G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30001479
Length (bp)4356
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30001479) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30001479) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30001479) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30001479) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001479

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30001479SMESG000029294.1 SMESG000029291.1 SmedASXL_017909SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v4_2802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v4_2802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v4_2802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v4_2802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30001479SMESG000029291.1 dd_Smed_v4_6716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001479SMESG000029291.1 dd_Smed_v4_6716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001479SMESG000029291.1 dd_Smed_v4_6716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30001479SMESG000029291.1 dd_Smed_v4_6716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v6_2802_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v6_2802_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v6_2802_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v4_2802_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v4_2802_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v4_2802_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v4_2802_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30001479SMESG000029294.1 SMESG000029291.1 dd_Smed_v4_2802_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001479SMESG000029291.1 dd_Smed_v4_6716_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30001479SMESG000029291.1 dd_Smed_v4_6716_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18236751 (tr|A0A267GWF5|A0A267GWF5_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002220g1 PE=4 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 1.173e-162
Identity = 309/577 (53.55%), Postives = 436/577 (75.56%), Query Frame = 2
Query:  401 MMDHISTVGGGRDPDGFVRRKKDEECLKCMLKIPHKKCESHKYIRVGGGYRHSYYYVRMLLEKIELKKQRDEMLRRRLEAISEGKLRALKTYIRTKSGRLIEKIIYVSDEDYIAFNESLARGEDPTKVLQKYLSKDEFKNLDSYDKDENVAIKTYVRTKSGRLVEKVIYISKKDFDAIQRGDLDSNALLRKRLGLKSGDKLEGWAESXXXXXXXXXXXXXXXXXEKQIMISEEDYNKLQKG-GNLNDIISKYMKNDPNVEILDWKKAPKAGMKVVKTFIRTKSGRLVEKTILMTEKEYQEFLNSKGDPNFLKKYLDLKEDETIEGWEKSSTVYEGSEDEALVKA-KGGQIIKDKDGNEYEVVVDPITGXX-XXXXXXXXXXXXXXRTANGRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVRKKKKNADNTRGDSESYHSSQDEGGKAXXXXXXXKLKHGPDSAHSYQSVVSAGGTXXXXXXXXXADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKT-GNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVGYGSKIEVDS 2119
              D +    GGRDPDGF+ + KDE+C+KCMLK+PH KCESH+YIRVGGGYRHS++Y+++LLE+IEL + +  + ++RLE I+EG +RA+KTYIRTKSGR++EK+I++S++DY  F + + +G DP+ +++KYLSK++ +NL  +DK+E  AIKT VRTKSGR++EK++Y+S+ ++D IQRG++D+NA+LR+RL LK G++LE W+  KMRTITT+IRTKSGRIIEK++++S+EDY KL++G  +L+ ++ KY+  D   E+  W    K  MKV+KT++RTKSG+LVEKTILMTE E++EF  S GDPN LK+++ LK+ E I+ WEK+STVY  S+D+      K G+   DK GN +E V DP+TGK   K++ K A +   ++T  G+IIT  D+K+R++ K+GKR+ +SESEYSY+S VS GGTRHV ++ K AD T GD ESYHSS+DE G+ARRR RRR+ KHG DSA S+ S VS GGTR V  R R  DGTY ++  YHS DS+ F+ A + IK+Q+K  K +  G+DS+ S+ SE S  GTRT+ +R+RI++E G  +GYG ++E +S
Sbjct:  103 FADFLGVAYGGRDPDGFLPKSKDEDCIKCMLKVPHDKCESHRYIRVGGGYRHSFWYIKVLLEEIELARHQALIRQKRLETIAEGNIRAVKTYIRTKSGRMVEKVIFMSEDDYQNFQQFVQQGGDPSSLVRKYLSKEDAQNLQGFDKEEQKAIKTVVRTKSGRVIEKIVYVSRDEYDKIQRGEVDANAVLRRRLNLKDGEQLEKWSAPKMRTITTRIRTKSGRIIEKKVLVSDEDYQKLKEGKADLSKVLGKYLSKDEG-EVEGWSAPQKEAMKVIKTYVRTKSGKLVEKTILMTEDEFKEFEKSGGDPNILKRFMKLKDGEQIDKWEKASTVYADSDDDGGGPPKKPGERTVDKHGNVFEYVKDPLTGKVYKKQINKDAKEKGAFKTKGGKIITAADVKRRQDLKQGKRNVDSESEYSYKSEVSDGGTRHVYRRVKKADGTYGDRESYHSSEDEEGQARRRRRRRERKHGNDSAKSFFSDVSEGGTRRVFVRERKPDGTYGEAKEYHSDDSDDFQQAAKAIKQQQKKAKERQHGSDSEHSYVSEYSENGTRTRKRRQRIRDEFGNVIGYGKEVEYES 678          

HSP 2 Score: 383.645 bits (984), Expect = 1.034e-106
Identity = 223/449 (49.67%), Postives = 313/449 (69.71%), Query Frame = 2
Query: 2879 NDADIDSDREDINGKTKKNLKKGSEDSV------LEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDXXXXXXXXXXXXXXIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRXXXXXXXXXXXXRKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYK 4207
            N+AD +SD E    + K++ K+             E+ R KDG I+K++KKDK+GN++E+EYD  GNVV   V++       D+D G YFE G+DGKI+LK GK ++DL  IS++EL  LGIDPN SKAE +R LKQ  G +++V +  KKIG K A D  SD  +  LAE+ D+D++T+   +R+++I K+ G +L  H   ++EKS+L +  + +EK ++I+FLS YRLVDPN LE Y + F +ED DDMDG+IN +  + A+  +     +  L+E+Q D+ L  L  + +T++TFRMFSV  AL +R+TK+D +CRDLLEI++L+DIERKL  YR +F  N  SD DPNYIKL+S+ I+L AGGLN  QQEF++ KL+PNE+ EISFLD+L YIPLF+S+HDNIL+NPLD S+ KY+   +RRAS QRDMNPL + L +NT+F +
Sbjct: 1041 NEADSESDYEPGTERRKRDKKRPGSTGSSDSDSGAEIFRGKDGKILKKVKKDKDGNVVELEYDDKGNVVKRTVRQA------DEDQGDYFEKGSDGKIRLKKGKKRLDLDKISRDELRALGIDPNASKAEIMRQLKQKLGGDVDVHFKGKKIGAK-AIDEYSDIDSDKLAEDDDLDVETLTGIKRLRVIMKKGGSKLISHMHELIEKSHLADNATEEEKATEIDFLSAYRLVDPNKLETYGKAFVVEDFDDMDGLINVRCAKRAISMVPS---VAGLSERQIDYALQVLGFDGNTQLTFRMFSVAMALCERVTKMDQFCRDLLEITNLIDIERKLALYRAMFYCNIPSDRDPNYIKLDSLRIELMAGGLNWRQQEFIIDKLQPNEMFEISFLDYLCYIPLFLSFHDNILSNPLDMSDLKYTPTYRRRASAQRDMNPLAFPLKKNTKFMR 1479          

HSP 3 Score: 127.102 bits (318), Expect = 1.774e-25
Identity = 133/378 (35.19%), Postives = 191/378 (50.53%), Query Frame = 2
Query: 1631 ESEYSYRSFVSAGGTRHVRKKKKNADNTRGDSESYHS--SQD--EGGKA--XXXXXXXKLKHGPDSAHSYQSVVSAGGTXXXXXXXXXADG-----TYSDSVSYHS---ADSEIFKTAEQTIKEQKKLLKNKT---------------GNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVGYGSKIEVDSTGK-PI----GDKNAKKRRKHXXXXXXXXXXXXXXGGTHNQKRKQKVRDKNGKVIGYKKAXXXXXXXXXXXITVSDGKGGKI------KVANPNKKKRKF----------------------------------SKVFSDATTDSEIVNELMKNMTDEEKIKYLADRAKRAKEREQNRKEKYGSNY 2542
            +S  S+ S VS GGTR V  +++  D T G+++ YHS  S D  +  KA  +++ + ++ +HG DS HSY S  S  GTR   RR+R  D       Y   V Y S   +DS+           +    K K                G+DS+ S+ SEVS  GTR  M+R+RI++  G  +GYG K E   TGK P+     D    ++++ ++  ++  +SD S GGT    R++ +RD+ G VIG+ + E Y SD   +Y+TVSDGKGGKI      K AN  + +R                                    S+VFSDA+TDSE+V E + NMT+EE+ ++L DRA R + RE  RKEKYG+ Y
Sbjct:  573 DSAKSFFSDVSEGGTRRVFVRERKPDGTYGEAKEYHSDDSDDFQQAAKAIKQQQKKAKERQHGSDSEHSYVSEYSENGTRTRKRRQRIRDEFGNVIGYGKEVEYESPQASDSDEGGGGGGGQGRKGGGKKGKQAGKGQKGPDGQDVVGGSDSEHSYVSEVSEHGTRHIMRRERIRDADGNVIGYGKKEEY--TGKRPVLGHGADGKKSRKKRDETGEEYEVYSDTSEGGTKRTMRRKVIRDELGNVIGHGEEEVYDSDDADTYVTVSDGKGGKIRKLNMAKAANRERVRRAEQKAAEAAAAGGDKKKRKGKTVRLANGVEVHVSSDSEVFSDASTDSEVVREQLANMTEEERQEFLRDRAARQQARENRRKEKYGAEY 948          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18222577 (tr|A0A267EZG7|A0A267EZG7_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002220g2 PE=4 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 1.439e-162
Identity = 310/577 (53.73%), Postives = 436/577 (75.56%), Query Frame = 2
Query:  401 MMDHISTVGGGRDPDGFVRRKKDEECLKCMLKIPHKKCESHKYIRVGGGYRHSYYYVRMLLEKIELKKQRDEMLRRRLEAISEGKLRALKTYIRTKSGRLIEKIIYVSDEDYIAFNESLARGEDPTKVLQKYLSKDEFKNLDSYDKDENVAIKTYVRTKSGRLVEKVIYISKKDFDAIQRGDLDSNALLRKRLGLKSGDKLEGWAESXXXXXXXXXXXXXXXXXEKQIMISEEDYNKLQKG-GNLNDIISKYMKNDPNVEILDWKKAPKAGMKVVKTFIRTKSGRLVEKTILMTEKEYQEFLNSKGDPNFLKKYLDLKEDETIEGWEKSSTVYEGSEDEALVKA-KGGQIIKDKDGNEYEVVVDPITGXX-XXXXXXXXXXXXXXRTANGRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVRKKKKNADNTRGDSESYHSSQDEGGKAXXXXXXXKLKHGPDSAHSYQSVVSAGGTXXXXXXXXXADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKT-GNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVGYGSKIEVDS 2119
              D +    GGRDPDGF+ + KDE+C+KCMLK+PH KCESH+YIRVGGGYRHS++Y+++LLE+IEL + +  + ++RLE I+EG +RA+KTYIRTKSGR++EK+I++S++DY  F + + +G DP+ +++KYLSK++ +NL  +DK+E  AIKT VRTKSGR++EK++Y+S+ ++D IQRG++D+NA+LR+RL LK G++LE W+  KMRTITTKIRTKSGRIIEK++++S+EDY KL++G  +L+ ++ KY+  D   E+  W    K  MKV+KT++RTKSG+LVEKTILMTE E++EF  S GDPN LK+++ LK+ E I+ WEK+STVY  S+D+      K G+   DK GN +E V DP+TGK   K++ K A +   ++T  G+IIT  D+K+R++ K+GKR+ +SESEYSY+S VS GGTRHV ++ K AD T GD ESYHSS+DE G+ARRR RRR+ KHG DSA S+ S VS GGTR V  R R  DGTY ++  YHS DS+ F+ A + IK+Q+K  K +  G+DS+ S+ SE S  GTRT+ +R+RI++E G  +GYG ++E +S
Sbjct:  103 FADFLGVAYGGRDPDGFLPKSKDEDCIKCMLKVPHDKCESHRYIRVGGGYRHSFWYIKVLLEEIELARHQALIRQKRLETIAEGNIRAVKTYIRTKSGRMVEKVIFMSEDDYQNFQQFVQQGGDPSSLVRKYLSKEDAQNLQGFDKEEQKAIKTVVRTKSGRVIEKIVYVSRDEYDKIQRGEVDANAVLRRRLNLKDGEQLEKWSAPKMRTITTKIRTKSGRIIEKKVLVSDEDYQKLKEGKADLSKVLGKYLSKDEG-EVEGWSAPQKEAMKVIKTYVRTKSGKLVEKTILMTEDEFKEFEKSGGDPNILKRFMKLKDGEQIDKWEKASTVYADSDDDGGGPPKKPGERTVDKHGNVFEYVKDPLTGKVYKKQINKDAKEKGAFKTKGGKIITAADVKRRQDLKQGKRNVDSESEYSYKSEVSDGGTRHVYRRVKKADGTYGDRESYHSSEDEEGQARRRRRRRERKHGNDSAKSFFSDVSEGGTRRVFVRERKPDGTYGEAKEYHSDDSDDFQQAAKAIKQQQKKAKERQHGSDSEHSYVSEYSENGTRTRKRRQRIRDEFGNVIGYGKEVEYES 678          

HSP 2 Score: 385.185 bits (988), Expect = 3.315e-107
Identity = 224/449 (49.89%), Postives = 314/449 (69.93%), Query Frame = 2
Query: 2879 NDADIDSDREDINGKTKKNLKKGSEDSV------LEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDXXXXXXXXXXXXXXIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRXXXXXXXXXXXXRKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYK 4207
            N+AD +SD E    + K++ K+             E+IR KDG I+K++KKDK+GN++E+EYD  GNVV   V++       D+D G YFE G+DGKI+LK GK ++DL  IS++EL  LGIDPN SKAE +R LKQ  G +++V +  KKIG K A D  SD  +  LAE+ D+D++T+   +R+++I K+ G +L  H   ++EKS+L +  + +EK ++I+FLS YRLVDPN LE Y + F +ED DDMDG+IN +  + A+  +     +  L+E+Q D+ L  L  + +T++TFRMFSV  AL +R+TK+D +CRDLLEI++L+DIERKL  YR +F  N  SD DPNYIKL+S+ I+L AGGLN  QQEF++ KL+PNE+ EISFLD+L YIPLF+S+HDNIL+NPLD S+ KY+   +RRAS QRDMNPL + L +NT+F +
Sbjct: 1041 NEADSESDYEPGTERRKRDKKRPGSTGSSDSDSGAEIIRGKDGKILKKVKKDKDGNVVELEYDDKGNVVKRTVRQA------DEDQGDYFEKGSDGKIRLKKGKKRLDLDKISRDELRALGIDPNASKAEIMRQLKQKLGGDVDVHFKGKKIGAK-AIDEYSDIDSDKLAEDDDLDVETLTGIKRLRVIMKKGGSKLISHMHELIEKSHLADNATEEEKATEIDFLSAYRLVDPNKLETYGKAFVVEDFDDMDGLINVRCAKRAISMVPS---VAGLSERQIDYALQVLGFDGNTQLTFRMFSVAMALCERVTKMDQFCRDLLEITNLIDIERKLALYRAMFYCNIPSDRDPNYIKLDSLRIELMAGGLNWRQQEFIIDKLQPNEMFEISFLDYLCYIPLFLSFHDNILSNPLDMSDLKYTPTYRRRASAQRDMNPLAFPLKKNTKFMR 1479          

HSP 3 Score: 127.102 bits (318), Expect = 2.066e-25
Identity = 133/378 (35.19%), Postives = 191/378 (50.53%), Query Frame = 2
Query: 1631 ESEYSYRSFVSAGGTRHVRKKKKNADNTRGDSESYHS--SQD--EGGKA--XXXXXXXKLKHGPDSAHSYQSVVSAGGTXXXXXXXXXADG-----TYSDSVSYHS---ADSEIFKTAEQTIKEQKKLLKNKT---------------GNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVGYGSKIEVDSTGK-PI----GDKNAKKRRKHXXXXXXXXXXXXXXGGTHNQKRKQKVRDKNGKVIGYKKAXXXXXXXXXXXITVSDGKGGKI------KVANPNKKKRKF----------------------------------SKVFSDATTDSEIVNELMKNMTDEEKIKYLADRAKRAKEREQNRKEKYGSNY 2542
            +S  S+ S VS GGTR V  +++  D T G+++ YHS  S D  +  KA  +++ + ++ +HG DS HSY S  S  GTR   RR+R  D       Y   V Y S   +DS+           +    K K                G+DS+ S+ SEVS  GTR  M+R+RI++  G  +GYG K E   TGK P+     D    ++++ ++  ++  +SD S GGT    R++ +RD+ G VIG+ + E Y SD   +Y+TVSDGKGGKI      K AN  + +R                                    S+VFSDA+TDSE+V E + NMT+EE+ ++L DRA R + RE  RKEKYG+ Y
Sbjct:  573 DSAKSFFSDVSEGGTRRVFVRERKPDGTYGEAKEYHSDDSDDFQQAAKAIKQQQKKAKERQHGSDSEHSYVSEYSENGTRTRKRRQRIRDEFGNVIGYGKEVEYESPQASDSDEGGGGGGGQGRKGGGKKGKQAGKGQKGPDGQDVVGGSDSEHSYVSEVSEHGTRHIMRRERIRDADGNVIGYGKKEEY--TGKRPVLGHGADGKKSRKKRDETGEEYEVYSDTSEGGTKRTMRRKVIRDELGNVIGHGEEEVYDSDDADTYVTVSDGKGGKIRKLNMAKAANRERVRRAEQKAAEAAAAGGDKKKRKGKTVRLANGVEVHVSSDSEVFSDASTDSEVVREQLANMTEEERQEFLRDRAARQQARENRRKEKYGAEY 948          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18213137 (tr|A0A267H3G0|A0A267H3G0_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002220g3 PE=4 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 2.276e-162
Identity = 309/577 (53.55%), Postives = 437/577 (75.74%), Query Frame = 2
Query:  401 MMDHISTVGGGRDPDGFVRRKKDEECLKCMLKIPHKKCESHKYIRVGGGYRHSYYYVRMLLEKIELKKQRDEMLRRRLEAISEGKLRALKTYIRTKSGRLIEKIIYVSDEDYIAFNESLARGEDPTKVLQKYLSKDEFKNLDSYDKDENVAIKTYVRTKSGRLVEKVIYISKKDFDAIQRGDLDSNALLRKRLGLKSGDKLEGWAESXXXXXXXXXXXXXXXXXEKQIMISEEDYNKLQKG-GNLNDIISKYMKNDPNVEILDWKKAPKAGMKVVKTFIRTKSGRLVEKTILMTEKEYQEFLNSKGDPNFLKKYLDLKEDETIEGWEKSSTVYEGSEDE-ALVKAKGGQIIKDKDGNEYEVVVDPITGXX-XXXXXXXXXXXXXXRTANGRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVRKKKKNADNTRGDSESYHSSQDEGGKAXXXXXXXKLKHGPDSAHSYQSVVSAGGTXXXXXXXXXADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKT-GNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVGYGSKIEVDS 2119
              D +    GGRDPDGF+ + KDE+C+KCMLK+PH KCESH+YIRVGGGYRHS++Y+++LLE+IEL + +  + ++RLE I+EG +RA+KTYIRTKSGR++EK+I++S++DY  F + + +G DP+ +++KYLSK++ +NL  +DK+E  AIKT VRTKSGR++EK++Y+S+ ++D IQRG++D+NA+LR+RL LK G++LE W+  KMRTITT+IRTKSGRIIEK++++S+EDY KL++G  +L+ ++ KY+  D + E+  W    K  MKV+KT++RTKSG+LVEKTILMTE E++EF  S GDPN LK+++ LK+ E I+ WEK+STVY  S+D+      K G+   DK GN +E V DP+TGK   K++ K A +   ++T  G+IIT  D+K+R++ K+GKR+ +SESEYSY+S VS GGTRHV ++ K AD T GD ESYHSS+DE G+ARRR RRR+ KHG DSA S+ S VS GGTR V  R R  DGTY ++  YHS DS+ F+ A + IK+Q+K  K +  G+DS+ S+ SE S  GTRT+ +R+RI++E G  +GYG ++E +S
Sbjct:  103 FADFLGVAYGGRDPDGFLPKSKDEDCIKCMLKVPHDKCESHRYIRVGGGYRHSFWYIKVLLEEIELARHQALIRQKRLETIAEGNIRAVKTYIRTKSGRMVEKVIFMSEDDYQNFQQFVQQGGDPSSLVRKYLSKEDAQNLQGFDKEEQKAIKTVVRTKSGRVIEKIVYVSRDEYDKIQRGEVDANAVLRRRLNLKDGEQLEKWSAPKMRTITTRIRTKSGRIIEKKVLVSDEDYQKLKEGKADLSKVLGKYLSKD-DGEVEGWSAPQKEAMKVIKTYVRTKSGKLVEKTILMTEDEFKEFEKSGGDPNILKRFMKLKDGEKIDKWEKASTVYADSDDDGGGPPKKPGERTVDKHGNVFEYVKDPLTGKVYKKQINKDAKEKGAFKTKGGKIITAADVKRRQDLKQGKRNVDSESEYSYKSEVSDGGTRHVYRRVKKADGTYGDRESYHSSEDEEGQARRRRRRRERKHGNDSAKSFFSDVSEGGTRRVFVRERKPDGTYGEAKEYHSDDSDDFQQAAKAIKQQQKKAKERQHGSDSEHSYVSEYSENGTRTRKRRQRIRDEFGNVIGYGKEVEYES 678          

HSP 2 Score: 384.8 bits (987), Expect = 3.932e-107
Identity = 224/449 (49.89%), Postives = 314/449 (69.93%), Query Frame = 2
Query: 2879 NDADIDSDREDINGKTKKNLKKGSEDSV------LEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDXXXXXXXXXXXXXXIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRXXXXXXXXXXXXRKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYK 4207
            N+AD +SD E    + K++ K+             E+IR KDG I+K++KKDK+GN++E+EYD  GNVV   V++       D+D G YFE G+DGKI+LK GK ++DL  IS++EL  LGIDPN SKAE +R LKQ  G +++V +  KKIG K A D  SD  +  LAE+ D+D++T+   +R+++I K+ G +L  H   ++EKS+L +  + +EK ++I+FLS YRLVDPN LE Y + F +ED DDMDG+IN +  + A+  +     +  L+E+Q D+ L  L  + +T++TFRMFSV  AL +R+TK+D +CRDLLEI++L+DIERKL  YR +F  N  SD DPNYIKL+S+ I+L AGGLN  QQEF++ KL+PNE+ EISFLD+L YIPLF+S+HDNIL+NPLD S+ KY+   +RRAS QRDMNPL + L +NT+F +
Sbjct: 1041 NEADSESDYEPGTERRKRDKKRPGSTGSSDSDSGAEIIRGKDGKILKKVKKDKDGNVVELEYDDKGNVVKRTVRQA------DEDQGDYFEKGSDGKIRLKKGKKRLDLDKISRDELRALGIDPNASKAEIMRQLKQKLGGDVDVHFKGKKIGAK-AIDEYSDIDSDKLAEDDDLDVETLTGIKRLRVIMKKGGSKLISHMHELIEKSHLADNATEEEKATEIDFLSAYRLVDPNKLETYGKAFVVEDFDDMDGLINVRCAKRAISMVPS---VAGLSERQIDYALQVLGFDGNTQLTFRMFSVAMALCERVTKMDQFCRDLLEITNLIDIERKLALYRAMFYCNIPSDRDPNYIKLDSLRIELMAGGLNWRQQEFIIDKLQPNEMFEISFLDYLCYIPLFLSFHDNILSNPLDMSDLKYTPTYRRRASAQRDMNPLAFPLKKNTKFMR 1479          

HSP 3 Score: 127.102 bits (318), Expect = 2.248e-25
Identity = 133/378 (35.19%), Postives = 191/378 (50.53%), Query Frame = 2
Query: 1631 ESEYSYRSFVSAGGTRHVRKKKKNADNTRGDSESYHS--SQD--EGGKA--XXXXXXXKLKHGPDSAHSYQSVVSAGGTXXXXXXXXXADG-----TYSDSVSYHS---ADSEIFKTAEQTIKEQKKLLKNKT---------------GNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVGYGSKIEVDSTGK-PI----GDKNAKKRRKHXXXXXXXXXXXXXXGGTHNQKRKQKVRDKNGKVIGYKKAXXXXXXXXXXXITVSDGKGGKI------KVANPNKKKRKF----------------------------------SKVFSDATTDSEIVNELMKNMTDEEKIKYLADRAKRAKEREQNRKEKYGSNY 2542
            +S  S+ S VS GGTR V  +++  D T G+++ YHS  S D  +  KA  +++ + ++ +HG DS HSY S  S  GTR   RR+R  D       Y   V Y S   +DS+           +    K K                G+DS+ S+ SEVS  GTR  M+R+RI++  G  +GYG K E   TGK P+     D    ++++ ++  ++  +SD S GGT    R++ +RD+ G VIG+ + E Y SD   +Y+TVSDGKGGKI      K AN  + +R                                    S+VFSDA+TDSE+V E + NMT+EE+ ++L DRA R + RE  RKEKYG+ Y
Sbjct:  573 DSAKSFFSDVSEGGTRRVFVRERKPDGTYGEAKEYHSDDSDDFQQAAKAIKQQQKKAKERQHGSDSEHSYVSEYSENGTRTRKRRQRIRDEFGNVIGYGKEVEYESPQASDSDEGGGGGGGQGRKGGGKKGKQAGKGQKGPDGQDVVGGSDSEHSYVSEVSEHGTRHIMRRERIRDADGNVIGYGKKEEY--TGKRPVLGHGADGKKSRKKRDETGVEYEVYSDTSEGGTKRTMRRKVIRDELGNVIGHGEEEVYDSDDADTYVTVSDGKGGKIRKLNMAKAANRERVRRAEQKAAEAAAAGGDKKKRKGKTVRLANGVEVHVSSDSEVFSDASTDSEVVREQLANMTEEERQEFLRDRAARQQARENRRKEKYGAEY 948          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18303455 (tr|A0A1I8I866|A0A1I8I866_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 5.562e-139
Identity = 292/576 (50.69%), Postives = 413/576 (71.70%), Query Frame = 2
Query:  401 MMDHISTVGGGRDPDGFVRRKKDEECLKCMLKIPHKKCESHKYIRVGGGYRHSYYYVRMLLEKIELKKQRDEMLRRRLEAISEGKLRALKTYIRTKSGRLIEKIIYVSDEDYIAFNESLARGEDPTKVLQKYLSKDEFKNLDSYDKDENVAIKTYVRTKSGRLVEKVIYISKKDFDAIQRGDLDSNALLRKRLGLKSGDKLEGWAESXXXXXXXXXXXXXXXXXEKQIMISEEDYNKLQKG-GNLNDIISKYMKNDPNVEILDWKKAPKAGMKVVKTFIRTKSGRLVEKTILMTEKEYQEFLNSKGDPNFLKKYLDLKEDETIEGWEKSSTVYEGSEDEALVKA-KGGQIIKDKDGNEYEVVVDPITGXXXXXXXXXXXXXXXXRTANGRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVRKKKKNADNTRGDSESYHSSQDEGGKAXXXXXXXKLKHGPDSAHSYQSVVSAGGTXXXXXXXXXADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKT-GNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVGYGSKIEVDS 2119
              D +    GGRDPDGF+ +                    H+YIRVGGGYRHS++Y+++LLE+IEL + +  + ++RLE I+EG +RA+KTYIRTKSGR++EK+I++S++DY  F + + +G DP+ +++KYLSK++ +NL  +DK+E  AIKT VRTKSGR++EK++Y+S+ ++D IQRG++D+NA+LR+RL LK G++LE W+  KMRTITT+IRTKSGRIIEK++++S+EDY KL++G  +L+ ++ KY+  D + E+  W    K  MKV+KT++RTKSG+LVEKTILMTE E++EF  S GDPN LK+++ LK+ E I+ WEK+STVY  S+D+      K G+   DK GN +E V DP+TGK YKK   +            +IIT  D+K+R++ K+GKR+ +SESEYSY+S VS GGTRHV ++ K AD T GD ESYHSS+DE G+ARRR RRR+ KHG DSA S+ S VS GGTR V  R R  DGTY ++  YHS DS+ F+ A + IK+Q+K  K +  G+DS+ S+ SE S  GTRT+ +R+RI++E G  +GYG ++E +S
Sbjct:    6 FADFLGVAYGGRDPDGFLPK--------------------HRYIRVGGGYRHSFWYIKVLLEEIELARHQALIRQKRLETIAEGNIRAVKTYIRTKSGRMVEKVIFMSEDDYQNFQQFVQQGGDPSSLVRKYLSKEDAQNLQGFDKEEQKAIKTVVRTKSGRVIEKIVYVSRDEYDKIQRGEVDANAVLRRRLNLKDGEQLEKWSAPKMRTITTRIRTKSGRIIEKKVLVSDEDYQKLKEGKADLSKVLGKYLSKD-DGEVEGWSAPQKEAMKVIKTYVRTKSGKLVEKTILMTEDEFKEFEKSGGDPNILKRFMKLKDGEKIDKWEKASTVYADSDDDGGGPPKKPGERTVDKHGNVFEYVKDPLTGKVYKKPKAE------------KIITAADVKRRQDLKQGKRNVDSESEYSYKSEVSDGGTRHVYRRVKKADGTYGDRESYHSSEDEEGQARRRRRRRERKHGNDSAKSFFSDVSEGGTRRVFVRERKPDGTYGEAKEYHSDDSDDFQQAAKAIKQQQKKAKERQHGSDSEHSYVSEYSENGTRTRKRRQRIRDEFGNVIGYGKEVEYES 548          

HSP 2 Score: 90.5077 bits (223), Expect = 2.901e-14
Identity = 39/61 (63.93%), Postives = 50/61 (81.97%), Query Frame = 2
Query: 4025 ISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYK 4207
            ISFLD+L YIPLF+S+HDNIL+NPLD S+ KY+   +RRAS QRDMNPL + L +NT+F +
Sbjct:  732 ISFLDYLCYIPLFLSFHDNILSNPLDMSDLKYTPTYRRRASAQRDMNPLAFPLKKNTKFMR 792          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20324085 (tr|A0A1S3K794|A0A1S3K794_LINUN uncharacterized protein LOC106179302 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106179302 PE=4 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 4.504e-135
Identity = 316/609 (51.89%), Postives = 411/609 (67.49%), Query Frame = 2
Query:  458 RKKDEECLKCMLKIPHKKCESHKYIRVGGGYRHSYYYVRMLLEKIELKKQRDEMLRR-RLEAISEGKLRALKTYIRTKSGRLIEKIIYVSDEDYIAFNESLARGEDPTKVLQKYLSKDEFKNLDSYDKDENVAIKTYVRTKSGRLVEKVIYISKKDFDAIQRGDLDSNALLRKRLGLKSGDKLEGWAESXXXXXXXXXXXXXXXXXEKQIMISEEDYNKLQ----KGGNLNDIISKYMKNDPNVEILDWKKAPKAGMKVVKTFIRTKSGRLVEKTILMTEKEYQEFLNSKGDPNFLKKYLDLKEDETIEGWEKSSTVYEGSE-DEALVKAKGGQIIKDKDGNEYEVVVDPITGXXXXXXX--------------------XXXXXXXXXRTANGRI----ITEKD------------IKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVRKKKKNADNTRGDSESYHSSQDEGGKAXXXXXXXKLKHGPDSAHSYQSVVSAGGTXXXXXXXXXADGTYSDSVSYHSADSEIF-------KTAEQTIKEQKKLLKNKTGNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVG------YGSKIEVDS 2119
            R   EECLKCMLK+PH KC  HKYIRVGGGYRHSY+Y++ +L++IE  +Q +E+LRR RLEAI E  +RA+KTYIRTKSGRLIE++I++S+EDY AF            +L+KYL+K+E   L+ +DKDE  AIKT++RTKSG+LVE+++Y+SK+D+D I++G  D+  +L+K +  K G+K++GW E++M+TI T +RTKSGR+IEK IM+S+EDY KLQ    +GG+   ++ KYM      +I  W+K     MKVVKT+IRTKSG+LVEKTILMTE+EY++F  S GD NFLKK++ L + ETIE WEK+STVY  SE DE +  AK G  I  KDG  YE+V DPITGKK+KK V                       D      T+ GR     ITE++            ++K K  KEGKR+ +S SEYSYRS VSAGGTRHVR+KKK AD T  DSESYHSSQDE GK RRR RRR  KHG  SAHSY SV+S GGTRHV RR+R+ADGT  DS SYHS++SE         K      K++K+  + + G+DS+ S+FS+V+ GGT T+ ++KRI++  G  +G      Y S  E DS
Sbjct:  128 RTSSEECLKCMLKVPHSKCVGHKYIRVGGGYRHSYWYLKSMLDEIEA-RQFEELLRRQRLEAIEEKTVRAIKTYIRTKSGRLIERVIFMSEEDYQAFKAGGGGKAA-ADILKKYLTKEEAGGLEKWDKDEVKAIKTFIRTKSGKLVERLVYVSKEDYDRIKQGGSDARDILKKYVTTKPGEKIDGWGEAEMKTIKTYVRTKSGRLIEKTIMVSKEDYEKLQEITRRGGDPASVLGKYMSVGEGEKIESWQKPEPKPMKVVKTYIRTKSGKLVEKTILMTEEEYRQFQESGGDVNFLKKFIPLAKGETIEDWEKASTVYAASEDDEEIQAAKPGTRIIGKDGEIYEIVEDPITGKKFKKKVGGGKGGGAAGGDSDIDSGVGSMKDRTTGKSTSMGRKTYEDITEEEMYSALDPVEREKLRKYKAMKEGKRNDDSNSEYSYRSVVSAGGTRHVRRKKKLADGTYADSESYHSSQDEDGKERRRRRRRDRKHGAGSAHSYYSVISEGGTRHVKRRKRNADGTRGDSESYHSSESEYMAHLARKGKKKAAKTKKKKEKKRREHGSDSEYSYFSDVTEGGTHTRKRKKRIRDAQGNVIGHAESEAYTSPSETDS 734          

HSP 2 Score: 286.96 bits (733), Expect = 5.235e-75
Identity = 169/380 (44.47%), Postives = 247/380 (65.00%), Query Frame = 2
Query: 3101 DEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKE---FQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRXXXXXXXXXXXXRKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRAS-IQRDMNPLGYSLSRNTQFYKKNNAVHL 4228
            DE+ D G YFE+   G +KLK GK KID+  ++ ++L KLGIDP LSK E  RLLK+ FGD+I++    K IG K  +  GSD  T +LA++SD+D DT++  +R  ++ ++ GQ++ DH K V+  S + +    +  DEK+S I++L  YRLV+ N +E Y + F +ED D  D +IN    R  L  +   Q I     KQ ++ L  L I+++T++TFRMF+V+ AL +R+TK+D   R LLEI +L DIERK+  YR +F  N  SD DPN+I  ES+ I+L AGGL+ +QQE+++ +L PN   EISFLD++ YIPLF+S HDNI ++PLD S+ KY +  K+  +  QRDMNPLG  L +++ +  ++ A  L
Sbjct: 1014 DEESD-GDYFEVDEHGNVKLKEGKKKIDISKLTDDDLRKLGIDPTLSKKEITRLLKEKFGDHIKITEKGKTIGIKPVDAYGSDVDTDELADDSDLDTDTLRGTRRTNVLMRKGGQKILDHIKNVINWSKITDQDYAKDLDEKDSGIDYLHHYRLVETNKIEMYAKSFCVEDQD-YDAVINNNEARLGLDGIPTLQAIE---PKQLEYCLRVLRIDENTQVTFRMFAVVTALCERVTKMDDVSRHLLEICNLADIERKMDLYRAMFYTNVTSDRDPNFITAESLRIELIAGGLSWEQQEYIMDRLCPNIFGEISFLDYILYIPLFLSMHDNICDDPLDMSDQKYMTFRKKSGTGRQRDMNPLGNPLKKSSPWLNRSKAKDL 1388          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO44314 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVX6])

HSP 1 Score: 80.8777 bits (198), Expect = 2.641e-15
Identity = 67/255 (26.27%), Postives = 117/255 (45.88%), Query Frame = 2
Query: 3515 KNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALD----INKHTEIT-----------------FRMFSVIAALGD---------------RMTKLDSYCRXXXXXXXXXX-------XXRKLKFYRDL---FNMNEI----SDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKL--RPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYS 4123
            ++S I++L+ YRLVD + +E Y R F +ED D+ +GI+ Y+     L  L+    I  ++ +Q +++L  +        HT +                   R +S    +GD               R  +  ++ R   E               R L+  + +   F  N +     D    +I  E++ I+LKAGGL+  Q++ V+  +    ++  +ISFLD+++Y+PLF+S H+NI  N LD S +KY+
Sbjct:  609 RDSTIDYLAQYRLVDRSKIEVYGRAFTVEDEDE-EGILTYE---QMLMALEGVPTITGMSRQQLNYVLQVITEFTACEVHTNVVEASLQHLLISWKENIDKLRNYSCGTGVGDKLRFTYQLQDVRSHYRTVRASNHIRPNGERPGGRAGPLSDGMETRPLQGTKQVLKRFTHNNMFYVTGDRSATFISSENLRIELKAGGLSQIQEDHVIRHIMQTSDDDKKISFLDYMAYLPLFLSIHENICANALDMSRDKYT 859          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000029294.1 (SMESG000029294.1)

HSP 1 Score: 1537.32 bits (3979), Expect = 0.000e+0
Identity = 920/932 (98.71%), Postives = 926/932 (99.36%), Query Frame = 2
Query: 1547 RTANGRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVRKKKKNADNTRGDSESYHSSQDEGGKAXXXXXXXKLKHGPDSAHSYQSVVSAGGTXXXXXXXXXADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKTGNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVGYGSKIEVDSTGKPIGDKNAKKRRKHXXXXXXXXXXXXXXGGTHNQKRKQKVRDKNGKVIGYKKAXXXXXXXXXXXITVSDGKGGKIKVANPNKKKRKFSKVFSDATTDSEIVNELMKNMTDEEKIKYLADRAKRAKEREQNRKEKYGSNYXXXXXXXXXXXXXXXQRKFSPIFSDATTDSEIVRERMKNMTEDEKLKCIXXXXXXXXXXXXXXXXXYGEKYDEMKNQYXXXXXXXXXXXXXXXXXXXXXXLVRDKKFDKFEENDADIDSDREDINGKTKKNLKKGSEDSVLEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDXXXXXXXXXXXXXXIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRXXXXXXXXXXXXRKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYKKNNAVHLQSNRNNPHTDDMNGLQITGKMKEKLSKYSVLPKIHSPI 4342
            RTA+GRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVR+KKKNADNTRGDSESYHSSQDEGGKARRR+RRRKLKHGPDSAHSYQSVVSAGGTRHVHRRRRHADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKTGNDSDDSFFSEVSAGGTR KMKRKRIKNELGAGVGYGSKIEVDSTGKPIGDKNAKKRRKHDSDSDFSYFSDVSVGGTH QKRKQKVRDKNGKVIGYKKAEDYSSDSESSYITVSDGKGGKIKVANPNKKKRKFSKVFSDATTDSEIVNELMKNMTDEEKIKYLADRA+RAKEREQNRKEKYGSNYE MKKLHEKNKELEKQRKFSPIFSDATTDSEIVRERMKNMTEDEKLK IA+REQ+AAEREQKRKEKYGEKYDEMKNQYE KKEVFKEKLEKAKKEAAERKLVRDKKFDKFEENDADIDSDREDINGK KKNLKKGSEDSVLEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDGNVVSTKVKKKGGKIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRDLLEISDLLDIERKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYKKNNAVHLQSNRNNPHTDDMNGLQITGKMKEKLSKYSVLPKIHSPI
Sbjct:  566 RTADGRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVRRKKKNADNTRGDSESYHSSQDEGGKARRRNRRRKLKHGPDSAHSYQSVVSAGGTRHVHRRRRHADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKTGNDSDDSFFSEVSAGGTRKKMKRKRIKNELGAGVGYGSKIEVDSTGKPIGDKNAKKRRKHDSDSDFSYFSDVSVGGTHYQKRKQKVRDKNGKVIGYKKAEDYSSDSESSYITVSDGKGGKIKVANPNKKKRKFSKVFSDATTDSEIVNELMKNMTDEEKIKYLADRAERAKEREQNRKEKYGSNYEKMKKLHEKNKELEKQRKFSPIFSDATTDSEIVRERMKNMTEDEKLKYIADREQRAAEREQKRKEKYGEKYDEMKNQYEKKKEVFKEKLEKAKKEAAERKLVRDKKFDKFEENDADIDSDREDINGKKKKNLKKGSEDSVLEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDGNVVSTKVKKKGGKIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRDLLEISDLLDIERKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYKKNNAVHLQSNRNNPHTDDMNGLQITGKMKEKLSKYSVLPKIHSPI 1497          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000029294.1 (SMESG000029294.1)

HSP 1 Score: 1536.55 bits (3977), Expect = 0.000e+0
Identity = 920/932 (98.71%), Postives = 926/932 (99.36%), Query Frame = 2
Query: 1547 RTANGRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVRKKKKNADNTRGDSESYHSSQDEGGKAXXXXXXXKLKHGPDSAHSYQSVVSAGGTXXXXXXXXXADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKTGNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVGYGSKIEVDSTGKPIGDKNAKKRRKHXXXXXXXXXXXXXXGGTHNQKRKQKVRDKNGKVIGYKKAXXXXXXXXXXXITVSDGKGGKIKVANPNKKKRKFSKVFSDATTDSEIVNELMKNMTDEEKIKYLADRAKRAKEREQNRKEKYGSNYXXXXXXXXXXXXXXXQRKFSPIFSDATTDSEIVRERMKNMTEDEKLKCIXXXXXXXXXXXXXXXXXYGEKYDEMKNQYXXXXXXXXXXXXXXXXXXXXXXLVRDKKFDKFEENDADIDSDREDINGKTKKNLKKGSEDSVLEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDXXXXXXXXXXXXXXIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRXXXXXXXXXXXXRKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYKKNNAVHLQSNRNNPHTDDMNGLQITGKMKEKLSKYSVLPKIHSPI 4342
            RTA+GRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVR+KKKNADNTRGDSESYHSSQDEGGKARRR+RRRKLKHGPDSAHSYQSVVSAGGTRHVHRRRRHADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKTGNDSDDSFFSEVSAGGTR KMKRKRIKNELGAGVGYGSKIEVDSTGKPIGDKNAKKRRKHDSDSDFSYFSDVSVGGTH QKRKQKVRDKNGKVIGYKKAEDYSSDSESSYITVSDGKGGKIKVANPNKKKRKFSKVFSDATTDSEIVNELMKNMTDEEKIKYLADRA+RAKEREQNRKEKYGSNYE MKKLHEKNKELEKQRKFSPIFSDATTDSEIVRERMKNMTEDEKLK IA+REQ+AAEREQKRKEKYGEKYDEMKNQYE KKEVFKEKLEKAKKEAAERKLVRDKKFDKFEENDADIDSDREDINGK KKNLKKGSEDSVLEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDGNVVSTKVKKKGGKIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRDLLEISDLLDIERKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYKKNNAVHLQSNRNNPHTDDMNGLQITGKMKEKLSKYSVLPKIHSPI
Sbjct:   22 RTADGRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVRRKKKNADNTRGDSESYHSSQDEGGKARRRNRRRKLKHGPDSAHSYQSVVSAGGTRHVHRRRRHADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKTGNDSDDSFFSEVSAGGTRKKMKRKRIKNELGAGVGYGSKIEVDSTGKPIGDKNAKKRRKHDSDSDFSYFSDVSVGGTHYQKRKQKVRDKNGKVIGYKKAEDYSSDSESSYITVSDGKGGKIKVANPNKKKRKFSKVFSDATTDSEIVNELMKNMTDEEKIKYLADRAERAKEREQNRKEKYGSNYEKMKKLHEKNKELEKQRKFSPIFSDATTDSEIVRERMKNMTEDEKLKYIADREQRAAEREQKRKEKYGEKYDEMKNQYEKKKEVFKEKLEKAKKEAAERKLVRDKKFDKFEENDADIDSDREDINGKKKKNLKKGSEDSVLEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDGNVVSTKVKKKGGKIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRDLLEISDLLDIERKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYKKNNAVHLQSNRNNPHTDDMNGLQITGKMKEKLSKYSVLPKIHSPI 953          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000029294.1 (SMESG000029294.1)

HSP 1 Score: 1536.55 bits (3977), Expect = 0.000e+0
Identity = 920/932 (98.71%), Postives = 926/932 (99.36%), Query Frame = 2
Query: 1547 RTANGRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVRKKKKNADNTRGDSESYHSSQDEGGKAXXXXXXXKLKHGPDSAHSYQSVVSAGGTXXXXXXXXXADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKTGNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVGYGSKIEVDSTGKPIGDKNAKKRRKHXXXXXXXXXXXXXXGGTHNQKRKQKVRDKNGKVIGYKKAXXXXXXXXXXXITVSDGKGGKIKVANPNKKKRKFSKVFSDATTDSEIVNELMKNMTDEEKIKYLADRAKRAKEREQNRKEKYGSNYXXXXXXXXXXXXXXXQRKFSPIFSDATTDSEIVRERMKNMTEDEKLKCIXXXXXXXXXXXXXXXXXYGEKYDEMKNQYXXXXXXXXXXXXXXXXXXXXXXLVRDKKFDKFEENDADIDSDREDINGKTKKNLKKGSEDSVLEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDXXXXXXXXXXXXXXIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRXXXXXXXXXXXXRKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYKKNNAVHLQSNRNNPHTDDMNGLQITGKMKEKLSKYSVLPKIHSPI 4342
            RTA+GRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVR+KKKNADNTRGDSESYHSSQDEGGKARRR+RRRKLKHGPDSAHSYQSVVSAGGTRHVHRRRRHADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKTGNDSDDSFFSEVSAGGTR KMKRKRIKNELGAGVGYGSKIEVDSTGKPIGDKNAKKRRKHDSDSDFSYFSDVSVGGTH QKRKQKVRDKNGKVIGYKKAEDYSSDSESSYITVSDGKGGKIKVANPNKKKRKFSKVFSDATTDSEIVNELMKNMTDEEKIKYLADRA+RAKEREQNRKEKYGSNYE MKKLHEKNKELEKQRKFSPIFSDATTDSEIVRERMKNMTEDEKLK IA+REQ+AAEREQKRKEKYGEKYDEMKNQYE KKEVFKEKLEKAKKEAAERKLVRDKKFDKFEENDADIDSDREDINGK KKNLKKGSEDSVLEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDGNVVSTKVKKKGGKIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRDLLEISDLLDIERKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYKKNNAVHLQSNRNNPHTDDMNGLQITGKMKEKLSKYSVLPKIHSPI
Sbjct:  590 RTADGRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVRRKKKNADNTRGDSESYHSSQDEGGKARRRNRRRKLKHGPDSAHSYQSVVSAGGTRHVHRRRRHADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKTGNDSDDSFFSEVSAGGTRKKMKRKRIKNELGAGVGYGSKIEVDSTGKPIGDKNAKKRRKHDSDSDFSYFSDVSVGGTHYQKRKQKVRDKNGKVIGYKKAEDYSSDSESSYITVSDGKGGKIKVANPNKKKRKFSKVFSDATTDSEIVNELMKNMTDEEKIKYLADRAERAKEREQNRKEKYGSNYEKMKKLHEKNKELEKQRKFSPIFSDATTDSEIVRERMKNMTEDEKLKYIADREQRAAEREQKRKEKYGEKYDEMKNQYEKKKEVFKEKLEKAKKEAAERKLVRDKKFDKFEENDADIDSDREDINGKKKKNLKKGSEDSVLEVIRDKDGNIIKRIKKDKNGNLIEIEYDKDGNVVSTKVKKKGGKIDEDQDNGGYFEIGTDGKIKLKVGKTKIDLKNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAEDLGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSNLKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYKGCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRDLLEISDLLDIERKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYKKNNAVHLQSNRNNPHTDDMNGLQITGKMKEKLSKYSVLPKIHSPI 1521          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000029291.1 (SMESG000029291.1)

HSP 1 Score: 451.44 bits (1160), Expect = 3.156e-148
Identity = 252/285 (88.42%), Postives = 253/285 (88.77%), Query Frame = 2
Query:  575 MLLEKIELKKQRDEMLRRRLEAISEGKLRALKTYIRTKSGRLIEKIIYVSDEDYIAFNESLARGEDPTKVLQKYLSKDEFKNLDSYDKDENVAIKTYVRTKSGRLVEKVIYISKKDFDAIQRGDLDSNALLRKRLGLKSGDKLEGWAESXXXXXXXXXXXXXXXXXEKQIMISEEDYNKLQKGGNLNDIISKYMKNDPNVEILDWKKAPKAGMKVVKTFIRTKSGRLVEKTILMTEKEYQEFLNSKGDPNFLKKYLDLKEDETIEGWEKSSTVYEGSEDEALVKA 1429
            MLLEKIELKKQRDEMLRRRLEAISEG                              FNESLARGEDPTKVLQKYLSKDEFKNLDSYDKDENVAIKTYVRTKSGRLVEKVIYISKKDFDAIQRGDLDSNALLRKRLGL+SGDKLEGWAESKMRTITTKIRTKSGRIIEKQIMISEEDYNKLQKGGNLNDIISKYMKNDPNVEILDWKKAPKAGMKVVKTFIRTKSGRLVEKTILMTEKEYQEFLNSKGDPNFL KYLDLKEDETIEGWEKSSTVYEGSEDEALVK 
Sbjct:    1 MLLEKIELKKQRDEMLRRRLEAISEG-----------------------------TFNESLARGEDPTKVLQKYLSKDEFKNLDSYDKDENVAIKTYVRTKSGRLVEKVIYISKKDFDAIQRGDLDSNALLRKRLGLQSGDKLEGWAESKMRTITTKIRTKSGRIIEKQIMISEEDYNKLQKGGNLNDIISKYMKNDPNVEILDWKKAPKAGMKVVKTFIRTKSGRLVEKTILMTEKEYQEFLNSKGDPNFLNKYLDLKEDETIEGWEKSSTVYEGSEDEALVKG 256          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000032513.1 (SMESG000032513.1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.618e-15
Identity = 47/134 (35.07%), Postives = 83/134 (61.94%), Query Frame = 2
Query: 3707 DFILLALDINKHTEITFRMFSVIAALGDRMTKLDSYCRXXXXXXXXXXXXRKLKFYRDLFNMNEISDHDPNYIKLESISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNILNNPLDTS 4108
            + ++   D N  +   F++F+V+AAL  ++T LDS+ ++ L  +D   +E+K+   R L+ +N   D   N I L ++ ++L+AGG+  +  E +  +L    + E++FLDFL+YIPLFI  H +I++NPLD +
Sbjct:  614 NLVMKLCDYNLQSGADFKLFAVLAALSIQITTLDSWIKNKLGKADFKTLEKKVYLCRKLWEVN--VDSSSNSIPLSALMVELRAGGVKQENIEEINQRL--GWMKELNFLDFLTYIPLFILLHTSIIDNPLDMT 743          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182367511.173e-16253.55tr|A0A267GWF5|A0A267GWF5_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182225771.439e-16253.73tr|A0A267EZG7|A0A267EZG7_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182131372.276e-16253.55tr|A0A267H3G0|A0A267H3G0_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183034555.562e-13950.69tr|A0A1I8I866|A0A1I8I866_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|203240854.504e-13551.89tr|A0A1S3K794|A0A1S3K794_LINUN uncharacterized pro... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO443142.641e-1526.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029294.10.000e+098.71SMESG000029294.1[more]
SMESG000029294.10.000e+098.71SMESG000029294.1[more]
SMESG000029294.10.000e+098.71SMESG000029294.1[more]
SMESG000029291.13.156e-14888.42SMESG000029291.1[more]
SMESG000032513.12.618e-1535.07SMESG000032513.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001479 ID=SMED30001479|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4356bp
ATTTTACAGATGATTGATGTATATTGTTTTTCAGACACAGAAAAAATTAA
TTATTATTGGCTGACAGGTGTATCACAATATATTGCTTATGACAGTATGT
AAAAACCATCAACAATTATAAATTTTGCCAGCATTTATTGCAAAATTAGT
TTAATCAAGTTGTGAAATTTTACGAATCTAATTACAAATGAATAATTCTA
TTTATGACAGTGGCCGCTCTTCTCAGTTATCCAACGCATATAGTGATAAT
GAAAGTCTTTCTAGCCAACTTTCCTCAAGAACCTCAAATCATGATAAATA
CATGACCTACAGAAAACCAAAAAAAGAAAGCAGATTTATTTATAACAACA
TTAGAAAATCTTTAATTCGCTCAAGTTCTAGATCTAATATTCACTCTAGA
ATGATGGATCATATATCAACTGTTGGAGGAGGACGAGATCCAGATGGATT
TGTAAGACGAAAAAAAGATGAAGAATGTTTAAAATGCATGCTTAAGATTC
CTCACAAGAAATGTGAATCACACAAATATATTCGCGTCGGTGGAGGCTAT
CGTCACAGTTACTATTACGTCAGAATGTTACTCGAAAAAATTGAGCTGAA
AAAGCAGAGAGATGAAATGCTACGACGCAGACTTGAAGCCATATCTGAAG
GAAAACTAAGAGCATTAAAAACCTACATAAGGACGAAAAGTGGCAGACTT
ATAGAAAAGATAATTTATGTTAGTGATGAAGATTATATAGCTTTCAATGA
ATCATTGGCAAGAGGTGAAGATCCAACCAAAGTTTTACAAAAATATCTAT
CAAAAGACGAATTTAAAAATTTAGATTCCTACGACAAAGATGAAAACGTT
GCCATAAAAACTTACGTTAGAACTAAAAGTGGGCGCTTGGTTGAGAAGGT
CATATATATTTCAAAAAAGGATTTTGATGCCATTCAAAGAGGAGATTTAG
ATAGTAATGCATTATTAAGAAAGCGACTGGGATTAAAAAGTGGAGACAAA
CTTGAAGGTTGGGCCGAATCGAAAATGCGAACTATTACAACGAAAATCCG
AACTAAAAGTGGAAGAATTATTGAAAAACAAATAATGATTTCCGAAGAAG
ATTATAACAAATTGCAAAAAGGAGGAAATTTAAATGACATCATTTCAAAA
TACATGAAAAACGACCCAAATGTCGAAATTCTAGATTGGAAGAAAGCACC
TAAAGCCGGAATGAAAGTTGTAAAAACTTTTATTAGAACGAAAAGTGGAC
GGTTAGTTGAAAAAACTATTTTAATGACAGAAAAGGAATATCAGGAATTT
CTTAATTCCAAGGGAGATCCGAATTTTTTAAAAAAATATTTGGATTTAAA
AGAAGATGAAACTATTGAAGGTTGGGAAAAGTCATCTACAGTTTATGAAG
GTTCAGAGGACGAAGCACTTGTTAAAGCAAAAGGTGGTCAAATAATTAAA
GATAAAGACGGCAATGAATATGAAGTTGTAGTTGATCCTATAACTGGAAA
AAAGTATAAAAAGTTAGTTAAAAAGGCCGATGACGCCGTGGTTTACAGGA
CTGCAAATGGCCGAATTATTACGGAAAAAGACATAAAAAAAAGAAAAAAT
TACAAAGAAGGAAAACGTGATCCGAATAGTGAGAGTGAATATAGTTACAG
ATCATTTGTGAGTGCTGGAGGAACGAGGCATGTTCGAAAGAAGAAAAAGA
ATGCTGATAATACTCGCGGTGACAGTGAATCCTATCACAGCAGCCAAGAT
GAAGGTGGTAAAGCTCGAAGACGAGATCGTCGTAGAAAATTAAAACACGG
CCCTGATAGTGCACATTCATATCAGAGTGTTGTTAGTGCAGGAGGTACTC
GACATGTTCATAGACGAAGAAGACATGCGGATGGAACGTATTCAGATAGT
GTATCATACCACAGCGCAGATAGTGAAATATTCAAAACAGCCGAGCAAAC
AATTAAAGAACAAAAAAAACTATTAAAAAACAAAACCGGGAACGATAGTG
ATGATTCATTTTTTAGTGAAGTGAGCGCAGGTGGAACGAGAACGAAAATG
AAAAGGAAACGAATTAAGAATGAGCTTGGTGCTGGTGTTGGTTATGGCTC
TAAAATCGAAGTTGACAGTACCGGTAAGCCGATTGGAGATAAAAACGCTA
AAAAAAGAAGAAAGCACGACTCTGATAGTGATTTCTCTTATTTCAGTGAC
GTAAGTGTCGGTGGGACTCATAATCAAAAACGCAAACAAAAAGTTCGAGA
CAAAAATGGCAAAGTGATTGGCTATAAAAAAGCGGAAGATTATAGTTCAG
ATTCTGAATCAAGTTATATAACAGTTAGTGATGGAAAAGGTGGGAAAATA
AAAGTAGCTAACCCCAATAAAAAAAAGAGAAAATTTTCAAAAGTATTTTC
CGACGCAACTACCGACTCAGAAATTGTAAACGAACTTATGAAAAATATGA
CAGACGAAGAGAAAATAAAATATTTAGCAGACAGAGCTAAACGAGCAAAA
GAACGTGAACAAAATCGCAAAGAAAAGTACGGATCCAATTATGAAAATAT
GAAGAAATTACATGAAAAAAACAAAGAATTAGAAAAGCAAAGAAAGTTTT
CTCCAATTTTTTCTGATGCAACTACTGATTCTGAAATTGTTCGAGAAAGA
ATGAAAAATATGACTGAAGATGAAAAACTCAAATGTATAGCCGAGCGAGA
ACAGAAAGCTGCTGAACGAGAACAAAAGAGAAAAGAAAAATATGGTGAGA
AGTATGATGAAATGAAAAATCAATATGAAAATAAAAAAGAAGTGTTTAAG
GAAAAATTGGAGAAAGCAAAAAAGGAAGCCGCTGAGAGAAAGTTAGTGAG
AGACAAGAAATTTGATAAATTTGAGGAAAATGATGCCGATATTGACAGTG
ATCGAGAAGATATAAATGGAAAGACAAAGAAAAATCTTAAGAAAGGCAGT
GAAGACTCAGTGCTAGAAGTGATTCGGGATAAAGATGGAAACATTATCAA
ACGAATTAAAAAAGACAAAAATGGAAATTTAATTGAAATTGAATATGATA
AGGACGGGAATGTGGTTAGTACGAAAGTTAAAAAGAAAGGGGGAAAGATT
GACGAAGACCAAGACAATGGTGGCTATTTTGAAATTGGCACAGATGGAAA
AATTAAACTCAAAGTTGGTAAAACAAAAATAGATTTGAAAAACATTTCAA
AAGAAGAATTACTGAAACTTGGTATTGACCCTAATTTGTCCAAAGCCGAA
CAGCTTCGACTATTAAAGCAAATGTTTGGGGATAACATTGAAGTTGTTTA
TAATAAGAAAAAAATAGGTACAAAAAATGCAGAAGACCTTGGCAGTGATG
CTCATACAACCGATCTAGCAGAGAATAGTGACGTAGATATTGATACAGTA
AAACCTGAACAACGAGTGAAGATAATTGAAAAGCGATACGGACAACAGCT
GAAAGATCATGCAAAAATTGTCCTAGAAAAATCAAATCTTAAAGAATTTC
AATCAACGGACGAAAAAAATTCCAAAATAAATTTCTTGTCAACTTATCGT
TTGGTTGATCCAAATAATTTGGAGAAATATGTTCGTTTTTTTGCGATTGA
AGACCACGATGATATGGATGGGATTATCAATTATAAGGGCTGTCGAACCG
CGCTTGGAAACCTAAAGCGGACACAAGTGATAAACAACTTAACTGAAAAA
CAAACCGACTTTATTCTATTGGCACTTGATATTAATAAACATACAGAAAT
CACGTTCCGAATGTTTTCAGTTATCGCGGCCCTCGGAGATCGGATGACGA
AACTAGATTCATACTGTCGTGACTTATTGGAAATATCAGATCTGTTGGAT
ATAGAGCGAAAGTTGAAATTTTATCGAGATTTATTCAATATGAATGAGAT
CTCTGATCATGATCCAAATTACATAAAACTTGAATCAATCTCAATTGATC
TGAAGGCAGGTGGTTTGAATGACGATCAACAAGAATTTGTTTTATCGAAA
CTTCGTCCAAACGAAATTCTTGAGATTTCCTTTCTGGATTTTTTGTCTTA
TATTCCTCTTTTTATTTCTTATCATGACAACATATTGAATAATCCTCTTG
ATACTTCGAATAACAAATATTCAAGTCATACAAAACGACGTGCGTCAATA
CAAAGAGATATGAATCCTTTAGGCTACAGTCTTTCCAGAAACACGCAATT
TTATAAGAAAAATAATGCAGTCCATTTGCAGAGTAACCGAAATAATCCAC
ATACAGATGATATGAATGGGCTGCAAATAACTGGGAAAATGAAAGAAAAA
TTGAGTAAATACTCAGTATTACCAAAGATTCATTCTCCAATATAAAGAAT
ACTCAC
back to top

protein sequence of SMED30001479-orf-1

>SMED30001479-orf-1 ID=SMED30001479-orf-1|Name=SMED30001479-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1386bp
MNNSIYDSGRSSQLSNAYSDNESLSSQLSSRTSNHDKYMTYRKPKKESRF
IYNNIRKSLIRSSSRSNIHSRMMDHISTVGGGRDPDGFVRRKKDEECLKC
MLKIPHKKCESHKYIRVGGGYRHSYYYVRMLLEKIELKKQRDEMLRRRLE
AISEGKLRALKTYIRTKSGRLIEKIIYVSDEDYIAFNESLARGEDPTKVL
QKYLSKDEFKNLDSYDKDENVAIKTYVRTKSGRLVEKVIYISKKDFDAIQ
RGDLDSNALLRKRLGLKSGDKLEGWAESKMRTITTKIRTKSGRIIEKQIM
ISEEDYNKLQKGGNLNDIISKYMKNDPNVEILDWKKAPKAGMKVVKTFIR
TKSGRLVEKTILMTEKEYQEFLNSKGDPNFLKKYLDLKEDETIEGWEKSS
TVYEGSEDEALVKAKGGQIIKDKDGNEYEVVVDPITGKKYKKLVKKADDA
VVYRTANGRIITEKDIKKRKNYKEGKRDPNSESEYSYRSFVSAGGTRHVR
KKKKNADNTRGDSESYHSSQDEGGKARRRDRRRKLKHGPDSAHSYQSVVS
AGGTRHVHRRRRHADGTYSDSVSYHSADSEIFKTAEQTIKEQKKLLKNKT
GNDSDDSFFSEVSAGGTRTKMKRKRIKNELGAGVGYGSKIEVDSTGKPIG
DKNAKKRRKHDSDSDFSYFSDVSVGGTHNQKRKQKVRDKNGKVIGYKKAE
DYSSDSESSYITVSDGKGGKIKVANPNKKKRKFSKVFSDATTDSEIVNEL
MKNMTDEEKIKYLADRAKRAKEREQNRKEKYGSNYENMKKLHEKNKELEK
QRKFSPIFSDATTDSEIVRERMKNMTEDEKLKCIAEREQKAAEREQKRKE
KYGEKYDEMKNQYENKKEVFKEKLEKAKKEAAERKLVRDKKFDKFEENDA
DIDSDREDINGKTKKNLKKGSEDSVLEVIRDKDGNIIKRIKKDKNGNLIE
IEYDKDGNVVSTKVKKKGGKIDEDQDNGGYFEIGTDGKIKLKVGKTKIDL
KNISKEELLKLGIDPNLSKAEQLRLLKQMFGDNIEVVYNKKKIGTKNAED
LGSDAHTTDLAENSDVDIDTVKPEQRVKIIEKRYGQQLKDHAKIVLEKSN
LKEFQSTDEKNSKINFLSTYRLVDPNNLEKYVRFFAIEDHDDMDGIINYK
GCRTALGNLKRTQVINNLTEKQTDFILLALDINKHTEITFRMFSVIAALG
DRMTKLDSYCRDLLEISDLLDIERKLKFYRDLFNMNEISDHDPNYIKLES
ISIDLKAGGLNDDQQEFVLSKLRPNEILEISFLDFLSYIPLFISYHDNIL
NNPLDTSNNKYSSHTKRRASIQRDMNPLGYSLSRNTQFYKKNNAVHLQSN
RNNPHTDDMNGLQITGKMKEKLSKYSVLPKIHSPI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004969histamine receptor activity
GO:0003688DNA replication origin binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007186G-protein coupled receptor signaling pathway
GO:0043114regulation of vascular permeability
GO:0045907positive regulation of vasoconstriction
GO:0048245eosinophil chemotaxis
GO:0006260DNA replication
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000464GABAergic neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR011992EF-hand-dom_pair
IPR003133T_Ag_DNA-bd
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 764..791
NoneNo IPR availableCOILSCoilCoilcoord: 835..880
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 645..664
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 505..526
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..40
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..35
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 471..576
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 769..788
NoneNo IPR availablePANTHERPTHR35538:SF1coord: 833..1331
NoneNo IPR availablePANTHERPTHR35538FAMILY NOT NAMEDcoord: 833..1331
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 1120..1196