Dynamin-like protein

Overview
NameDynamin-like protein
Smed IDSMED30001478
Length (bp)860
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynamin-like protein (SMED30001478) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynamin-like protein (SMED30001478) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-like protein (SMED30001478) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-like protein (SMED30001478) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001478

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30001478SMESG000002033.1 dd_Smed_v4_884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001478SMESG000002033.1 dd_Smed_v4_884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30001478SMESG000002033.1 dd_Smed_v4_884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001478SMESG000002033.1 dd_Smed_v4_884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30001478SMESG000002033.1 dd_Smed_v4_884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30001478SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001478SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30001478SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001478SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30001478SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001478SMESG000002033.1 dd_Smed_v4_884_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-like protein vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 89.3521 bits (220), Expect = 4.877e-20
Identity = 45/130 (34.62%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT++DLPG+ K  V  Q  D+  +  ++   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +++ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMD--EGTDARDVLENKLLPLRRGYIGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Human
Match: DNM3 (dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125])

HSP 1 Score: 90.1225 bits (222), Expect = 8.472e-20
Identity = 47/130 (36.15%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT+IDLPG+ K  V  Q  D+  +  E+   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +++ N+ +P+ +GY G++   Q
Sbjct:    2 NKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMD--EGTDARDVLENKLLPLRRGYVGVVNRSQ 129          
BLAST of Dynamin-like protein vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 89.3521 bits (220), Expect = 9.805e-20
Identity = 45/130 (34.62%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT++DLPG+ K  V  Q  D+  +  ++   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +++ N+ +P+ +GY G++   Q
Sbjct:   55 NKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMD--EGTDARDVLENKLLPLRRGYIGVVNRSQ 182          
BLAST of Dynamin-like protein vs. Ensembl Human
Match: DNM3 (dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125])

HSP 1 Score: 90.1225 bits (222), Expect = 1.025e-19
Identity = 47/130 (36.15%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT+IDLPG+ K  V  Q  D+  +  E+   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +++ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMD--EGTDARDVLENKLLPLRRGYVGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Human
Match: DNM3 (dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125])

HSP 1 Score: 90.1225 bits (222), Expect = 1.292e-19
Identity = 47/130 (36.15%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT+IDLPG+ K  V  Q  D+  +  E+   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +++ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMD--EGTDARDVLENKLLPLRRGYVGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 91.2781 bits (225), Expect = 2.199e-20
Identity = 52/138 (37.68%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTD 725
            N  I+  PI + + SP ++ LT+IDLPGL K  V  Q  D+ ++  ++   F+ ++  LI+ V PAN D+ T+  +K A + +P   R IGVLTKLD +D  E T   EI+ N+   + +GY G++   Q  I+G+ D
Sbjct:  114 NKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMD--EGTDAREILENKLFTLRRGYVGVVNRGQKDIVGRKD 249          
BLAST of Dynamin-like protein vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 91.2781 bits (225), Expect = 2.234e-20
Identity = 52/138 (37.68%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTD 725
            N  I+  PI + + SP ++ LT+IDLPGL K  V  Q  D+ ++  ++   F+ ++  LI+ V PAN D+ T+  +K A + +P   R IGVLTKLD +D  E T   EI+ N+   + +GY G++   Q  I+G+ D
Sbjct:  114 NKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMD--EGTDAREILENKLFTLRRGYVGVVNRGQKDIVGRKD 249          
BLAST of Dynamin-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 69.707 bits (169), Expect = 4.226e-13
Identity = 41/130 (31.54%), Postives = 75/130 (57.69%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI++ I S  +V+L+++DLPG+ K  V  Q  ++ ++  E+   ++   +S+I+ V PANQD  T+  IK A + +    R + VLTKLD +D  + T   +++  + +P++ G  G++   Q
Sbjct:  124 NKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMD--QGTDAMDVLMGKVIPVKLGIIGVVNRSQ 251          
BLAST of Dynamin-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 69.707 bits (169), Expect = 4.226e-13
Identity = 41/130 (31.54%), Postives = 75/130 (57.69%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI++ I S  +V+L+++DLPG+ K  V  Q  ++ ++  E+   ++   +S+I+ V PANQD  T+  IK A + +    R + VLTKLD +D  + T   +++  + +P++ G  G++   Q
Sbjct:  124 NKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMD--QGTDAMDVLMGKVIPVKLGIIGVVNRSQ 251          
BLAST of Dynamin-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 69.707 bits (169), Expect = 4.226e-13
Identity = 41/130 (31.54%), Postives = 75/130 (57.69%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI++ I S  +V+L+++DLPG+ K  V  Q  ++ ++  E+   ++   +S+I+ V PANQD  T+  IK A + +    R + VLTKLD +D  + T   +++  + +P++ G  G++   Q
Sbjct:  124 NKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMD--QGTDAMDVLMGKVIPVKLGIIGVVNRSQ 251          
BLAST of Dynamin-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074122)

HSP 1 Score: 90.1225 bits (222), Expect = 6.794e-20
Identity = 52/150 (34.67%), Postives = 85/150 (56.67%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT+IDLPGL K  +  Q  D+ ++  ++   F+ ++  LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D +Q    E K  
Sbjct:  107 NKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMD--EGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFF 254          
BLAST of Dynamin-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074121)

HSP 1 Score: 90.1225 bits (222), Expect = 6.794e-20
Identity = 52/150 (34.67%), Postives = 85/150 (56.67%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT+IDLPGL K  +  Q  D+ ++  ++   F+ ++  LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D +Q    E K  
Sbjct:  107 NKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMD--EGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFF 254          
BLAST of Dynamin-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074119)

HSP 1 Score: 90.1225 bits (222), Expect = 6.794e-20
Identity = 52/150 (34.67%), Postives = 85/150 (56.67%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT+IDLPGL K  +  Q  D+ ++  ++   F+ ++  LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D +Q    E K  
Sbjct:  107 NKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMD--EGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFF 254          
BLAST of Dynamin-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0111037)

HSP 1 Score: 90.1225 bits (222), Expect = 6.794e-20
Identity = 52/150 (34.67%), Postives = 85/150 (56.67%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT+IDLPGL K  +  Q  D+ ++  ++   F+ ++  LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D +Q    E K  
Sbjct:  107 NKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMD--EGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFF 254          
BLAST of Dynamin-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074118)

HSP 1 Score: 90.1225 bits (222), Expect = 6.794e-20
Identity = 52/150 (34.67%), Postives = 85/150 (56.67%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT+IDLPGL K  +  Q  D+ ++  ++   F+ ++  LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D +Q    E K  
Sbjct:  107 NKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMD--EGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFF 254          
BLAST of Dynamin-like protein vs. Ensembl Zebrafish
Match: dnm1b (dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3])

HSP 1 Score: 90.1225 bits (222), Expect = 9.971e-20
Identity = 49/137 (35.77%), Postives = 80/137 (58.39%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVK-------ADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT++DLPG+ K       AD++ Q RDM+ +       F+ ++N L++ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   EI+ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLMQ-------FVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGMRTIGVITKLDLMD--EGTDAREILENKLLPLRRGYIGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Zebrafish
Match: dnm1b (dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3])

HSP 1 Score: 90.1225 bits (222), Expect = 1.040e-19
Identity = 49/137 (35.77%), Postives = 80/137 (58.39%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVK-------ADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT++DLPG+ K       AD++ Q RDM+ +       F+ ++N L++ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   EI+ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLMQ-------FVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGMRTIGVITKLDLMD--EGTDAREILENKLLPLRRGYIGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Zebrafish
Match: dnm1a (dynamin 1a [Source:NCBI gene;Acc:100307098])

HSP 1 Score: 89.7373 bits (221), Expect = 1.094e-19
Identity = 51/150 (34.00%), Postives = 84/150 (56.00%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT++DLPG+ K  V  Q  D+  +  ++   F+ ++N L++ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D N     E K  
Sbjct:  112 NKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMD--EGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAMAAERKFF 259          
BLAST of Dynamin-like protein vs. Ensembl Zebrafish
Match: dnm3a (dynamin 3a [Source:ZFIN;Acc:ZDB-GENE-040724-76])

HSP 1 Score: 89.7373 bits (221), Expect = 1.182e-19
Identity = 55/164 (33.54%), Postives = 90/164 (54.88%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVK-------ADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKILKDKGLWK 782
            N  I+  PI + + SP ++ LT+IDLPG+ K       AD++ Q RDMI +       F+ ++N LI+ V PAN D+  +  +K A   +P   R IGV+TKLD +D  + T + +++ NR +P+ +GY G++   Q  I G+ D +     E +  K    ++
Sbjct:  112 NKGISSIPINLRVFSPNVLNLTLIDLPGITKVPVGDQPADIEYQIRDMIMQ-------FICKENCLILAVTPANMDLANSDALKLAKDVDPQGHRTIGVITKLDLVD--KGTDVRDVLENRLLPLRRGYIGVVNRSQKDIEGKKDISAALAAEKRFFKSHPAYR 266          
BLAST of Dynamin-like protein vs. Ensembl Zebrafish
Match: dnm3a (dynamin 3a [Source:ZFIN;Acc:ZDB-GENE-040724-76])

HSP 1 Score: 89.7373 bits (221), Expect = 1.182e-19
Identity = 55/164 (33.54%), Postives = 90/164 (54.88%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVK-------ADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKILKDKGLWK 782
            N  I+  PI + + SP ++ LT+IDLPG+ K       AD++ Q RDMI +       F+ ++N LI+ V PAN D+  +  +K A   +P   R IGV+TKLD +D  + T + +++ NR +P+ +GY G++   Q  I G+ D +     E +  K    ++
Sbjct:  112 NKGISSIPINLRVFSPNVLNLTLIDLPGITKVPVGDQPADIEYQIRDMIMQ-------FICKENCLILAVTPANMDLANSDALKLAKDVDPQGHRTIGVITKLDLVD--KGTDVRDVLENRLLPLRRGYIGVVNRSQKDIEGKKDISAALAAEKRFFKSHPAYR 266          
BLAST of Dynamin-like protein vs. Ensembl Xenopus
Match: rnpepl1 (arginyl aminopeptidase (aminopeptidase B)-like 1 [Source:Xenbase;Acc:XB-GENE-986293])

HSP 1 Score: 92.8189 bits (229), Expect = 5.853e-21
Identity = 52/138 (37.68%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  315 FNNTITKEPITISIQSPEMVTLTIIDLPGLVK-------ADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
             N  I+  PI++ I SP ++ L++IDLPG+ K       AD++ Q RDMI        +F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   EI+ N+ +P+ +GY G++   Q
Sbjct:  113 LNKGISAIPISLRIYSPHVLNLSLIDLPGVTKVPVGDQPADIETQIRDMIM-------NFISRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMD--EGTNAQEILENKLLPLRRGYVGVVNRSQ 241          
BLAST of Dynamin-like protein vs. Ensembl Xenopus
Match: dcbld2 (discoidin, CUB and LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-958816])

HSP 1 Score: 87.4261 bits (215), Expect = 9.729e-19
Identity = 46/130 (35.38%), Postives = 76/130 (58.46%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT+IDLPG+ K  V  Q  D+  +  ++   F+ +D+ LI+ V P N D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISPVPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIKDMILQFISRDSCLILAVTPGNTDLANSDALKMAKEVDPQGLRTIGVITKLDLMD--EGTDAKDILENKLLPLRRGYIGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Xenopus
Match: dcbld2 (discoidin, CUB and LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-958816])

HSP 1 Score: 87.4261 bits (215), Expect = 1.051e-18
Identity = 46/130 (35.38%), Postives = 76/130 (58.46%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT+IDLPG+ K  V  Q  D+  +  ++   F+ +D+ LI+ V P N D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q
Sbjct:   96 NKGISPVPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIKDMILQFISRDSCLILAVTPGNTDLANSDALKMAKEVDPQGLRTIGVITKLDLMD--EGTDAKDILENKLLPLRRGYIGVVNRSQ 223          
BLAST of Dynamin-like protein vs. Ensembl Xenopus
Match: dcbld2 (discoidin, CUB and LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-958816])

HSP 1 Score: 87.4261 bits (215), Expect = 1.059e-18
Identity = 46/130 (35.38%), Postives = 76/130 (58.46%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT+IDLPG+ K  V  Q  D+  +  ++   F+ +D+ LI+ V P N D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISPVPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIKDMILQFISRDSCLILAVTPGNTDLANSDALKMAKEVDPQGLRTIGVITKLDLMD--EGTDAKDILENKLLPLRRGYIGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Xenopus
Match: dcbld2 (discoidin, CUB and LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-958816])

HSP 1 Score: 87.4261 bits (215), Expect = 1.072e-18
Identity = 46/130 (35.38%), Postives = 76/130 (58.46%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT+IDLPG+ K  V  Q  D+  +  ++   F+ +D+ LI+ V P N D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISPVPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIKDMILQFISRDSCLILAVTPGNTDLANSDALKMAKEVDPQGLRTIGVITKLDLMD--EGTDAKDILENKLLPLRRGYIGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 88.9669 bits (219), Expect = 2.715e-19
Identity = 45/130 (34.62%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT++DLPG+ K  V  Q  D+  +  ++   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +++ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMD--EGTDARDVLENKLLPLRRGYIGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 88.5817 bits (218), Expect = 2.906e-19
Identity = 45/130 (34.62%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT++DLPG+ K  V  Q  D+  +  ++   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +++ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMD--EGTDARDVLENKLLPLRRGYIGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 88.5817 bits (218), Expect = 3.057e-19
Identity = 45/130 (34.62%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT++DLPG+ K  V  Q  D+  +  ++   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +++ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMD--EGTDARDVLENKLLPLRRGYIGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 88.5817 bits (218), Expect = 3.057e-19
Identity = 45/130 (34.62%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT++DLPG+ K  V  Q  D+  +  ++   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +++ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMD--EGTDARDVLENKLLPLRRGYIGVVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 88.5817 bits (218), Expect = 3.100e-19
Identity = 45/130 (34.62%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT++DLPG+ K  V  Q  D+  +  ++   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +++ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMD--EGTDARDVLENKLLPLRRGYIGVVNRSQ 239          
BLAST of Dynamin-like protein vs. UniProt/SwissProt
Match: sp|Q9U1M9|DYNB_DICDI (Dynamin-B OS=Dictyostelium discoideum OX=44689 GN=dymB PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 7.599e-21
Identity = 57/154 (37.01%), Postives = 89/154 (57.79%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQILGQTDNNQRSELEIKILKDKGLW 779
            N  I+ EPI + I SP++V LT++DLPGL +  ++ Q  D+ +K   +  D++   NS+I+ + PANQDI T+  +K A Q +P   R IGVLTKLD +D    T   +I+    +P+  G+ G++       Q D N R  +E ++L D+  W
Sbjct:  266 NKDISSEPIVLKIYSPKVVPLTLVDLPGLTRVAIEDQPPDIEEKIKSMIIDYISNPNSIILAITPANQDIVTSDALKLAQQVDPLGKRTIGVLTKLDLMDKG--TDAIDILLGNSIPLSLGFVGVVNR----SQQDINNRKPIE-QMLADEWKW 412          
BLAST of Dynamin-like protein vs. UniProt/SwissProt
Match: sp|Q8S3C9|DRP1D_ARATH (Dynamin-related protein 1D OS=Arabidopsis thaliana OX=3702 GN=DRP1D PE=2 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 2.214e-19
Identity = 54/165 (32.73%), Postives = 91/165 (55.15%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQILGQTDNNQRSELEIKILKDKGLWKVE*EFYNLKT 812
            N  I+  PI +SI SP +V LT+IDLPGL K  V+GQ   +++    + R ++ + N LI+ + PANQDI T+  +K A + +P   R  GVLTKLD +D    T   ++I  R   ++  + G++       Q D N+  ++ +   K++  ++   ++ +L T
Sbjct:  119 NKQISSIPIHLSIFSPNVVNLTLIDLPGLTKVAVEGQPETIVEDIESMVRSYVEKPNCLILAISPANQDIATSDAMKLAKEVDPIGDRTFGVLTKLDLMDKG--TNALDVINGRSYKLKYPWVGIVNRS----QADINKNVDMMVARRKEREYFETSPDYGHLAT 277          
BLAST of Dynamin-like protein vs. UniProt/SwissProt
Match: sp|P39055|DYN1_CAEEL (Dynamin OS=Caenorhabditis elegans OX=6239 GN=dyn-1 PE=1 SV=3)

HSP 1 Score: 91.2781 bits (225), Expect = 2.842e-19
Identity = 52/138 (37.68%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTD 725
            N  I+  PI + + SP ++ LT+IDLPGL K  V  Q  D+ ++  ++   F+ ++  LI+ V PAN D+ T+  +K A + +P   R IGVLTKLD +D  E T   EI+ N+   + +GY G++   Q  I+G+ D
Sbjct:  114 NKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMD--EGTDAREILENKLFTLRRGYVGVVNRGQKDIVGRKD 249          
BLAST of Dynamin-like protein vs. UniProt/SwissProt
Match: sp|Q9UQ16|DYN3_HUMAN (Dynamin-3 OS=Homo sapiens OX=9606 GN=DNM3 PE=1 SV=4)

HSP 1 Score: 90.1225 bits (222), Expect = 6.530e-19
Identity = 47/130 (36.15%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP ++ LT+IDLPG+ K  V  Q  D+  +  E+   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +++ N+ +P+ +GY G++   Q
Sbjct:  112 NKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMD--EGTDARDVLENKLLPLRRGYVGVVNRSQ 239          
BLAST of Dynamin-like protein vs. UniProt/SwissProt
Match: sp|P27619|DYN_DROME (Dynamin OS=Drosophila melanogaster OX=7227 GN=shi PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 7.194e-19
Identity = 52/150 (34.67%), Postives = 85/150 (56.67%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT+IDLPGL K  +  Q  D+ ++  ++   F+ ++  LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D +Q    E K  
Sbjct:  107 NKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMD--EGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFF 254          
BLAST of Dynamin-like protein vs. TrEMBL
Match: A0A260ZXX5 (Dynamin-type G domain-containing protein (Fragment) OS=Caenorhabditis latens OX=1503980 GN=FL83_21844 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.724e-21
Identity = 58/150 (38.67%), Postives = 86/150 (57.33%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT+IDLPGL K  V  Q  D+  +  E+   F++Q+  LI+ V PAN D+ T+  +K A + +P   R IGVLTKLD +D  E T   EI+ N+ +P+ +GY G++   Q  I+G+ D     E E K  
Sbjct:   78 NKGISAIPINLRVYSPNVLNLTLIDLPGLTKVAVGDQPADIEHQIREMILSFILQETCLILAVTPANSDLATSDALKMAKEVDPQGLRTIGVLTKLDLMD--EGTDAREILDNKLLPLRRGYVGVVNRGQKDIVGRKDIRAALEAERKFF 225          
BLAST of Dynamin-like protein vs. TrEMBL
Match: A0A087UPJ6 (Dynamin-1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_23768 PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.013e-20
Identity = 50/127 (39.37%), Postives = 82/127 (64.57%), Query Frame = 3
Query:  327 ITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
             + +PI++ I SP ++ LT++DLPGL++  V GQ+ D I +  E+  +++ Q N LI+ V PANQDI  +  +  A   +P++ R IGVLTKLD +D  E T   +I+ N+ +P+++GY G++   Q
Sbjct:   13 FSTKPISLKIFSPHVLKLTLVDLPGLIRIAVSGQSEDSINQIQEMVLNYISQPNCLILAVTPANQDIANSDALNIAKVADPERERTIGVLTKLDLMD--EGTDAKDILENKLIPLKRGYVGVLNRSQ 137          
BLAST of Dynamin-like protein vs. TrEMBL
Match: A0A397HSN3 (Uncharacterized protein OS=Diversispora epigaea OX=1348612 GN=Glove_326g167 PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.743e-20
Identity = 57/157 (36.31%), Postives = 93/157 (59.24%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKILKDKGLWK 782
            N  I++ PI + I+SP+++ LT++DLPGL K  V  Q  D+ K+T  +  D++ + NSLI+ V PAN D+  + ++K A Q +P+  R IGVLTKLD +DA   T   E++  R +P++ G+ G++   Q  I      N+  + E+   K+   +K
Sbjct:  113 NKGISRSPIHLKIRSPKVLNLTLVDLPGLTKIPVGDQPTDIEKQTRNLILDYITKPNSLILAVSPANVDLVNSESLKLAKQVDPEGKRTIGVLTKLDLMDAG--TNALEVLTGRVLPLKLGFIGVVNRSQQDITSSKPMNEALKSELDFFKNHPAYK 267          
BLAST of Dynamin-like protein vs. TrEMBL
Match: A0A267EUG5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016602g2 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.508e-20
Identity = 50/130 (38.46%), Postives = 81/130 (62.31%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PIT+ + SP+++ LT++DLPG+ K  V  Q  D+ ++   +  +F+ +DN LI+ V PAN D+  +  +K A + +P  SR IGVLTKLD +DA   T   +++ NR +P+ +GY G++   Q
Sbjct:  113 NKGISNVPITLRVYSPQVLNLTLVDLPGMTKVAVGDQPPDIEQQVRAMIWEFISKDNCLILAVSPANSDLANSDALKLAKEADPSGSRTIGVLTKLDLMDAG--TDARDVLENRFLPLRRGYVGVVNRSQ 240          
BLAST of Dynamin-like protein vs. TrEMBL
Match: A0A267GS45 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016602g1 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.630e-20
Identity = 50/130 (38.46%), Postives = 81/130 (62.31%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PIT+ + SP+++ LT++DLPG+ K  V  Q  D+ ++   +  +F+ +DN LI+ V PAN D+  +  +K A + +P  SR IGVLTKLD +DA   T   +++ NR +P+ +GY G++   Q
Sbjct:  113 NKGISNVPITLRVYSPQVLNLTLVDLPGMTKVAVGDQPPDIEQQVRAMIWEFISKDNCLILAVSPANSDLANSDALKLAKEADPSGSRTIGVLTKLDLMDAG--TDARDVLENRFLPLRRGYVGVVNRSQ 240          
BLAST of Dynamin-like protein vs. Ensembl Cavefish
Match: dnm1a (dynamin-1 [Source:NCBI gene;Acc:103024863])

HSP 1 Score: 91.2781 bits (225), Expect = 2.975e-20
Identity = 52/150 (34.67%), Postives = 84/150 (56.00%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT++DLPG+ K  V  Q  D+  +  E+   F+ ++N L++ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D N     E K  
Sbjct:  112 NKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKEMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMD--EGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFF 259          
BLAST of Dynamin-like protein vs. Ensembl Cavefish
Match: dnm1a (dynamin-1 [Source:NCBI gene;Acc:103024863])

HSP 1 Score: 91.2781 bits (225), Expect = 3.039e-20
Identity = 52/150 (34.67%), Postives = 84/150 (56.00%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT++DLPG+ K  V  Q  D+  +  E+   F+ ++N L++ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D N     E K  
Sbjct:  112 NKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKEMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMD--EGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFF 259          
BLAST of Dynamin-like protein vs. Ensembl Cavefish
Match: dnm1a (dynamin-1 [Source:NCBI gene;Acc:103024863])

HSP 1 Score: 91.2781 bits (225), Expect = 3.276e-20
Identity = 52/150 (34.67%), Postives = 84/150 (56.00%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT++DLPG+ K  V  Q  D+  +  E+   F+ ++N L++ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D N     E K  
Sbjct:  112 NKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKEMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMD--EGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFF 259          
BLAST of Dynamin-like protein vs. Ensembl Cavefish
Match: dnm3a (dynamin-3 [Source:NCBI gene;Acc:103035811])

HSP 1 Score: 90.1225 bits (222), Expect = 8.893e-20
Identity = 49/138 (35.51%), Postives = 79/138 (57.25%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTD 725
            N  I+  PI + + SP ++ LT+IDLPG+ K  V  Q  D+  +  ++   F+ ++N LI+ V PAN D+  +  +K     +P   R IGV+TKLD +D  E T   +++ NR +P+ +GY G++   Q  I G+ D
Sbjct:  112 NKGISSIPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIRDMIMQFICRENCLILAVTPANMDLANSDALKLGKDVDPQGQRTIGVITKLDLMD--EGTNARDVLENRLLPLRRGYIGVVNRSQKDIEGKKD 247          
BLAST of Dynamin-like protein vs. Ensembl Cavefish
Match: dnm3a (dynamin-3 [Source:NCBI gene;Acc:103035811])

HSP 1 Score: 89.7373 bits (221), Expect = 9.041e-20
Identity = 49/138 (35.51%), Postives = 79/138 (57.25%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTD 725
            N  I+  PI + + SP ++ LT+IDLPG+ K  V  Q  D+  +  ++   F+ ++N LI+ V PAN D+  +  +K     +P   R IGV+TKLD +D  E T   +++ NR +P+ +GY G++   Q  I G+ D
Sbjct:  112 NKGISSIPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIRDMIMQFICRENCLILAVTPANMDLANSDALKLGKDVDPQGQRTIGVITKLDLMD--EGTNARDVLENRLLPLRRGYIGVVNRSQKDIEGKKD 247          
BLAST of Dynamin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006976.1 (pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1 gene:ENSPMAG00000006300.1 transcript:ENSPMAT00000006976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 1.381e-20
Identity = 53/150 (35.33%), Postives = 84/150 (56.00%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT+IDLPG+ K  V  Q  D+  +  E+   F+ ++N LI+ V PAN D+  +  +K A + +P   R IGV+TKLD +D  + T   +I+ N+ +P+ +GY G++   Q  I G+ D N     E K  
Sbjct:   59 NKGISPIPINLRVYSPHVLNLTLIDLPGMTKVPVGDQPVDIEYQIREMLMQFVTKENCLILAVSPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMD--DGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFF 206          
BLAST of Dynamin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002816.1 (pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-1 gene:ENSPMAG00000002541.1 transcript:ENSPMAT00000002816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 3.282e-16
Identity = 45/131 (34.35%), Postives = 75/131 (57.25%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQI 710
            N  I+ E I + I SP ++ LT++DLPG+ K  V  Q  D+ ++  E+   F+   NS+I+ V  AN D+ T+  +K A + + D  R + V+TKLD +DA   T   +I+  R +P++ G  G++   Q+
Sbjct:  135 NKGISSEAIHLKIFSPHVLNLTLVDLPGITKVPVGDQPVDIEQQIRELIIKFIGNPNSIILAVTAANTDLATSEALKIAREVDTDGRRTLAVITKLDLMDAG--TDAMDILTGRVIPVKLGIIGVVNRSQL 263          
BLAST of Dynamin-like protein vs. Ensembl Sea Lamprey
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 72.4034 bits (176), Expect = 1.329e-14
Identity = 40/119 (33.61%), Postives = 66/119 (55.46%), Query Frame = 3
Query:  327 ITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGY 683
            ++K  I + + S  +  LT+IDLPG+ +  + GQA D+  +  ++ RD + +  ++ + V+P N DI TT  +K A   +P   R +GVLTK D +D         I+ N+  P+ KGY
Sbjct:  137 VSKSLIELEVTSDSVPDLTLIDLPGIARVALAGQAVDIETQIKDLIRDHIGRQETINLVVIPCNVDIATTEALKMAQAVDPTGVRTLGVLTKPDLMDEGTERNALRILQNQVFPLSKGY 255          
BLAST of Dynamin-like protein vs. Ensembl Sea Lamprey
Match: opa1 (OPA1 mitochondrial dynamin like GTPase [Source:NCBI gene;Acc:492332])

HSP 1 Score: 55.4546 bits (132), Expect = 6.230e-9
Identity = 32/129 (24.81%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  321 NTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTT---IPEIIANRKMPIEK-GYYGLI 695
            +T++ E I++S++ P +  + ++DLPG++     G A D       +++ +M   N++I+C+   + D   +         +P   R I VLTK+D L  K + +   I +I+  +  P++  GY+ ++
Sbjct:  307 HTVSAETISLSVKGPGLQRMVLVDLPGVISTMTSGMAPDTKDAIFAMSKGYMQNPNAIILCIQDGSVDAERSIVTDLVSNMDPQGKRTIFVLTKVD-LAEKNLASPNRIQQILDGKLFPMKALGYFAVV 434          
BLAST of Dynamin-like protein vs. Ensembl Sea Lamprey
Match: opa1 (OPA1 mitochondrial dynamin like GTPase [Source:NCBI gene;Acc:492332])

HSP 1 Score: 55.0694 bits (131), Expect = 7.622e-9
Identity = 32/129 (24.81%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  321 NTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTT---IPEIIANRKMPIEK-GYYGLI 695
            +T++ E I++S++ P +  + ++DLPG++     G A D       +++ +M   N++I+C+   + D   +         +P   R I VLTK+D L  K + +   I +I+  +  P++  GY+ ++
Sbjct:  317 HTVSAETISLSVKGPGLQRMVLVDLPGVISTMTSGMAPDTKDAIFAMSKGYMQNPNAIILCIQDGSVDAERSIVTDLVSNMDPQGKRTIFVLTKVD-LAEKNLASPNRIQQILDGKLFPMKALGYFAVV 444          
BLAST of Dynamin-like protein vs. Ensembl Yeast
Match: VPS1 (Dynamin-like GTPase required for vacuolar sorting; also involved in actin cytoskeleton organization, endocytosis, late Golgi-retention of some proteins, regulation of peroxisome biogenesis [Source:SGD;Acc:S000001709])

HSP 1 Score: 83.1889 bits (204), Expect = 1.953e-18
Identity = 46/130 (35.38%), Postives = 80/130 (61.54%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N+ I+  PI + I SP ++TLT++DLPGL K  V  Q  D+ ++  ++   ++ + N++I+ V  AN D+  +  +K A + +P+ +R IGVLTK+D +D  + T + +I+A R +P+  GY  +I   Q
Sbjct:  154 NSGISSVPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMD--QGTDVIDILAGRVIPLRYGYIPVINRGQ 281          
BLAST of Dynamin-like protein vs. Ensembl Yeast
Match: DNM1 (Dynamin-related GTPase involved in mitochondrial organization; required for mitochondrial fission and inheritance; self assembles on the cytoplasmic face of mitochondrial tubules at sites where division will occur; participates in endocytosis and regulates peroxisome fission along with Vps1p; mutants in the human ortholog DNM1L, which mediates mitochondrial fission, peroxisomal division, autophagy, and mitophagy, are associated with slowly progressive infantile encephalopathy [Source:SGD;Acc:S000003924])

HSP 1 Score: 81.6481 bits (200), Expect = 6.217e-18
Identity = 43/127 (33.86%), Postives = 76/127 (59.84%), Query Frame = 3
Query:  327 ITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            I+K PI + + SP ++ LT++DLPG+ K  +  Q  D+ K+   +  D++   N LI+ V PAN D+  + ++K A + +P   R IGV+TKLD +D+   T   +I++ +  P++ G+ G++   Q
Sbjct:  154 ISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSG--TNALDILSGKMYPLKLGFVGVVNRSQ 278          
BLAST of Dynamin-like protein vs. Ensembl Yeast
Match: MGM1 (Mitochondrial GTPase, present in complex with Ugo1p and Fzo1p; required for mitochondrial morphology, fusion, and genome maintenance; promotes membrane bending; exists as long and short form with different distributions; ratio of long to short forms is regulated by Psd1p; homolog of human OPA1 involved in autosomal dominant optic atrophy [Source:SGD;Acc:S000005737])

HSP 1 Score: 68.9366 bits (167), Expect = 1.353e-13
Identity = 35/124 (28.23%), Postives = 73/124 (58.87%), Query Frame = 3
Query:  324 TITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLI 695
             +++EPI ++I+S  +  L+++DLPG ++ +   Q  ++  K  ++   ++   N +I+ +  A+ D+  ++ +K +   +P   R IGV+TKLD +D ++  +   I+ N+K P+  GY G+I
Sbjct:  295 AVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDPEKARS---ILNNKKYPLSMGYVGVI 414          
BLAST of Dynamin-like protein vs. Ensembl Nematostella
Match: EDO32191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT4])

HSP 1 Score: 92.8189 bits (229), Expect = 2.566e-21
Identity = 47/130 (36.15%), Postives = 79/130 (60.77%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ 707
            N  I+  PI + + SP +++LT++DLPG+ K  V  Q  D+  +   +  +F+ ++N LI+ V PAN D+  +  +K A + +P  +R IGV+TKLD +D  E T   +I+ NR +P+ +GY G++   Q
Sbjct:  112 NKGISNIPINLRVYSPSVLSLTLVDLPGMTKVPVGDQPADIEFQIRSMLLEFITKENCLILAVSPANSDLANSDALKIAREVDPQGARTIGVITKLDLMD--EGTDARDILENRVLPLRRGYIGIVNRSQ 239          
BLAST of Dynamin-like protein vs. Ensembl Nematostella
Match: EDO34895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN34])

HSP 1 Score: 83.9593 bits (206), Expect = 3.349e-18
Identity = 50/152 (32.89%), Postives = 85/152 (55.92%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQILGQTDNNQRSELEIKILKDKG 773
            N  I+ EPI + I SP+++ LT++DLPG+ K  V  Q  D+ ++   +   ++   NS+I+ V PAN D+ T+  +K A + +PD  R + V TKLD +D    T   +++  R +P++ G  G++   Q+    D N R  +E   L+D+ 
Sbjct:  131 NKGISSEPINLKIYSPKVLNLTLVDLPGVTKVPVGDQPLDIEQQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHG--TDAMDVLYGRVIPVKLGIIGVVNRSQL----DINNRKSIE-NALRDEA 275          
BLAST of Dynamin-like protein vs. Ensembl Nematostella
Match: EDO40359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A7])

HSP 1 Score: 51.9878 bits (123), Expect = 1.468e-7
Identity = 31/127 (24.41%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  324 TITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEV--TTIPEIIANRKMPIEK-GYYGLI 695
            T++ E I+++++ P +  + ++DLPG++     G A        +I+R +M   N++I+C+     D   +         +P   R I VLTK+D  +  E   + I +I+     P++  GY+ ++
Sbjct:  117 TVSPEVISMTVKGPGLHRMVLVDLPGIIGTTTTGMAESTKSDILDISRRYMENPNAIILCIQDGAIDAERSNVTDLVSSMDPQGKRTIFVLTKVDLAEQNETSPSRIKQILEGNLFPMKALGYFAVV 243          
BLAST of Dynamin-like protein vs. Ensembl Medaka
Match: ENSORLT00000002352.2 (pep primary_assembly:ASM223467v1:4:3837959:3851307:-1 gene:ENSORLG00000001885.2 transcript:ENSORLT00000002352.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 4.378e-21
Identity = 47/126 (37.30%), Postives = 74/126 (58.73%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLI 695
            N  I   PI + I SP ++ LT++DLPG+ K  V+ Q  D+  +  +I   ++  +N LI+ V+PAN D+  +  +K A   +P   R  GV+TKLD +D  E T   EI+ NR +P+ +GY G++
Sbjct:  115 NKGICSAPIVLQIHSPHVLNLTLVDLPGMTKVPVEDQPADIEYQIRDIIMQYICNENCLILAVVPANTDLPNSDALKLAKDVDPQGLRTFGVITKLDLMD--EGTDAKEILENRFLPLRRGYVGVV 238          
BLAST of Dynamin-like protein vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 89.7373 bits (221), Expect = 1.058e-19
Identity = 54/157 (34.39%), Postives = 87/157 (55.41%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVK-------ADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT++DLPG+ K       AD++ Q RDM+ +       F+ ++N L++ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D N     E K  
Sbjct:  112 NKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQ-------FVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMD--EGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFF 259          
BLAST of Dynamin-like protein vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 89.7373 bits (221), Expect = 1.084e-19
Identity = 54/157 (34.39%), Postives = 87/157 (55.41%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVK-------ADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT++DLPG+ K       AD++ Q RDM+ +       F+ ++N L++ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D N     E K  
Sbjct:  112 NKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQ-------FVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMD--EGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFF 259          
BLAST of Dynamin-like protein vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 89.7373 bits (221), Expect = 1.086e-19
Identity = 54/157 (34.39%), Postives = 87/157 (55.41%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVK-------ADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT++DLPG+ K       AD++ Q RDM+ +       F+ ++N L++ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D N     E K  
Sbjct:  112 NKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQ-------FVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMD--EGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFF 259          
BLAST of Dynamin-like protein vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 89.7373 bits (221), Expect = 1.093e-19
Identity = 54/157 (34.39%), Postives = 87/157 (55.41%), Query Frame = 3
Query:  318 NNTITKEPITISIQSPEMVTLTIIDLPGLVK-------ADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQ--ILGQTDNNQRSELEIKIL 761
            N  I+  PI + + SP ++ LT++DLPG+ K       AD++ Q RDM+ +       F+ ++N L++ V PAN D+  +  +K A + +P   R IGV+TKLD +D  E T   +I+ N+ +P+ +GY G++   Q  I G+ D N     E K  
Sbjct:  112 NKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQ-------FVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMD--EGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFF 259          
BLAST of Dynamin-like protein vs. Planmine SMEST
Match: SMESG000002033.1 (SMESG000002033.1)

HSP 1 Score: 333.954 bits (855), Expect = 6.223e-111
Identity = 162/163 (99.39%), Postives = 163/163 (100.00%), Query Frame = 3
Query:  300 VQHDVFNNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQILGQTDNNQRSELEIKILKDKGLWKVE 788
            +QHDVFNNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQILGQTDNNQRSELEIKILKDKGLWKVE
Sbjct:  103 IQHDVFNNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQILGQTDNNQRSELEIKILKDKGLWKVE 265          
BLAST of Dynamin-like protein vs. Planmine SMEST
Match: SMESG000002199.1 (SMESG000002199.1)

HSP 1 Score: 265.774 bits (678), Expect = 9.444e-85
Identity = 129/166 (77.71%), Postives = 144/166 (86.75%), Query Frame = 3
Query:  291 ILLVQHDVFNNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQILGQTDNNQRSELEIKILKDKGLWKVE 788
            IL +Q +VFN+ +TKEPITISI SP+  TLTIIDLPGLVKAD++GQA DMI+KTHEIARDFM QDNSLIICVLPANQDICTTTTIKEA QCNPDKSRIIGVLTKLDKLD KE TTIPEII NRK+PIEKGYYGL+VSD IL  TD N+R++ E  IL +KGL+  E
Sbjct:   30 ILKIQRNVFNDQLTKEPITISIGSPDSSTLTIIDLPGLVKADIEGQATDMIEKTHEIARDFMKQDNSLIICVLPANQDICTTTTIKEATQCNPDKSRIIGVLTKLDKLDDKEATTIPEIIRNRKLPIEKGYYGLVVSDHILELTDKNKRTDAETTILMNKGLYNKE 195          
BLAST of Dynamin-like protein vs. Planmine SMEST
Match: SMESG000002124.1 (SMESG000002124.1)

HSP 1 Score: 257.299 bits (656), Expect = 8.409e-83
Identity = 126/163 (77.30%), Postives = 142/163 (87.12%), Query Frame = 3
Query:  300 VQHDVFNNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQILGQTDNNQRSELEIKILKDKGLWKVE 788
            +QH+VF + ITK+PITI IQSPE+VTLTIIDLPGLVKADV+GQARDMI+KTHEIARDFMM +NSLIICVLPANQDICTTTTI+EA +CNP KSRIIGVLTKLDKLD KEVT I EII N+K+PIEKGYYGLIV+ +IL  TD + RSE E +ILK K LW  E
Sbjct:  103 IQHNVFKDEITKDPITIRIQSPEVVTLTIIDLPGLVKADVRGQARDMIEKTHEIARDFMMLENSLIICVLPANQDICTTTTIREATECNPGKSRIIGVLTKLDKLDEKEVTLILEIIRNQKLPIEKGYYGLIVNTEILELTDKDDRSETERRILKAKNLWNAE 265          
BLAST of Dynamin-like protein vs. Planmine SMEST
Match: SMESG000002211.1 (SMESG000002211.1)

HSP 1 Score: 250.751 bits (639), Expect = 1.213e-82
Identity = 123/163 (75.46%), Postives = 141/163 (86.50%), Query Frame = 3
Query:  300 VQHDVFNNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQILGQTDNNQRSELEIKILKDKGLWKVE 788
            +Q   FNN ITKEPITISIQSPE VTLTIIDLPGLVK +VQGQ+R +I+KTHEIARDFM Q+NSLIICVLPANQDICTTTTI+EAIQCNPDKSRIIGVLTKLDKLD KE T IP+II N K+PI+KGYYGLIVSD+IL  T+ ++ +++E  ILK K LW +E
Sbjct:  126 IQTTAFNNEITKEPITISIQSPESVTLTIIDLPGLVKTNVQGQSRHIIQKTHEIARDFMEQENSLIICVLPANQDICTTTTIREAIQCNPDKSRIIGVLTKLDKLDKKEATLIPDIIRNYKLPIKKGYYGLIVSDEILELTNKDEIAKVEKNILKRKKLWTLE 288          
BLAST of Dynamin-like protein vs. Planmine SMEST
Match: SMESG000002124.1 (SMESG000002124.1)

HSP 1 Score: 257.299 bits (656), Expect = 2.877e-82
Identity = 126/163 (77.30%), Postives = 142/163 (87.12%), Query Frame = 3
Query:  300 VQHDVFNNTITKEPITISIQSPEMVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPANQDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMPIEKGYYGLIVSDQILGQTDNNQRSELEIKILKDKGLWKVE 788
            +QH+VF + ITK+PITI IQSPE+VTLTIIDLPGLVKADV+GQARDMI+KTHEIARDFMM +NSLIICVLPANQDICTTTTI+EA +CNP KSRIIGVLTKLDKLD KEVT I EII N+K+PIEKGYYGLIV+ +IL  TD + RSE E +ILK K LW  E
Sbjct:  149 IQHNVFKDEITKDPITIRIQSPEVVTLTIIDLPGLVKADVRGQARDMIEKTHEIARDFMMLENSLIICVLPANQDICTTTTIREATECNPGKSRIIGVLTKLDKLDEKEVTLILEIIRNQKLPIEKGYYGLIVNTEILELTDKDDRSETERRILKAKNLWNAE 311          
The following BLAST results are available for this feature:
BLAST of Dynamin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNM14.877e-2034.62dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM38.472e-2036.15dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125][more]
DNM19.805e-2034.62dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM31.025e-1936.15dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125][more]
DNM31.292e-1936.15dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125][more]
back to top
BLAST of Dynamin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyn-12.199e-2037.68Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
dyn-12.234e-2037.68Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
drp-14.226e-1331.54Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-14.226e-1331.54Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-14.226e-1331.54Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Dynamin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shi6.794e-2034.67gene:FBgn0003392 transcript:FBtr0074122[more]
shi6.794e-2034.67gene:FBgn0003392 transcript:FBtr0074121[more]
shi6.794e-2034.67gene:FBgn0003392 transcript:FBtr0074119[more]
shi6.794e-2034.67gene:FBgn0003392 transcript:FBtr0111037[more]
shi6.794e-2034.67gene:FBgn0003392 transcript:FBtr0074118[more]
back to top
BLAST of Dynamin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1b9.971e-2035.77dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3][more]
dnm1b1.040e-1935.77dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3][more]
dnm1a1.094e-1934.00dynamin 1a [Source:NCBI gene;Acc:100307098][more]
dnm3a1.182e-1933.54dynamin 3a [Source:ZFIN;Acc:ZDB-GENE-040724-76][more]
dnm3a1.182e-1933.54dynamin 3a [Source:ZFIN;Acc:ZDB-GENE-040724-76][more]
back to top
BLAST of Dynamin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnpepl15.853e-2137.68arginyl aminopeptidase (aminopeptidase B)-like 1 [... [more]
dcbld29.729e-1935.38discoidin, CUB and LCCL domain containing 2 [Sourc... [more]
dcbld21.051e-1835.38discoidin, CUB and LCCL domain containing 2 [Sourc... [more]
dcbld21.059e-1835.38discoidin, CUB and LCCL domain containing 2 [Sourc... [more]
dcbld21.072e-1835.38discoidin, CUB and LCCL domain containing 2 [Sourc... [more]
back to top
BLAST of Dynamin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnm12.715e-1934.62dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm12.906e-1934.62dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm13.057e-1934.62dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm13.057e-1934.62dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm13.100e-1934.62dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
back to top
BLAST of Dynamin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U1M9|DYNB_DICDI7.599e-2137.01Dynamin-B OS=Dictyostelium discoideum OX=44689 GN=... [more]
sp|Q8S3C9|DRP1D_ARATH2.214e-1932.73Dynamin-related protein 1D OS=Arabidopsis thaliana... [more]
sp|P39055|DYN1_CAEEL2.842e-1937.68Dynamin OS=Caenorhabditis elegans OX=6239 GN=dyn-1... [more]
sp|Q9UQ16|DYN3_HUMAN6.530e-1936.15Dynamin-3 OS=Homo sapiens OX=9606 GN=DNM3 PE=1 SV=... [more]
sp|P27619|DYN_DROME7.194e-1934.67Dynamin OS=Drosophila melanogaster OX=7227 GN=shi ... [more]
back to top
BLAST of Dynamin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A260ZXX53.724e-2138.67Dynamin-type G domain-containing protein (Fragment... [more]
A0A087UPJ61.013e-2039.37Dynamin-1 (Fragment) OS=Stegodyphus mimosarum OX=4... [more]
A0A397HSN31.743e-2036.31Uncharacterized protein OS=Diversispora epigaea OX... [more]
A0A267EUG52.508e-2038.46Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GS452.630e-2038.46Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Dynamin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1a2.975e-2034.67dynamin-1 [Source:NCBI gene;Acc:103024863][more]
dnm1a3.039e-2034.67dynamin-1 [Source:NCBI gene;Acc:103024863][more]
dnm1a3.276e-2034.67dynamin-1 [Source:NCBI gene;Acc:103024863][more]
dnm3a8.893e-2035.51dynamin-3 [Source:NCBI gene;Acc:103035811][more]
dnm3a9.041e-2035.51dynamin-3 [Source:NCBI gene;Acc:103035811][more]
back to top
BLAST of Dynamin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006976.11.381e-2035.33pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1... [more]
ENSPMAT00000002816.13.282e-1634.35pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-... [more]
mxb1.329e-1433.61myxovirus (influenza) resistance B [Source:NCBI ge... [more]
opa16.230e-924.81OPA1 mitochondrial dynamin like GTPase [Source:NCB... [more]
opa17.622e-924.81OPA1 mitochondrial dynamin like GTPase [Source:NCB... [more]
back to top
BLAST of Dynamin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
VPS11.953e-1835.38Dynamin-like GTPase required for vacuolar sorting;... [more]
DNM16.217e-1833.86Dynamin-related GTPase involved in mitochondrial o... [more]
MGM11.353e-1328.23Mitochondrial GTPase, present in complex with Ugo1... [more]
back to top
BLAST of Dynamin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO321912.566e-2136.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348953.349e-1832.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403591.468e-724.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002352.24.378e-2137.30pep primary_assembly:ASM223467v1:4:3837959:3851307... [more]
dnm1a1.058e-1934.39dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a1.084e-1934.39dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a1.086e-1934.39dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a1.093e-1934.39dynamin 1 [Source:NCBI gene;Acc:101157793][more]
back to top
BLAST of Dynamin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002033.16.223e-11199.39SMESG000002033.1[more]
SMESG000002199.19.444e-8577.71SMESG000002199.1[more]
SMESG000002124.18.409e-8377.30SMESG000002124.1[more]
SMESG000002211.11.213e-8275.46SMESG000002211.1[more]
SMESG000002124.12.877e-8277.30SMESG000002124.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001478 ID=SMED30001478|Name=Dynamin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=860bp
ATTTTATTAAACTATTTAGAATGTGTGTGTTACTTGGATAATAATTAAAC
TATATAGTATGTTTAATTAGACAATAAAGAATTTATGTGCGACGTACTTT
GAACTAACAACTTTTACATTTAAAACGATTTATTTAAACTATATAGCGTT
TGTATATGTTAAAAAAAACTATATAGTACGTGTGACCTAATGTGAGCCAG
TAAATAATTTCACAATAAATTTTGTTATTTTTCTTAAGTTTTGACCCTTA
TCGATGATTTATCGTGATGTATTGATATTATTATTTTTTTATTCTTTTAG
TACAACACGATGTGTTCAATAATACAATAACAAAGGAGCCCATAACAATC
AGCATCCAGTCCCCTGAAATGGTGACATTGACAATCATTGACTTGCCTGG
CTTGGTCAAGGCAGATGTTCAAGGCCAGGCGAGAGACATGATAAAGAAAA
CACATGAAATAGCAAGGGACTTCATGATGCAAGATAATTCATTAATAATT
TGCGTGCTGCCAGCAAATCAGGACATCTGTACAACGACAACGATTAAGGA
GGCAATTCAATGCAATCCGGACAAATCAAGAATTATTGGCGTGCTTACAA
AGCTCGACAAACTTGATGCAAAGGAAGTTACGACAATTCCGGAAATTATT
GCAAACCGAAAGATGCCAATAGAAAAAGGATATTACGGTTTAATTGTCAG
TGATCAAATTTTGGGACAAACCGATAATAATCAGCGGAGTGAGCTTGAAA
TAAAAATTCTTAAAGATAAAGGATTATGGAAAGTCGAGTAAGAATTCTAT
AACCTTAAAACTTGATATTATAAAGTTGAAAGAAATAATATTGCAATAAA
AGCACCCTGT
back to top

protein sequence of SMED30001478-orf-1

>SMED30001478-orf-1 ID=SMED30001478-orf-1|Name=SMED30001478-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=141bp
MVTLTIIDLPGLVKADVQGQARDMIKKTHEIARDFMMQDNSLIICVLPAN
QDICTTTTIKEAIQCNPDKSRIIGVLTKLDKLDAKEVTTIPEIIANRKMP
IEKGYYGLIVSDQILGQTDNNQRSELEIKILKDKGLWKVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000463cholinergic neuron
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR022812Dynamin_SF
IPR001401Dynamin_GTPase
IPR027417P-loop_NTPase
IPR030381G_DYNAMIN_dom
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
GO:0008017microtubule binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0000266mitochondrial fission
GO:0003374dynamin family protein polymerization involved in mitochondrial fission
GO:0006909phagocytosis
GO:0016049cell growth
GO:0016337single organismal cell-cell adhesion
GO:0031589cell-substrate adhesion
GO:0060151peroxisome localization
GO:0061025membrane fusion
GO:0071476cellular hypotonic response
Vocabulary: cellular component
TermDefinition
GO:0000331contractile vacuole
GO:0005737cytoplasm
GO:0005741mitochondrial outer membrane
GO:0005886plasma membrane
GO:0031143pseudopodium
GO:0045335phagocytic vesicle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..139
e-value: 9.9E-31
score: 108.9
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 3..78
e-value: 1.2E-11
score: 44.9
IPR022812Dynamin superfamilyPANTHERPTHR11566DYNAMINcoord: 2..122
IPR030381Dynamin-type guanine nucleotide-binding (G) domainPROSITEPS51718G_DYNAMIN_2coord: 1..140
score: 16.152
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 3..117