus OX=182803 GN=B3GALT1_3 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.246e-32
Identity = 99/321 (30.84%), Postives = 165/321 (51.40%), Query Frame = 3
Query:  735 RYYRSYEPLQKYTNELFLMKYFIKDYKFTSLVNAVPFTCGNQ--VTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYST--NVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICSFS 1685
            ++Y S +    Y  +  L  +FI           VP TC +Q  + LV+VV     N+  R+ IR+TWG+   S+++ N              TK+ F++G  S ++     D+     +  + D++++  LLD+Y NLTLK+++ L  A   CT A F +K+D D+FVNVP +     + + QS     +VG    NA  IRD+++KW+VP ++YS   +P Y++G GY++ S++   ++  AS        EDV +TG+ +   N++  DN LF Y +     + C    I  AHR+TP+ +   W+ I +    C+ S
Sbjct:    3 KWYNSTKTTWLYAKKSILRSHFI---------GTVP-TCQSQQDLKLVIVVCSAPQNFAARQAIRSTWGK--ESRWTKN--------------TKIFFIIGRSSDSI----SDMFVFTEQQEYGDVIHY-DLLDSYFNLTLKSVSLLRWAATSCTNAKFVMKSDDDMFVNVPVIF----KTVIQSDATNDLVGKLIVNARPIRDRSSKWFVPQDMYSDKLYPNYLSGTGYVM-SQSAAILLHNASYSAPYICLEDVFITGICAKLGNIKPKDNHLFTYAKQKK--NPCKYLYIATAHRMTPNDLYDTWDMIHNMHFRCAMS 285          
BLAST of Hexosyltransferase vs. TrEMBL
Match: gnl|BL_ORD_ID|17915167 (tr|A0A087T2X2|A0A087T2X2_STEMI Hexosyltransferase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_07186 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.294e-32
Identity = 94/299 (31.44%), Postives = 150/299 (50.17%), Query Frame = 3
Query:  786 LMKYFIKDYKFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVEL--IDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            L KY + D   + L+  +   C   + LV+VV     N+E R+ IR+TW Q     +S+                  VF +  KS N ++V  ++      + + DI+     +DTY NLTLK++  L    Q CT A + +K D D+FVN+P L  L    L     K +++G     A  ++D N+KW+VP  V+    +PPY++G GY+++  A D +  TA      FY ED+ VTG+    V L  I+N  F++ +  N  D C  R +I AH++TP +++ +W  I + +  C
Sbjct:   57 LNKYILPDNDTSILLPKL--QCNGSIFLVVVVCSAVPNFEARRAIRDTWAQDARKLHSVQ-----------------VFFLLGKSRN-QTV--NVAVADESSKYGDIIQ-QDFIDTYNNLTLKSVMLLKWTNQNCTNAKYVMKTDDDMFVNLPNLFRL----LKAKGHKGLLLGCLIKGAVPVKDWNSKWFVPEVVFPGRVYPPYLSGTGYVMSRDAADLLYRTALSTP-FFYLEDIFVTGICGNRVGLKPINNDGFKFYKRKN--DMCVFRALITAHKMTPKELVQVWKNIRNPSVKC 325          
BLAST of Hexosyltransferase vs. TrEMBL
Match: gnl|BL_ORD_ID|22603173 (tr|A0A2C9JKD8|A0A2C9JKD8_BIOGL Hexosyltransferase OS=Biomphalaria glabrata OX=6526 GN=106057692 PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 3.772e-32
Identity = 84/277 (30.32%), Postives = 143/277 (51.62%), Query Frame = 3
Query:  861 VTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETH-FNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAI-IVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYW-EDVAVTGMYS--TNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            V LV+ V+    N+ QR+ IR TWG +   K                N  +L F +G++  + +  +     ++NE   F D++     +D Y NLTLK+++ L    Q+C  + F LK+D DV+VNVP L+          + K+I + G    +A  IRD  +KWY PY++Y ++ +P YV+G  Y +   A   +   +++V   F+W EDV +TG+ +    V ++++KLF Y         C+++ +I  H+ T S++  + NE+  +T IC
Sbjct:  135 VELVMCVMSSRDNFVQRQAIRQTWGSYAKDK---------------ENSARLFFFLGSEDPSTEPFESTQSLVENEAKIFGDVLQ-ANFVDNYRNLTLKSISILQWVSQRCRGSRFLLKSDDDVYVNVPFLVTTLKDMQKWEELKSIFLTGFVYSSASPIRDGTSKWYTPYDLYKESEYPMYVSGTAYAMTVDAARQLFKASNEVP--FFWLEDVFITGLCAKKAGVRIVNSKLFVYHRL--EPKGCSIKSVISGHKYTSSELAKIHNELNDDTAIC 391          
BLAST of Hexosyltransferase vs. TrEMBL
Match: gnl|BL_ORD_ID|23917712 (tr|K1QK64|K1QK64_CRAGI Hexosyltransferase OS=Crassostrea gigas OX=29159 GN=CGI_10018451 PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 9.325e-32
Identity = 90/282 (31.91%), Postives = 140/282 (49.65%), Query Frame = 3
Query:  840 PFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMG-AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGM--YSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            P  C   V LV+VV     N++ R+ +R +WG  L SK  I              +T+LVF++G     NL+ V Q     +N  H + I+     +DTY NLTLK+++ L      C  A + LKAD DVFVN+P L+          +K   I+G++Q  A  I+DKN+KWY P E + +  +PPYV+G  Y     A  ++     +VK  F+ ED+ +TG+   +  +   D+  F ++    T   C  R  I  H +T  +M+ ++NE+  +   C
Sbjct:   47 PNVCRGDVDLVVVVCSGLGNFKAREHVRKSWG--LYSKQEIY-------------KTRLVFLVGTGDKANLEQVLQ-----ENRVHGDIIV--GNFIDTYRNLTLKSISVLKWMSSFCGNAKYGLKADDDVFVNIPNLISAMSSKRQTMEK--FIIGSKQIGAKPIQDKNSKWYTPKEDFGEREYPPYVSGTAYAFTIPAAKALYRVTGRVK-AFWLEDIYITGLCARAAGIPRYDHAGFTFQRRKPT--GCAFRRHISGHYVTGEQMVKIYNELLQSDLKC 301          
BLAST of Hexosyltransferase vs. TrEMBL
Match: gnl|BL_ORD_ID|20452941 (tr|A0A131YKL6|A0A131YKL6_RHIAP Hexosyltransferase OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 4.511e-29
Identity = 97/314 (30.89%), Postives = 154/314 (49.04%), Query Frame = 3
Query:  756 PLQKYTNELFLMKYFIKDYKFTSLVNAVPFTCG-----NQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGM--YSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            P++K    L+   +  KDY     V   P  CG     N +   +VV+      E+R+ IR TWG+ L         R  NS         LVF++G K+ N +  QQ   F ++  HF+ +     + + Y NLT K++  L++A   C +A+F LK D D FVNVP+LL    +  A+ +K AI  G+   N   IRD + KW+V YE Y    +P +V+G  Y++  + I  +     +V+ L + EDV VTG+   +  +  +    F  +E  +    C+MR ++ +H +TP KM+  W E+ +    C
Sbjct:   53 PVRKALPRLY---HHPKDY-----VILPPAICGTRLVNNSLNFFVVVVSAVDQIERRQAIRRTWGRDLKL-------RGNNS---------LVFLLG-KAENTE--QQRRVFEESGEHFDIVQG--EMWEGYRNLTTKSVQALHLATTHCPQASFLLKTDDDTFVNVPKLL----KQAAELRKDAIY-GSIHANNSAIRDPSIKWFVTYEEYKPESYPDFVSGSAYVVGGEVIAPLYFQTGRVRPL-WLEDVYVTGLCAEAAGIPRVGLSTFDSDEVSSV---CDMRNMVTSHYMTPEKMLLFWRELRTADLKC 328          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: B3GALT1 (beta-1,3-galactosyltransferase 1 [Source:NCBI gene;Acc:103046404])

HSP 1 Score: 103.99 bits (258), Expect = 5.686e-24
Identity = 72/287 (25.09%), Postives = 140/287 (48.78%), Query Frame = 3
Query:  810 YKFTSLVNAVPFTCGNQVTLVLVVLCET-SNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETH-FNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAV-TGMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            + F  ++N  P  C   V  +++++  T   ++ R+ IR TWG               +   +   R   +F++G  + ++ +       ++ E+  F+DI+     +D+Y NLTLKTL G+      C +A + +K D+D+FVN+  L+    +   + +++         N   IRD  +KWY+P ++Y ++ +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    +    N  F + +   ++  C  R +I  H+I+P +M  +WN+++S
Sbjct:   65 HGFDFIINE-PKKCETNVPFLVILISTTHKEFDARQAIRETWG---------------DESTFSDLRIITLFLLGRSTDSVLN-----QMVEQESQIFHDIV-VEDFVDSYHNLTLKTLMGMRWVATFCNQAKYVMKTDSDIFVNMDNLVYKLLKPATKPRRRYFT--GYVINGSPIRDMRSKWYMPRDLYPESKYPPFCSGTGYVF-SADVAELIYKTSLHTRLLHLEDVYVGVCLRKLGIHPYQNSGFNHWKMAYSL--CRYRRVITVHQISPEEMHRIWNDMSS 324          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3galt1a (beta-1,3-galactosyltransferase 1-like [Source:NCBI gene;Acc:103046152])

HSP 1 Score: 103.219 bits (256), Expect = 1.021e-23
Identity = 77/292 (26.37%), Postives = 140/292 (47.95%), Query Frame = 3
Query:  801 IKDYKFTSLVNAVPFTC-GNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSN-RTKLVFVMGAKSINLKSVQQDLDFIQNETH-FNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRL-LGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            +  + F  L+N  P  C G+   L++++      ++ R+ IR TWG+                 + YS+ R   +F++G  S  + +       ++ E+  F+DI+      D+Y NLTLKT+ G+      C  A + +K D+D+FVN+  L L L       +K +         N   IRD  +KWY+  E+Y ++ +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    +  I N  F + +   ++  C  R ++  H+I+P +M  +WN++++
Sbjct:   61 LNPHSFRFLINE-PSKCEGDPPFLLILISTNHKEFDARQAIRETWGE----------------ENMYSDIRIVTLFLLGHNSEPVLN-----QMVEQESQIFHDII-VEDFEDSYHNLTLKTMMGMRWVSSFCPNAHYVMKTDSDIFVNMDNLVLNLLR---PNAKPRQRFFTGHVINGGPIRDTRSKWYMSREMYPESKYPPFCSGTGYVF-SGDMAELIFKTSLHTRLIHLEDVYVGLCLRKLGIHPIQNSGFNHWKMSYSL--CRYRRVVTVHQISPEEMHRIWNDMST 323          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: si:ch211-250e5.2 (beta-1,3-galactosyltransferase 2-like [Source:NCBI gene;Acc:111197654])

HSP 1 Score: 101.679 bits (252), Expect = 7.162e-23
Identity = 64/212 (30.19%), Postives = 107/212 (50.47%), Query Frame = 3
Query:  867 LVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAV 1502
            LVL+V       E R  IR+TWG               N          ++F++G   I  +  Q++L+    + H  D++     +DTY+NLT+KT+  ++    +C +A + +K D+D+F+N+  ++ L      ++ +   I G   +N PVIRD  +KWYVP E+Y ++Y+P Y+ G GY+  S  +   +V  SK  + F  ED  V
Sbjct:  127 LVLMVPVAPHELEARNAIRSTWG---------------NETVVQGKTVTVLFLVGLPGIKTEKQQEELNLESQKYH--DLIQS-DFMDTYLNLTIKTMVIMDWLATRCPQAAYSMKVDSDMFLNLDNMMNLLLA--PETPRINYITGMVMWNRPVIRDPASKWYVPQELYPEDYYPTYLLGMGYIF-SNDLPKKLVEVSKDIQPFNIEDAYV 317          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:NCBI gene;Acc:103046609])

HSP 1 Score: 101.679 bits (252), Expect = 1.311e-22
Identity = 75/291 (25.77%), Postives = 136/291 (46.74%), Query Frame = 3
Query:  840 PFTCGNQVTLVLVVLCETSNYEQRKTIRNTWG--QWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKK-KAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNK--------LFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICS 1679
            P  C   V L++V+    S +++R+ IR TWG  Q +N K                 R K +F++G  S+  +           +  + DI+ +   +D++ NLTLK    L      C    +  K D DVFV+V  ++    ++L  S   K +  G+  F A  IR K  K+Y+P+ +Y+K Y+PPY  G G+L++      + + AS+   L+  +DV + GM    +++   K        L + +      + C  R +I+ H++ P  ++++W  + S+  +C+
Sbjct:  139 PEKCSGDVHLLMVIKSIISQHDRREVIRQTWGKEQVINGK-----------------RIKTLFLLGTSSVESERANHQKLLEYEDYIYGDILQW-DFMDSFFNLTLKETHFLKWFSTYCGNVRYIFKGDDDVFVSVQNIM----EYLEDSSDVKNLFAGDVLFKARPIRRKENKYYIPHALYNKTYYPPYAGGGGFLMDGPLARKLYL-ASETLELYPIDDVFL-GMCLEVLQVTPIKHNAFKTFGLVKNKSSKLNKEPCFFRGMIVVHKLLPQDLLAMWRLVNSD-LVCA 404          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: zgc:162952 (zgc:162952 [Source:ZFIN;Acc:ZDB-GENE-070424-98])

HSP 1 Score: 97.0561 bits (240), Expect = 1.445e-22
Identity = 67/214 (31.31%), Postives = 110/214 (51.40%), Query Frame = 3
Query: 1065 DLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLF---------RYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            +L    NE H  DI+Y    +DTY NLT+KT+  +N     C  A + +K D D+FVNVP L+    Q+  +S +K  I G+   +    R++ +KWY+  E Y ++ FPPYV+G GY+  S  +   +  AS+  R    EDV V   ++  +V+ + ++ F         R+ EY    D+C     I+    TPS+++++W +   +   C
Sbjct:    1 ELALALNEVH-QDIVYV-DFIDTYQNLTVKTMMIMNWLATYCPSARYAMKVDADIFVNVPYLVRYL-QNQGESSQKDFITGSVINDGCPRRNQRSKWYLSKEAYPESRFPPYVSGAGYVF-SIDLAKKISWASRYVRPIPMEDVYVGLCLHFLDVQPVFSRTFLPYRNLFEIRHLEY----DACTYAQRIIVTGFTPSQLLNIWTDFQKDRLAC 206          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:13528])

HSP 1 Score: 100.523 bits (249), Expect = 2.091e-23
Identity = 76/295 (25.76%), Postives = 129/295 (43.73%), Query Frame = 3
Query:  861 VTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLD-FIQNET-HFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLG-LCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRL-----FYWEDVAVTGMYST----------NVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICSFSPN 1691
            VTL+L +  +  N E+R  IR TWG+  + +                   + VF++G  S      +  L+  +Q E+    DI+ +   LDT+ NLTLK L  L+   ++C  A +    D DVFVN P LL  +  +  A      +  G    N   IR  ++K++VP +V++ + +PPYV G G L+  +    I   A ++  L     F  + +A  G+  T          ++   +    +    +++   C  R +IL HR+ P + + +W  +      C   PN
Sbjct:   51 VTLLLAIKSDARNLERRDVIRRTWGREGSVR---------------GRPVRRVFLVGVPSGEAPERRVHLNALLQEESREHGDIVQW-NFLDTFFNLTLKQLLFLDWLHERCAGARYVFDGDDDVFVNTPNLLERIAAEERAGRGDGHLYEGYVISNVGPIRAPSSKYFVPVQVHAGDSYPPYVGGGGILMAGRTALDIRRVAGQLAMLPIDDVFLGQCLAALGLAPTRHPAFRTAGISLPAPNRGAAKRAALVSSFHPCYYREVILVHRVEPFQTLIMWAALRDPRLRCG-RPN 328          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3gnt2a (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2a [Source:ZFIN;Acc:ZDB-GENE-090312-192])

HSP 1 Score: 99.7525 bits (247), Expect = 9.039e-23
Identity = 81/295 (27.46%), Postives = 131/295 (44.41%), Query Frame = 3
Query:  816 FTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMG--AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGM--YSTNVELIDNKLFR----YEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            F  L++      G++  L+  +    +++++R+ IR +WG   +   ++                + VF++G  A      ++Q  LD       ++DI+ +    D++ NLTLK L  L    Q+C+   F  K D DVFVN  R + L     A  K + + +G+   NA   RDK  K+Y+P  V+   Y PPY  G GY+ + +    I   + +V + F  +DV V GM           N  FR     E+  N I  C  R +IL H   P +M+ +W  + S    C
Sbjct:  136 FPQLIDQPRKCAGHRPFLLFAIKSVIAHFDRRQAIRESWGAETSGNVTV----------------RRVFLLGRPANPDLEPNLQHLLDL--ESKRYSDILQW-DFRDSFFNLTLKELLFLKWVEQRCSDVRFIFKGDDDVFVNTDRTVALLSNITAPDKVQNLFLGDVIVNAGPHRDKKVKYYIPESVFEGAY-PPYAGGGGYVYSGEMARRIHQVSRQVMQ-FPIDDVYV-GMCLRRMGFAPTKNSGFRTFDISEKERNNI--CVYRDLILVHPRNPHEMMDIWKSLHSPNLKC 406          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2078])

HSP 1 Score: 95.5153 bits (236), Expect = 3.864e-22
Identity = 66/274 (24.09%), Postives = 123/274 (44.89%), Query Frame = 3
Query:  867 LVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLG-LCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKL---FRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            LVL++    +  + R+ IR+TWG               N         K +F++GA      S++     ++ E+  +  +     +DTY NLTLKT+ GL+   + C+ A + +K D+D+FVNV  L+  +    L Q        G         R+  +KWY+P EVY    +P + +G GY+L+      +   +  ++RL + EDV V G+    + +        F +  +  +  +C    ++ +H+ +P+++   W  +  +   C
Sbjct:   11 LVLLISSVPAQLDARQAIRDTWG---------------NESLVPGIVIKRLFLLGAAPAEAGSLRVQ-SLLEEESRRHGDLLQQNFVDTYYNLTLKTMMGLHWVSEHCSDAAYVMKTDSDMFVNVEFLVSTVLKPELHQPSLPDYFTGYLMRGYSPNRNPESKWYMPVEVYPGERYPTFCSGTGYVLSGTLAARVYRVSLTIRRL-HLEDVYV-GLCLAKLRVTPTAPPSEFLFNHWRVSYSACKYSHLVTSHQFSPAELRRYWGHLQQHRLSC 266          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2078])

HSP 1 Score: 90.1225 bits (222), Expect = 1.773e-20
Identity = 74/286 (25.87%), Postives = 131/286 (45.80%), Query Frame = 3
Query:  816 FTSLVNAVPFTCGNQVT-LVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVI------RDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAV-TGMYSTNVELIDNKL-FRYEEYMNTIDSCNMRIIILAHRITPSKMISLW 1646
            F  L+N  P TC  +   LV++V  E++ +E R+ IR TW                 S+       + +F++G  S    + ++    I+ E+  +  +      D Y NLTLKT+ GL+     C  A++ +K D+D+FVN+  L+      L Q +++  +   + F   V+      R+  +KWY+P ++Y    +P + +G GY++ S  + S +  AS   R    EDV V   + S  VE +     F +  +  +   C    I+ +H  +PS++   W
Sbjct:    1 FRYLLNE-PDTCRPRAPFLVVLVASESTEFEAREAIRETWAS--------------ESVALRGVSFRRLFLLGTASPASDAQRR----IEEESRRHGDLIQQNFTDAYDNLTLKTMMGLHWVSVHCPHASYVMKTDSDMFVNLEVLVKAV---LEQQRRR--VPPRDYFTGYVMRGFLPNRNPASKWYMPEDMYPGATYPTFCSGTGYVM-SATLASRLYRASLAIRRLRLEDVYVGVCLESLGVEPVFPPYEFHFNHWRVSYSPCQYSRIVTSHAFSPSELRHYW 261          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:ZFIN;Acc:ZDB-GENE-021210-4])

HSP 1 Score: 88.9669 bits (219), Expect = 1.183e-19
Identity = 73/312 (23.40%), Postives = 131/312 (41.99%), Query Frame = 3
Query:  813 KFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINL--------------KSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAV------TGMYSTNVELIDNKLFRYEEYMNTIDS----CNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            +   +++  P  CG    L+LV+    SN+++R  IR TWG+        N   +  + D        +F++G +  +                 VQ+ +D       + D++ +    D++ NLTLK +  L      C    +  K D DVFVNV  LL +     ++     + VG  Q  AP IR   +K+++P E+Y +  +P Y +G G++++  A   I   +  +K  F  +DV +       G+  T  E         E     ++     C  R  ++ HR  P +M+ +W +  + +  C
Sbjct:    8 RLFPMLHNFPGVCGGGAFLLLVIKSSPSNFDRRDAIRRTWGR--------NGVATTTAGDGRPLVVHTLFLLGVRPPSPPSPSDSRDDDRGKRARVQRMVDL--EARLYGDLLQW-DFHDSFYNLTLKDINFLRWFEAYCPAVAYVYKGDDDVFVNVENLL-VYLATFSRDGSAPLFVGRTQQQAPPIRSVESKYFMPREMYRRWTYPDYASGGGFVMSRAAAVRIHEVSRDIKP-FPIDDVWIGMCLEKAGLAVTQHEGFRTFGLEAENLEEGVEKKSPLCIYRSSMIFHRFLPQEMLDMWVDFKNASIQC 306          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO33326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI5])

HSP 1 Score: 84.3445 bits (207), Expect = 1.489e-18
Identity = 67/220 (30.45%), Postives = 100/220 (45.45%), Query Frame = 3
Query:  837 VPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDV 1496
            +P   GN   L  V  C  S +  R+ IR +WG               N+I+      K VF +G  S + K+    L+       + DI+     LDTY NLTLKT+  L  A++ C +A + LK D D FVNV  L+ L         +K + +G   +     R+K +K+YV    +S+  +PPY  G GY+     + S+ + AS    +F  ED 
Sbjct:    1 MPLCTGNVFLLAAVHSCHES-FSMREAIRLSWGN------------QENAINKGKWTWKTVFFLGQSSDDEKNQLLRLE----AARYKDIV-IGDFLDTYRNLTLKTILILRWAKKHCPQAQYILKTDHDCFVNVLPLMRLLRI------RKPLYLGRIHWKNTPTRNKTSKFYVSKAEFSEPVYPPYAAGGGYVFKGSLLPSL-LQASHEAAVFPMEDA 195          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO36369 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIV3])

HSP 1 Score: 83.5741 bits (205), Expect = 5.266e-18
Identity = 73/228 (32.02%), Postives = 112/228 (49.12%), Query Frame = 3
Query:  867 LVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVAR-QKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKL 1547
            L+++VL    ++ QR+ IR TWG       SI    S +S      + KLVFV+G     L  V   L    +E   ND++      +TY NL +K   GL  A  Q+C    +  KAD DVF+N+PR++    +  +  +  A  V N   N  V+R   AK+ V   VY  +Y+PPY  G  YLL+   + +I+   +K +R F  ED A  G+ +  + L+  ++
Sbjct:   38 LIVLVLSTPESFIQRQAIRETWG-------SIT---STDSKGKSDKKVKLVFVLGG----LGHVDSALRREHSEK--NDLL-IGSFEETYRNLVVKVFVGLKWASTQRCK---YVFKADEDVFLNIPRVVEWVEEIGSPQRLYAGEVVN---NNTVLRWPWAKYSVSPLVYEPSYYPPYCRGAFYLLSRPVLPAILEEVAK-RRAFAVED-AFLGVIANAIGLMPAQI 240          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO33345 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI4])

HSP 1 Score: 79.337 bits (194), Expect = 6.830e-17
Identity = 65/217 (29.95%), Postives = 105/217 (48.39%), Query Frame = 3
Query:  849 CGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNS-KYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDV 1496
            C     L++ V    SN+++R+ IR +WGQ  N    + N P+            K VF++G +S N K++Q  LDF   ++  +DI+ F    D+Y NL  K + G+  A   CT A + LK D D ++N   L+     +   +  + +  G    +  VIRDK  + Y+  E Y    FP Y+ G GYL +   +  ++  + +VK +F  ED 
Sbjct:    2 CRRTPFLLIEVHSRPSNFKRREAIRFSWGQPENVINQAGNFPQG--------RSWKTVFMIG-RSQN-KTIQSALDFESKKS--SDIV-FGDFEDSYSNLYKKMVLGIRWAHTFCT-ADYILKTDDDCYINAHALITWLDSYHMVNASQPLYTGRLVEDRRVIRDKEDRNYLSMEEYPDAEFPAYIAGGGYLFSGFLLLRLISGSKRVK-MFPVEDA 203          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO34693 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNK7])

HSP 1 Score: 73.559 bits (179), Expect = 3.880e-15
Identity = 44/140 (31.43%), Postives = 75/140 (53.57%), Query Frame = 3
Query: 1095 FNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMY 1514
            + DI+     LDTY +L+LK L G+    + C  A + LK D D ++N+  L+    ++  Q     + +G  Q N  V+R K+ ++YV   V+  +++ PYV+G GYL +   + S +   S+  R+F  ED A+ G +
Sbjct:   33 YGDIL-LGNFLDTYKHLSLKMLLGITWPYEHCN-AKYILKTDDDCYMNIVSLILWLSEYHTQQGTDPLYIGKVQKNMAVVRTKSHRYYVSRSVHRGDFYAPYVSGGGYLFSGHLL-SRLYKVSRHSRVFPVED-ALLGRF 168          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO47742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLS0])

HSP 1 Score: 72.7886 bits (177), Expect = 7.494e-15
Identity = 49/194 (25.26%), Postives = 86/194 (44.33%), Query Frame = 3
Query:  867 LVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMY--FPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKK-----KAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLN 1427
            L+++V+    N+E RK IR +WG+   SK ++  P S+          +++FV+G+        + D    +    + DI+   F  +       ++K L     A   C ++ F LK  T+ FVNVP  +        +S            G++   A VIR+K + WY+  E + +   PPY +G G  ++
Sbjct:    8 LLILVISTGRNFEARKAIRKSWGRADTSKRNVTTPESV----------RVIFVVGSDE------KSDSRVTKEAKRYKDILRGNFDDVYHQNEFHSVKALLAFKWATLSC-RSKFILKVLTESFVNVPATMEWLRSKKPESSDVRGLYTGFCHGHDTGGAAVIRNKESPWYITEEEWPEGRLPPYASGMGIAMS 184          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3gnt7l (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7-like [Source:NCBI gene;Acc:101170895])

HSP 1 Score: 113.62 bits (283), Expect = 1.103e-26
Identity = 74/298 (24.83%), Postives = 146/298 (48.99%), Query Frame = 3
Query:  816 FTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSI--NLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDN--------KLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICS 1679
            F  ++N        +V L++V+      +++R+ +R TWG+                      + + +F++G  +   + K++Q+ L++   +  + DI+ +   +DT+ NLTLK +  L      C    F  K D DVFVN P LL L    + + K+  + VG+    A  IR++ +K+Y+P E+Y + Y PPYV G G+L++S+    ++V + K++ L+  +DV + GM    +++            + R++      + C  R +I+ HR++P +++ +W  +      C+
Sbjct:  115 FPMIINHPEKCADGEVHLLMVIKSVIEQHDRREAVRRTWGREQTRD---------------GRKIRTLFLLGTPTTGKDTKNLQKLLEY--EDRIYKDILQW-DFMDTFFNLTLKEVNFLKWFDIFCPTVQFVFKGDDDVFVNTPNLLQLIRFRVEEHKEAQLFVGDTISKAIPIRNRQSKYYIPKELYDQPY-PPYVGGGGFLMSSRLARRLLVVSEKLE-LYPIDDVFL-GMCLQRLDVTPEMHPGFRTFGISRHKTSRMNREPCFYRHLIVVHRLSPQELLDMWGSVHHQQLACA 391          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3galt1a (beta-1,3-galactosyltransferase 1-like [Source:NCBI gene;Acc:101163306])

HSP 1 Score: 106.301 bits (264), Expect = 9.848e-25
Identity = 74/268 (27.61%), Postives = 134/268 (50.00%), Query Frame = 3
Query:  873 LVVLCETSN--YEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLD-FIQNETH-FNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAV-TGMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            LV+L  T++  ++ R+ IR TWG               +   +   R   +F++G      +S+   L+  ++ E+  F+D++     +D+Y NLTLKTL G+      CTKA + LK D+D+FVN+  L+    +   + +++         N   IRD  +KWY+P ++Y  + +PP+ +G GY+  S  +  ++   S   RL + EDV V   +    +    N  F + +   ++  C  R ++  H+I+P +M  +WN++TS
Sbjct:   82 LVILISTTHKEFDARQAIRETWG---------------DESTFPEVRVVALFLLG------RSMDAVLNQMVEQESQIFHDVV-VEDFIDSYHNLTLKTLMGMRWVATYCTKAQYVLKTDSDIFVNMENLIYNLLKPTTKPRRRYFT--GYVINGGPIRDIRSKWYMPRDLYPDSKYPPFCSGTGYVF-SADVAELIYKISLHTRLLHLEDVYVGVCLRKLGIHPFQNSGFNHWKMAYSL--CRYRRVVTVHQISPEEMHRIWNDMTS 322          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: B3GALT1 (beta-1,3-galactosyltransferase 1 [Source:NCBI gene;Acc:101156539])

HSP 1 Score: 104.76 bits (260), Expect = 2.965e-24
Identity = 77/288 (26.74%), Postives = 140/288 (48.61%), Query Frame = 3
Query:  810 YKFTSLVNAVPFTCGNQVTLVLVVLCETSN--YEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETH-FNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVT-GMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITS 1661
            + F  ++N  P  C   +T  LV+L  T++  ++ R+ IR TWG               +   +       +F++G  S ++ +       ++ E+  F+DI+     +D+Y NLTLKT+ G+      C KA + +K D+D+FVN+  L+    +   + +++         N   IRD  +KWY+P +VY  + +PP+ +G GY+  S  I  ++   S   RL + EDV V   +    +    N  F + +   ++  C  R +I  H+I+P +M  +WN+++S
Sbjct:   63 HAFEFVINE-PKKC-ESITPFLVILISTNHKEFDARQAIRETWG---------------DESTFTQIHILTIFLLGWNSDDVLN-----QMVEQESQIFHDIV-VENFIDSYHNLTLKTMMGMRWVATFCPKAQYVMKTDSDIFVNMDNLIYKLLKPTTKPRRRYFT--GYVINGGPIRDMRSKWYMPRDVYPDSKYPPFCSGTGYVF-SADIAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPYQNSGFNHWKMAYSL--CRYRRVITVHQISPEEMHRIWNDMSS 322          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3gnt9 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 [Source:NCBI gene;Acc:101174101])

HSP 1 Score: 99.3673 bits (246), Expect = 9.713e-22
Identity = 76/292 (26.03%), Postives = 132/292 (45.21%), Query Frame = 3
Query:  867 LVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKLFRYE-------------EYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICSFSPNLSSS 1703
            +++ V    +++++R+ +R TWG+    +Y   +          S RT  VF++G           D         F+D++ +    DT+ NLTLK    L      C    F  K D DV+VNV  +L + H H      + + VG+   NA  IR +N+K+Y+P  VY    +P Y  G G++++      +     KV+ LF  +DV + GM    ++LI  K +R+E              ++ T D C  + +++ H +T  ++  +WN +      C    +L+SS
Sbjct:  171 MLIAVKSTAADFDKRQVVRRTWGK--EGRYDPGV----------SIRT--VFLLGVPGSRTALPLWDRLLAYESQTFSDVLLW-DFEDTFFNLTLKETHFLEWVNSSCAHVKFIFKGDADVYVNVENILEMLHSH---KPDRDLFVGDIIVNAKPIRRRNSKYYIPELVYGGGLYPNYAGGGGFVMSGFTARRLSSACQKVE-LFPIDDVFL-GMC---LQLIGVKPYRHEGFRTFGISRPSAAPHLQTFDPCFYKELMVVHSLTVPQIWLMWNLLHDPKLSCHKRSSLTSS 439          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3gnt2b (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Source:NCBI gene;Acc:101168731])

HSP 1 Score: 96.2857 bits (238), Expect = 6.189e-21
Identity = 78/287 (27.18%), Postives = 136/287 (47.39%), Query Frame = 3
Query:  840 PFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKL-VFVMG-AKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELI--DNKLFRY----EEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTIC 1676
            P  C     L+L +   + ++++R+ IR +WG+                    +NRT + VF++G A S +      ++   ++  H  DI+ +    D++ NLT+K +  L   + +C+ A F  K D DVFVN  R++   +  +++ K + + VG+   NA   RDK  K+++P  +Y  +Y PPY  G GYL +      +   +S V    Y  D   TGM    + L    +K FR     E+Y +  + C  + ++L H  TP +MI +W+ ++     C
Sbjct:  134 PDICKEPPFLLLAIKSLSPHFDRRQAIRQSWGR----------------AGVIANRTVVTVFLLGNATSEDHHPDLSEMLLYESAKH-KDIVQW-DFRDSFFNLTVKEVLFLEWIQARCSGARFIFKGDDDVFVNTYRIMEFLNS-VSEPKARDLFVGDVITNAGPHRDKKVKYFIPQSMYVGSY-PPYAGGGGYLYSGDIAARLQNVSSHVA--LYPIDDVYTGMCLRKLGLAPEKHKGFRTFNIDEKYRS--NPCAYKSLMLVHPRTPQEMIKIWSWLSRPDLTC 396          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000060671.1 (SMESG000060671.1)

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 361/361 (100.00%), Postives = 361/361 (100.00%), Query Frame = 3
Query:  663 MQARKHXXXXXXXXXXXXXVNVCYRYYRSYEPLQKYTNELFLMKYFIKDYKFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICSFSPNLSSSIKRFEYVIKSMIFG 1745
            MQARKHFIKFCLLILFILFVNVCYRYYRSYEPLQKYTNELFLMKYFIKDYKFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICSFSPNLSSSIKRFEYVIKSMIFG
Sbjct:    1 MQARKHFIKFCLLILFILFVNVCYRYYRSYEPLQKYTNELFLMKYFIKDYKFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKLFRYEEYMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICSFSPNLSSSIKRFEYVIKSMIFG 361          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000060671.1 (SMESG000060671.1)

HSP 1 Score: 468.003 bits (1203), Expect = 1.968e-163
Identity = 240/240 (100.00%), Postives = 240/240 (100.00%), Query Frame = 3
Query:  663 MQARKHXXXXXXXXXXXXXVNVCYRYYRSYEPLQKYTNELFLMKYFIKDYKFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSK 1382
            MQARKHFIKFCLLILFILFVNVCYRYYRSYEPLQKYTNELFLMKYFIKDYKFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSK
Sbjct:    1 MQARKHFIKFCLLILFILFVNVCYRYYRSYEPLQKYTNELFLMKYFIKDYKFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSK 240          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000035184.1 (SMESG000035184.1)

HSP 1 Score: 136.732 bits (343), Expect = 5.124e-35
Identity = 101/299 (33.78%), Postives = 148/299 (49.50%), Query Frame = 3
Query:  822 SLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQD-LDFIQNETHFNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLL-GLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKR---LF-YWEDVAVTGMYSTNVELIDNKLFRYEEYM---NTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICSFSPN 1691
            SL  ++   C N   LV+V      ++ +R+TIR TWGQW    +S    +  N+   +S RT+L F++G    N K  + D L  ++    F DI+Y+P L D Y NLT KT+  LN   + C  A F +K D+D+F+N+P L+  + +Q L      + + G +  +  V RD   KWYV  E Y    FPPYV G GY+L+  A+  +      +KR   LF  +EDV + G    N E+    L  +  +M   N  D C     I+ H+ITP  +IS W    S    C +  N
Sbjct:   66 SLSESIEPICQNGTKLVIVTHSSPKDFLKRQTIRLTWGQW---TWSSRFYQVFNN-KQFSKRTELFFIIGN---NNKLQRSDWLQLLKESASFRDIIYYPHLFDNYYNLTNKTIAMLNWVTKSCPAAEFIMKTDSDIFLNIPLLVKSINNQDLV---GLSFLAGTKLLDPSVNRDIENKWYVSKEEYKYEVFPPYVEGPGYILSRLAVLHLNRKLKNLKRKRNLFKKFEDVFL-GFMIENSEI---SLLNWNHFMLQINYPDLCIGYTYIVLHKITPYDLISNWCSFVSMNMTCPYLSN 350          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000060669.1 (SMESG000060669.1)

HSP 1 Score: 126.716 bits (317), Expect = 1.320e-32
Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = -1
Query:    2 MAATNIPLSNDLMFKLKTEIKDPNDVRQTKLFEKSMNDWGKYTPADRSEWWKCQITPYR 178
            MAATNIPLSNDLMFKLKTEIKDPNDVRQTKLFEKSMNDWGKYTPADRSEWWKCQI PYR
Sbjct:    1 MAATNIPLSNDLMFKLKTEIKDPNDVRQTKLFEKSMNDWGKYTPADRSEWWKCQIKPYR 59          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000023690.1 (SMESG000023690.1)

HSP 1 Score: 104.76 bits (260), Expect = 1.859e-24
Identity = 76/233 (32.62%), Postives = 116/233 (49.79%), Query Frame = 3
Query:  816 FTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSINLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETH-FNDIMYFPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLCHQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGCGYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGM 1511
            F+ ++N     C   V L+  V   + N+E+R+ IR+TWG             S+  I+  S  T+L+F++G  S      Q D D I NE+  F D++     LDTY NLTLK +  L+     C +A F  K D D F+N+  L      +L  + K+  I+G    N   IR K  KW V  ++YS   +PPY  G  Y+++  A+  ++V +   K LF  +DV +TG+
Sbjct:   46 FSYIINETTL-CSENVFLLTYVQSSSINFERRQLIRDTWG-------------SLKQIN--SETTRLLFIIGRPS-----SQTDQDKIMNESKKFRDLVQ-ADFLDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINL--NPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFI-DDVFITGI 253          
The following BLAST results are available for this feature:
BLAST of Hexosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3GALT16.172e-2527.40beta-1,3-galactosyltransferase 1 [Source:HGNC Symb... [more]
B3GNT43.295e-2426.46UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GNT43.295e-2426.46UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GNT45.713e-2426.46UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GNT74.339e-2325.63UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B0024.152.374e-1928.52Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
B0024.152.374e-1928.52Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
E03H4.112.379e-1626.27Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
C54C8.32.283e-1526.10Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
F14B6.44.165e-1324.32Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GalT12.983e-2326.63gene:FBgn0053145 transcript:FBtr0088048[more]
CG300362.837e-2226.45gene:FBgn0050036 transcript:FBtr0088050[more]
CG300373.296e-2224.34gene:FBgn0050037 transcript:FBtr0088049[more]
CG86681.013e-2129.08gene:FBgn0031988 transcript:FBtr0339671[more]
CG86681.013e-2129.08gene:FBgn0031988 transcript:FBtr0079576[more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3gnt72.593e-2528.52UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3galt1a2.016e-2226.03UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
CABZ01072312.19.128e-2227.85beta-1,3-galactosyltransferase 2-like [Source:NCBI... [more]
b3gnt5a2.082e-2129.22UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt5a2.082e-2129.22UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000004498.12.813e-2627.52pep primary_assembly:Xenopus_tropicalis_v9.1:1:988... [more]
tcp11l11.082e-2525.86t-complex 11, testis-specific-like 1 [Source:Xenba... [more]
B3GNT42.695e-2528.43UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
ENSXETT00000004482.17.491e-2427.09UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
ENSXETT00000004465.11.125e-2327.09UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3gnt42.389e-2625.78UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3galt14.237e-2527.40UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3galt14.237e-2527.40UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3gnt63.612e-2326.50UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3gnt22.392e-2228.33UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1RLK6|B3GN4_MOUSE1.671e-2525.78N-acetyllactosaminide beta-1,3-N-acetylglucosaminy... [more]
sp|Q9MYM7|B3GT1_PONPY2.964e-2427.40Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus... [more]
sp|Q7JK26|B3GT1_PANTR2.964e-2427.40Beta-1,3-galactosyltransferase 1 OS=Pan troglodyte... [more]
sp|Q7JK25|B3GT1_PANPA2.964e-2427.40Beta-1,3-galactosyltransferase 1 OS=Pan paniscus O... [more]
sp|O54904|B3GT1_MOUSE2.964e-2427.40Beta-1,3-galactosyltransferase 1 OS=Mus musculus O... [more]
back to top
BLAST of Hexosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|223258341.246e-3230.84tr|A0A4Y2DLC0|A0A4Y2DLC0_ARAVE Hexosyltransferase ... [more]
gnl|BL_ORD_ID|179151673.294e-3231.44tr|A0A087T2X2|A0A087T2X2_STEMI Hexosyltransferase ... [more]
gnl|BL_ORD_ID|226031733.772e-3230.32tr|A0A2C9JKD8|A0A2C9JKD8_BIOGL Hexosyltransferase ... [more]
gnl|BL_ORD_ID|239177129.325e-3231.91tr|K1QK64|K1QK64_CRAGI Hexosyltransferase OS=Crass... [more]
gnl|BL_ORD_ID|204529414.511e-2930.89tr|A0A131YKL6|A0A131YKL6_RHIAP Hexosyltransferase ... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3GALT15.686e-2425.09beta-1,3-galactosyltransferase 1 [Source:NCBI gene... [more]
b3galt1a1.021e-2326.37beta-1,3-galactosyltransferase 1-like [Source:NCBI... [more]
si:ch211-250e5.27.162e-2330.19beta-1,3-galactosyltransferase 2-like [Source:NCBI... [more]
b3gnt71.311e-2225.77UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
zgc:1629521.445e-2231.31zgc:162952 [Source:ZFIN;Acc:ZDB-GENE-070424-98][more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3GNT32.091e-2325.76UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt2a9.039e-2327.46UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3galt23.864e-2224.09UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
b3galt21.773e-2025.87UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
b3gnt71.183e-1923.40UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO333261.489e-1830.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363695.266e-1832.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333456.830e-1729.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346933.880e-1531.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477427.494e-1525.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3gnt7l1.103e-2624.83UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3galt1a9.848e-2527.61beta-1,3-galactosyltransferase 1-like [Source:NCBI... [more]
B3GALT12.965e-2426.74beta-1,3-galactosyltransferase 1 [Source:NCBI gene... [more]
b3gnt99.713e-2226.03UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt2b6.189e-2127.18N-acetyllactosaminide beta-1,3-N-acetylglucosaminy... [more]
back to top
BLAST of Hexosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060671.10.000e+0100.00SMESG000060671.1[more]
SMESG000060671.11.968e-163100.00SMESG000060671.1[more]
SMESG000035184.15.124e-3533.78SMESG000035184.1[more]
SMESG000060669.11.320e-3298.31SMESG000060669.1[more]
SMESG000023690.11.859e-2432.62SMESG000023690.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001483 ID=SMED30001483|Name=Hexosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1945bp
ATCGGTAAGGTGTTATTTGACATTTCCACCATTCACTCCGGTCAGCTGGG
GTGTATTTGCCCCAATCGTTCATTGATTTTTCAAATAATTTTGTCTGTCT
GACATCATTCGGGTCTTTAATTTCGGTTTTCAGTTTAAACATTAAATCAT
TGGACAGTGGAATATTTGTTGCAGCCATTTTCGGTTTTGGATTAATAAAC
TAACAATACAGTTGCAATGATAACCAGCATAACGGTGCAGTAAAACTGGT
CAGTTATTCAATTGTAATACCGGCACTTAGTACCATGGCAATTACAAACA
GTGGCTGAAGATTAACAAAATTGTAAAGCCAACCAGTCATGAAAATCATT
AATTATAAATTTACGTAACACGCATGGACATTGGAAAGTCTACAGCTCTT
GAAAAATTAACCAAATGACTCATCGTAGGATGCATTGAATATGATATACA
TCAAAAGCAAAATTTTATTCTCACAATGTCGGTGTGCGTATGTGTGTGTC
CATTGTGATTGGTTGTTCAATTATACAATTCGTATTGATTATTTTATTTT
CAATTTCAATTGACTTGTTATAATTTTATTAAATTATAAAATCTCAAATT
TTCGAAATTCAAAATCGGTGGAATAAACGAAACCAATTTTCAATAGTCAT
TTAGACTTATCAATGCAGGCCAGGAAACATTTCATCAAATTTTGCCTGCT
GATTTTATTTATTCTATTTGTTAATGTTTGTTATCGATATTATCGCTCCT
ATGAACCGTTACAAAAATACACAAATGAATTGTTTCTCATGAAATATTTC
ATTAAAGACTACAAATTTACAAGTCTTGTCAATGCCGTTCCGTTTACCTG
CGGCAATCAAGTGACACTGGTTTTGGTGGTGTTGTGTGAAACTTCAAATT
ACGAACAGAGGAAAACTATCAGAAATACATGGGGACAATGGCTAAATTCG
AAATATTCCATTAATTTACCACGGTCTATTAATTCAATAGATTATTATTC
CAATCGAACTAAACTCGTGTTTGTTATGGGTGCAAAATCGATCAACTTAA
AGAGTGTTCAACAAGATTTAGATTTTATCCAAAATGAAACTCATTTCAAC
GATATTATGTACTTTCCTGGCTTATTAGACACTTACATGAATCTAACCCT
CAAAACCCTTACGGGACTTAATGTAGCTCGTCAGAAATGTACTAAAGCAA
CATTCTTTCTAAAGGCAGATACTGATGTGTTTGTCAATGTTCCACGCTTG
TTAGGACTATGCCATCAACATTTAGCTCAATCAAAGAAAAAAGCTATTAT
AGTTGGTAATGAACAATTCAATGCTCCTGTCATCCGGGACAAGAACGCCA
AGTGGTATGTCCCATATGAAGTCTATTCTAAAAATTATTTTCCTCCATAT
GTCACTGGCTGTGGCTATCTTCTCAACTCAAAAGCTATCGATAGTATAGT
CGTTACAGCTTCCAAAGTAAAGAGATTATTCTATTGGGAGGACGTGGCTG
TCACAGGGATGTACTCGACCAACGTGGAACTGATCGATAATAAGTTGTTC
CGGTATGAAGAGTATATGAATACCATTGACAGTTGTAACATGAGGATTAT
CATATTGGCACACAGGATCACCCCCTCTAAAATGATCTCATTATGGAATG
AAATCACATCCAACACAACAATATGTTCCTTTAGTCCCAATCTTTCAAGT
TCCATCAAAAGATTTGAATATGTCATCAAGTCGATGATTTTTGGATAGCT
GTGATGTGCTGTGAAATTCCATATCAATAATGCTATTATGCTACTATTTA
TTATCTTATCTATTTGTCTGTTCGGTTTGCTTGACGTGTAAATATCTTTT
ATGTAATTTCGATCTTTTTGATGCGGTACAAATTAGAATTTCTATTTTAT
CATTTCTTTTATTGATTATCGATTTTCAATATAATTAATGCGGAA
back to top

protein sequence of SMED30001483-orf-1

>SMED30001483-orf-1 ID=SMED30001483-orf-1|Name=SMED30001483-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=362bp
MQARKHFIKFCLLILFILFVNVCYRYYRSYEPLQKYTNELFLMKYFIKDY
KFTSLVNAVPFTCGNQVTLVLVVLCETSNYEQRKTIRNTWGQWLNSKYSI
NLPRSINSIDYYSNRTKLVFVMGAKSINLKSVQQDLDFIQNETHFNDIMY
FPGLLDTYMNLTLKTLTGLNVARQKCTKATFFLKADTDVFVNVPRLLGLC
HQHLAQSKKKAIIVGNEQFNAPVIRDKNAKWYVPYEVYSKNYFPPYVTGC
GYLLNSKAIDSIVVTASKVKRLFYWEDVAVTGMYSTNVELIDNKLFRYEE
YMNTIDSCNMRIIILAHRITPSKMISLWNEITSNTTICSFSPNLSSSIKR
FEYVIKSMIFG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002659Glyco_trans_31
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0008378galactosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002659Glycosyl transferase, family 31PFAMPF01762Galactosyl_Tcoord: 81..289
e-value: 1.2E-34
score: 119.8
IPR002659Glycosyl transferase, family 31PANTHERPTHR11214BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASEcoord: 54..324
NoneNo IPR availablePANTHERPTHR11214:SF148HEXOSYLTRANSFERASEcoord: 54..324
NoneNo IPR availableTMHMMTMhelixcoord: 52..74
NoneNo IPR availableTMHMMTMhelixcoord: 7..29