Transcriptional repressor protein YY1B

Overview
NameTranscriptional repressor protein YY1B
Smed IDSMED30001476
Length (bp)2444
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcriptional repressor protein YY1B (SMED30001476) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcriptional repressor protein YY1B (SMED30001476) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcriptional repressor protein YY1B (SMED30001476) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcriptional repressor protein YY1B (SMED30001476) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001476

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30001476 SmedASXL_013090SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30001476 SmedASXL_013090SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30001476 dd_Smed_v4_6684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001476 dd_Smed_v4_6684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001476 dd_Smed_v4_6684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001476 dd_Smed_v4_6684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001476 dd_Smed_v4_6684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30001476SMESG000037910.1 Contig4370newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30001476SMESG000037910.1 Contig4370uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Human
Match: YY1 (YY1 transcription factor [Source:HGNC Symbol;Acc:HGNC:12856])

HSP 1 Score: 228.024 bits (580), Expect = 3.287e-66
Identity = 99/118 (83.90%), Postives = 107/118 (90.68%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  294 RTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 411          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Human
Match: YY2 (YY2 transcription factor [Source:HGNC Symbol;Acc:HGNC:31684])

HSP 1 Score: 205.297 bits (521), Expect = 2.185e-58
Identity = 88/122 (72.13%), Postives = 103/122 (84.43%), Query Frame = 1
Query:  868 GTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            G   + VPC + GC K FRD ++MRKHLH HGPRVH C+ECGKAF+ESSKL+RH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGD+P+ CP+  C + FAQSTNLK+HI TH K K
Sbjct:  248 GEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHLRIHTGDKPFVCPFDVCNRKFAQSTNLKTHILTHVKTK 369          

HSP 2 Score: 52.373 bits (124), Expect = 2.306e-6
Identity = 31/107 (28.97%), Postives = 45/107 (42.06%), Query Frame = 1
Query:  994 KAFVESSKLKRHRLVHTGEKPFQCSFEG---------------------------CGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            K   E +K+K  R      K   CS+ G                           CGK F     LR H  +HTG++P+ C + GCGK F+   NL++H++ H  +K
Sbjct:  233 KQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHLRIHTGDK 339          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Human
Match: ZFP42 (ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:HGNC:30949])

HSP 1 Score: 182.57 bits (462), Expect = 5.978e-51
Identity = 81/121 (66.94%), Postives = 99/121 (81.82%), Query Frame = 1
Query:  874 SMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTH-NKNK 1233
            S+ A+ CP  GC++  R+ +++RKHL  HGPR H C+ECGKAFVESSKLKRH LVHTGEKPF+C+FEGCGKRFSLDFNLRTH+RIHTG++ + CP+ GC + F QS NLK+HI TH N NK
Sbjct:  184 SLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHTGEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANTNK 304          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Human
Match: ZFP42 (ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:HGNC:30949])

HSP 1 Score: 182.57 bits (462), Expect = 5.978e-51
Identity = 81/121 (66.94%), Postives = 99/121 (81.82%), Query Frame = 1
Query:  874 SMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTH-NKNK 1233
            S+ A+ CP  GC++  R+ +++RKHL  HGPR H C+ECGKAFVESSKLKRH LVHTGEKPF+C+FEGCGKRFSLDFNLRTH+RIHTG++ + CP+ GC + F QS NLK+HI TH N NK
Sbjct:  184 SLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHTGEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANTNK 304          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Human
Match: ZFP42 (ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:HGNC:30949])

HSP 1 Score: 182.57 bits (462), Expect = 5.978e-51
Identity = 81/121 (66.94%), Postives = 99/121 (81.82%), Query Frame = 1
Query:  874 SMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTH-NKNK 1233
            S+ A+ CP  GC++  R+ +++RKHL  HGPR H C+ECGKAFVESSKLKRH LVHTGEKPF+C+FEGCGKRFSLDFNLRTH+RIHTG++ + CP+ GC + F QS NLK+HI TH N NK
Sbjct:  184 SLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHTGEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANTNK 304          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 90.1225 bits (222), Expect = 2.539e-19
Identity = 44/122 (36.07%), Postives = 64/122 (52.46%), Query Frame = 1
Query:  892 CPHKGCS---KAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTL 1245
            C  KGC    K F+    +  H+  H G R   C  C K F  S  LK H+ +H+GEKPFQC+  GC K F+   + + H+ +H+  +PY+C Y  CGK +   ++L+ H + H   K   L
Sbjct:  121 CLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDVCNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHENEKKSQL 242          

HSP 2 Score: 51.6026 bits (122), Expect = 1.069e-6
Identity = 30/91 (32.97%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  970 VHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSL---DFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            +H C   G+    S+ +  + + H  +  F C ++GC + F +    + L  H+R+HTG+RP+ C    C K FA+S NLK H + H+  K
Sbjct:   95 MHVCQNSGEL---STHISSNHITHDSK--FVCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLC--DVCNKVFARSENLKIHKRIHSGEK 178          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 89.3521 bits (220), Expect = 3.370e-19
Identity = 44/122 (36.07%), Postives = 64/122 (52.46%), Query Frame = 1
Query:  892 CPHKGCS---KAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTL 1245
            C  KGC    K F+    +  H+  H G R   C  C K F  S  LK H+ +H+GEKPFQC+  GC K F+   + + H+ +H+  +PY+C Y  CGK +   ++L+ H + H   K   L
Sbjct:  108 CLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDVCNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHENEKKSQL 229          

HSP 2 Score: 51.2174 bits (121), Expect = 1.412e-6
Identity = 30/91 (32.97%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  970 VHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSL---DFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            +H C   G+    S+ +  + + H  +  F C ++GC + F +    + L  H+R+HTG+RP+ C    C K FA+S NLK H + H+  K
Sbjct:   82 MHVCQNSGEL---STHISSNHITHDSK--FVCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLC--DVCNKVFARSENLKIHKRIHSGEK 165          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 89.3521 bits (220), Expect = 3.370e-19
Identity = 44/122 (36.07%), Postives = 64/122 (52.46%), Query Frame = 1
Query:  892 CPHKGCS---KAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTL 1245
            C  KGC    K F+    +  H+  H G R   C  C K F  S  LK H+ +H+GEKPFQC+  GC K F+   + + H+ +H+  +PY+C Y  CGK +   ++L+ H + H   K   L
Sbjct:  108 CLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDVCNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHENEKKSQL 229          

HSP 2 Score: 51.2174 bits (121), Expect = 1.412e-6
Identity = 30/91 (32.97%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  970 VHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSL---DFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            +H C   G+    S+ +  + + H  +  F C ++GC + F +    + L  H+R+HTG+RP+ C    C K FA+S NLK H + H+  K
Sbjct:   82 MHVCQNSGEL---STHISSNHITHDSK--FVCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLC--DVCNKVFARSENLKIHKRIHSGEK 165          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Celegans
Match: fezf-1 (FEZ Family zinc finger protein [Source:UniProtKB/TrEMBL;Acc:O62425])

HSP 1 Score: 85.5001 bits (210), Expect = 1.791e-18
Identity = 50/121 (41.32%), Postives = 70/121 (57.85%), Query Frame = 1
Query:  874 SMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            S +  PC  + C K F  + ++ +H+  H G R   C  CGKAF ++S L RH+++HT  KP +C  + CGK F+    L TH+RIH G +P+ C    CGKGF Q+ N K+H  TH   K
Sbjct:   48 SRKKFPC--EICGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRHKIIHTDSKPHKC--KTCGKCFNRSSTLNTHVRIHQGFKPFVCEI--CGKGFHQNGNYKNHRLTHEDTK 162          

HSP 2 Score: 64.6994 bits (156), Expect = 1.958e-11
Identity = 40/110 (36.36%), Postives = 57/110 (51.82%), Query Frame = 1
Query:  895 PHK--GCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQ 1215
            PHK   C K F  +S++  H+  H G +   C  CGK F ++   K HRL H   K F CS   C + F   +NL  H+  H   +P+TC    C KGF ++ +LK H++
Sbjct:  107 PHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSI--CSRAFHQSYNLAFHMFTHEEHKPFTCHV--CSKGFCRNFDLKKHLR 212          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Celegans
Match: lin-29 (Transcription factor [Source:UniProtKB/TrEMBL;Acc:G5EGB2])

HSP 1 Score: 86.2705 bits (212), Expect = 4.420e-18
Identity = 40/90 (44.44%), Postives = 61/90 (67.78%), Query Frame = 1
Query:  967 RVHECSECGKAFVESSKLKRHRLVHTGEKPF-QCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            + ++C++C KAF  SS L +H  +H G KPF  C++  CGK+F+   +L+ HIR HTG++PY C + GC K F+Q +NL+SH + H  +K
Sbjct:    7 KPYKCTQCVKAFANSSYLSQHMRIHLGIKPFGPCNY--CGKKFTQLSHLQQHIRTHTGEKPYKCKFTGCDKAFSQLSNLQSHSRCHQTDK 94          

HSP 2 Score: 85.1149 bits (209), Expect = 1.358e-17
Identity = 46/116 (39.66%), Postives = 65/116 (56.03%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH------GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKY 1236
            C KAF ++S + +H+  H      GP    C+ CGK F + S L++H   HTGEKP++C F GC K FS   NL++H R H  D+P+ C    C K F    +L  HI  H ++K+
Sbjct:   14 CVKAFANSSYLSQHMRIHLGIKPFGP----CNYCGKKFTQLSHLQQHIRTHTGEKPYKCKFTGCDKAFSQLSNLQSHSRCHQTDKPFKC--NSCYKCFTDEQSLLDHIPKHKESKH 123          

HSP 3 Score: 59.6918 bits (143), Expect = 3.255e-9
Identity = 40/117 (34.19%), Postives = 63/117 (53.85%), Query Frame = 1
Query:  889 PCPHKGCSKAFRDNSSMRKHLHTH-GPRVHEC--SECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGD---RPYTCPYAGCGKGFAQSTNLKSHIQTH 1221
            PC +  C K F   S +++H+ TH G + ++C  + C KAF + S L+ H   H  +KPF+C+   C K F+ + +L  HI  H      + + CP+  CGK + Q T L+ H+  H
Sbjct:   39 PCNY--CGKKFTQLSHLQQHIRTHTGEKPYKCKFTGCDKAFSQLSNLQSHSRCHQTDKPFKCN--SCYKCFTDEQSLLDHIPKHKESKHLKIHICPF--CGKSYTQQTYLQKHMTKH 149          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Fly
Match: pho (gene:FBgn0002521 transcript:FBtr0089204)

HSP 1 Score: 223.787 bits (569), Expect = 5.913e-64
Identity = 103/147 (70.07%), Postives = 120/147 (81.63%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTL---KTFCAPNKISSQSNASCRN 1302
            T+ + + CPHKGC+K FRD+S+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRP+ CP+  C K FAQSTNLKSHI TH K K  T    K+ C+  + +SQS  +  N
Sbjct:  352 TNDKKIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAKAKRNTSISGKSGCSNAESNSQSEDTSAN 498          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Fly
Match: pho (gene:FBgn0002521 transcript:FBtr0089205)

HSP 1 Score: 223.787 bits (569), Expect = 5.913e-64
Identity = 103/147 (70.07%), Postives = 120/147 (81.63%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTL---KTFCAPNKISSQSNASCRN 1302
            T+ + + CPHKGC+K FRD+S+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRP+ CP+  C K FAQSTNLKSHI TH K K  T    K+ C+  + +SQS  +  N
Sbjct:  352 TNDKKIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAKAKRNTSISGKSGCSNAESNSQSEDTSAN 498          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Fly
Match: phol (gene:FBgn0035997 transcript:FBtr0345600)

HSP 1 Score: 203.756 bits (517), Expect = 1.406e-55
Identity = 89/116 (76.72%), Postives = 102/116 (87.93%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYK 1239
            C H+GC+K FR++S+MRKH+HTHGPR H C+ CGK+FVESSKLKRH+LVHTGEKPF+C+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP  GC K FAQSTNLKSH+ TH K K K
Sbjct:  504 CTHRGCNKEFRNHSAMRKHMHTHGPRGHVCNVCGKSFVESSKLKRHQLVHTGEKPFECTFEGCGKRFSLDFNLRTHVRIHTGDRPYHCPIDGCSKCFAQSTNLKSHMLTHTKPKRK 619          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Fly
Match: phol (gene:FBgn0035997 transcript:FBtr0076475)

HSP 1 Score: 203.756 bits (517), Expect = 1.406e-55
Identity = 89/116 (76.72%), Postives = 102/116 (87.93%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYK 1239
            C H+GC+K FR++S+MRKH+HTHGPR H C+ CGK+FVESSKLKRH+LVHTGEKPF+C+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP  GC K FAQSTNLKSH+ TH K K K
Sbjct:  504 CTHRGCNKEFRNHSAMRKHMHTHGPRGHVCNVCGKSFVESSKLKRHQLVHTGEKPFECTFEGCGKRFSLDFNLRTHVRIHTGDRPYHCPIDGCSKCFAQSTNLKSHMLTHTKPKRK 619          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Fly
Match: MTF-1 (gene:FBgn0040305 transcript:FBtr0344236)

HSP 1 Score: 98.5969 bits (244), Expect = 8.740e-21
Identity = 47/119 (39.50%), Postives = 64/119 (53.78%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNK 1227
            T ++   C   GC KAF     +  HL  H      C  C K F   S LK+H   HT E+P++C  + CGK F+   +L+TH R HTG++PY C    C K F+ S +LKSH +TH +
Sbjct:  384 TKVKPYECEVSGCDKAFNTRYRLHAHLRLHNGETFNCELCQKCFTTLSDLKKHMRTHTQERPYKCPEDDCGKAFTASHHLKTHRRTHTGEKPYPCQEDSCQKSFSTSHSLKSHKKTHQR 502          

HSP 2 Score: 84.3445 bits (207), Expect = 2.196e-16
Identity = 49/144 (34.03%), Postives = 68/144 (47.22%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTG---------------------------DRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C ++ C +++    ++R HL TH G    +C E  C KAF+ S  LK H  VHT  KP++C   GC K F+  + L  H+R+H G                           +RPY CP   CGK F  S +LK+H +TH   K
Sbjct:  331 CNYENCYRSYSTIGNLRTHLKTHTGDYSFKCPEDGCHKAFLTSYSLKIHVRVHTKVKPYECEVSGCDKAFNTRYRLHAHLRLHNGETFNCELCQKCFTTLSDLKKHMRTHTQERPYKCPEDDCGKAFTASHHLKTHRRTHTGEK 474          

HSP 3 Score: 62.003 bits (149), Expect = 1.831e-9
Identity = 26/59 (44.07%), Postives = 38/59 (64.41%), Query Frame = 1
Query: 1057 FQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            ++C++E C + +S   NLRTH++ HTGD  + CP  GC K F  S +LK H++ H K K
Sbjct:  329 YRCNYENCYRSYSTIGNLRTHLKTHTGDYSFKCPEDGCHKAFLTSYSLKIHVRVHTKVK 387          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Zebrafish
Match: yy1b (YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2127])

HSP 1 Score: 228.794 bits (582), Expect = 1.960e-67
Identity = 100/118 (84.75%), Postives = 107/118 (90.68%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R + CPHKGCSK FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  234 RTIACPHKGCSKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 351          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Zebrafish
Match: yy1a (YY1 transcription factor a [Source:ZFIN;Acc:ZDB-GENE-030131-1117])

HSP 1 Score: 228.409 bits (581), Expect = 2.543e-67
Identity = 100/120 (83.33%), Postives = 108/120 (90.00%), Query Frame = 1
Query:  874 SMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            S R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  235 SPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 354          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Zebrafish
Match: znf1024 (zinc finger protein 1024 [Source:ZFIN;Acc:ZDB-GENE-050320-62])

HSP 1 Score: 107.457 bits (267), Expect = 1.439e-25
Identity = 57/111 (51.35%), Postives = 75/111 (67.57%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQ-THNKNK 1233
            C K+F  +SS+ KH+  H G R + C++CGK+F +SS L +H L+HTGEKPF C+   CGK FS   NL  H++IHTG+RPYTC    CGK F+QS+NL  H+  TH   K
Sbjct:   88 CGKSFSQSSSLNKHMMIHTGDRPYTCTQCGKSFGQSSNLSKHMLIHTGEKPFTCT--QCGKSFSQSSNLNLHMKIHTGERPYTC--TQCGKSFSQSSNLNLHMMLTHTGEK 194          

HSP 2 Score: 88.9669 bits (219), Expect = 3.217e-19
Identity = 42/106 (39.62%), Postives = 68/106 (64.15%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTH 1221
            C +     ++++ H+  H G +   C++CGK+F +SS L +H ++HTG++P+ C+   CGK F    NL  H+ IHTG++P+TC    CGK F+QS+NL  H++ H
Sbjct:   60 CGQCCEGKANLKIHMRIHTGEKPFTCTQCGKSFSQSSSLNKHMMIHTGDRPYTCT--QCGKSFGQSSNLSKHMLIHTGEKPFTC--TQCGKSFSQSSNLNLHMKIH 161          

HSP 3 Score: 82.4185 bits (202), Expect = 5.842e-17
Identity = 42/85 (49.41%), Postives = 52/85 (61.18%), Query Frame = 1
Query:  979 CSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C++CG+     + LK H  +HTGEKPF C+   CGK FS   +L  H+ IHTGDRPYTC    CGK F QS+NL  H+  H   K
Sbjct:   57 CTQCGQCCEGKANLKIHMRIHTGEKPFTCT--QCGKSFSQSSSLNKHMMIHTGDRPYTC--TQCGKSFGQSSNLSKHMLIHTGEK 137          

HSP 4 Score: 80.1073 bits (196), Expect = 3.676e-16
Identity = 48/113 (42.48%), Postives = 66/113 (58.41%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHR-LVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYK 1239
            C K+F  +S++  H+  H G R + C++CGK+F +SS L  H  L HTGEKPF C+   CGK FS   NL  H++IHTG R + C    C K F  +  LK H ++H    Y+
Sbjct:  144 CGKSFSQSSNLNLHMKIHTGERPYTCTQCGKSFSQSSNLNLHMMLTHTGEKPFTCTH--CGKSFSQLSNLNQHMKIHTGIREHMC--FECEKTFITARELKRHQRSHTARVYR 252          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Zebrafish
Match: si:dkeyp-82h4.3 (si:dkeyp-82h4.3 [Source:ZFIN;Acc:ZDB-GENE-120709-17])

HSP 1 Score: 106.301 bits (264), Expect = 4.576e-25
Identity = 51/110 (46.36%), Postives = 76/110 (69.09%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K+F D+S ++KH+  H G +   C++CGK+F +SS LK+H ++HTGEKPF C+   CGK FS   +L  H+RIHTG++P+TC    CGK F +S++L  H++ H + K
Sbjct:  155 CGKSFCDSSYLKKHMRIHTGEKPFTCTQCGKSFCDSSYLKKHMMIHTGEKPFTCT--QCGKSFSKSSSLYRHMRIHTGEKPFTC--TQCGKSFGRSSSLNKHMRIHTREK 260          

HSP 2 Score: 98.2117 bits (243), Expect = 2.638e-22
Identity = 51/122 (41.80%), Postives = 76/122 (62.30%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            T  + + CP   C K F  +SS+ +H+  H G +   C++CGK+F +SS LK+H  +HTGEKPF C+   CGK F     L+ H+ IHTG++P+TC    CGK F++S++L  H++ H   K
Sbjct:  117 TGEKPLTCPQ--CGKIFSKSSSLYRHMMIHTGEKPFTCTQCGKSFCDSSYLKKHMRIHTGEKPFTCT--QCGKSFCDSSYLKKHMMIHTGEKPFTC--TQCGKSFSKSSSLYRHMRIHTGEK 232          

HSP 3 Score: 85.5001 bits (210), Expect = 6.067e-18
Identity = 41/85 (48.24%), Postives = 58/85 (68.24%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCP 1158
            C K+F D+S ++KH+  H G +   C++CGK+F +SS L RH  +HTGEKPF C+   CGK F    +L  H+RIHT ++P+TCP
Sbjct:  183 CGKSFCDSSYLKKHMMIHTGEKPFTCTQCGKSFSKSSSLYRHMRIHTGEKPFTCT--QCGKSFGRSSSLNKHMRIHTREKPFTCP 265          

HSP 4 Score: 84.7297 bits (208), Expect = 1.173e-17
Identity = 46/97 (47.42%), Postives = 60/97 (61.86%), Query Frame = 1
Query:  979 CSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTL----KTFC 1257
            C++CGK+    SKLK H  +HTGEKPF C+   CGK FS    L  H+RIHTG++P TCP   CGK F++S++L  H+  H   K  T     K+FC
Sbjct:   68 CTQCGKSLASKSKLKTHMRIHTGEKPFTCT--QCGKSFSHSSYLNQHMRIHTGEKPLTCPQ--CGKIFSKSSSLYRHMMIHTGEKPFTCTQCGKSFC 160          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Zebrafish
Match: znf997 (zinc finger protein 997 [Source:ZFIN;Acc:ZDB-GENE-110914-80])

HSP 1 Score: 105.531 bits (262), Expect = 4.598e-25
Identity = 52/110 (47.27%), Postives = 74/110 (67.27%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K+F  +SS+ +H+ TH G +   C++CGK+F +SS L  H  +HTGEKPF C+   CGK FS   +L  H+RIHTG++P+TCP+  CGK F QS++L  H++ H   K
Sbjct:   99 CGKSFSQSSSLNQHMRTHTGEKPFTCTQCGKSFSQSSSLNLHMRIHTGEKPFTCT--QCGKSFSQSSSLNLHVRIHTGEKPFTCPH--CGKSFNQSSHLNCHMKIHTGEK 204          

HSP 2 Score: 98.9821 bits (245), Expect = 9.309e-23
Identity = 50/110 (45.45%), Postives = 70/110 (63.64%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K+F  +SS+  H+  H G +   C++CGK+F +SS L  H  +HTGEKPF C    CGK F+   +L  H++IHTG++P+TCP   CGK F+QS+NL  H+  H   K
Sbjct:  127 CGKSFSQSSSLNLHMRIHTGEKPFTCTQCGKSFSQSSSLNLHVRIHTGEKPFTCPH--CGKSFNQSSHLNCHMKIHTGEKPFTCPQ--CGKSFSQSSNLNCHMTIHTGQK 232          

HSP 3 Score: 94.7449 bits (234), Expect = 2.827e-21
Identity = 48/110 (43.64%), Postives = 69/110 (62.73%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K+F     ++ H+  H G +   C++CGK+F +SS L +H   HTGEKPF C+   CGK FS   +L  H+RIHTG++P+TC    CGK F+QS++L  H++ H   K
Sbjct:   71 CEKSFGRKDDLKFHMMIHAGEKPFTCTQCGKSFSQSSSLNQHMRTHTGEKPFTCT--QCGKSFSQSSSLNLHMRIHTGEKPFTC--TQCGKSFSQSSSLNLHVRIHTGEK 176          

HSP 4 Score: 79.337 bits (194), Expect = 5.789e-16
Identity = 38/85 (44.71%), Postives = 54/85 (63.53%), Query Frame = 1
Query:  979 CSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C++C K+F     LK H ++H GEKPF C+   CGK FS   +L  H+R HTG++P+TC    CGK F+QS++L  H++ H   K
Sbjct:   68 CTQCEKSFGRKDDLKFHMMIHAGEKPFTCT--QCGKSFSQSSSLNQHMRTHTGEKPFTC--TQCGKSFSQSSSLNLHMRIHTGEK 148          

HSP 5 Score: 77.0258 bits (188), Expect = 2.998e-15
Identity = 40/84 (47.62%), Postives = 51/84 (60.71%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTC 1155
            C K+F  +SS+  H+  H G +   C  CGK+F +SS L  H  +HTGEKPF C    CGK FS   NL  H+ IHTG +P+TC
Sbjct:  155 CGKSFSQSSSLNLHVRIHTGEKPFTCPHCGKSFNQSSHLNCHMKIHTGEKPFTCP--QCGKSFSQSSNLNCHMTIHTGQKPFTC 236          

HSP 6 Score: 53.9138 bits (128), Expect = 1.797e-7
Identity = 27/67 (40.30%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCS 1068
            T  +   CPH  C K+F  +S +  H+  H G +   C +CGK+F +SS L  H  +HTG+KPF C+
Sbjct:  173 TGEKPFTCPH--CGKSFNQSSHLNCHMKIHTGEKPFTCPQCGKSFSQSSNLNCHMTIHTGQKPFTCT 237          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Xenopus
Match: hcn1 (hyperpolarization activated cyclic nucleotide gated potassium channel 1 [Source:Xenbase;Acc:XB-GENE-950265])

HSP 1 Score: 228.024 bits (580), Expect = 7.955e-67
Identity = 99/118 (83.90%), Postives = 107/118 (90.68%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  252 RTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 369          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Xenopus
Match: znf143 (zinc finger protein 143 [Source:NCBI gene;Acc:595042])

HSP 1 Score: 119.013 bits (297), Expect = 2.571e-27
Identity = 56/124 (45.16%), Postives = 75/124 (60.48%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            T  R   C H GC KAF     ++ H+ TH G + + CSE  C K+F  S  L++H   HTGE+PF+C FEGCG+ F+     + HIR HTG+RPY C   GCG+ FA +TN K+H++ H   K
Sbjct:  229 TGDRPYQCDHGGCRKAFATGYGLKSHVRTHTGEKPYRCSEENCTKSFKTSGDLQKHVRTHTGERPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYYCSEPGCGRAFASATNYKNHVRIHTGEK 352          

HSP 2 Score: 82.4185 bits (202), Expect = 1.114e-15
Identity = 33/82 (40.24%), Postives = 50/82 (60.98%), Query Frame = 1
Query:  988 CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            CGK +  +  LK H   HTG++P+QC   GC K F+  + L++H+R HTG++PY C    C K F  S +L+ H++TH   +
Sbjct:  211 CGKLYTTAHHLKVHERSHTGDRPYQCDHGGCRKAFATGYGLKSHVRTHTGEKPYRCSEENCTKSFKTSGDLQKHVRTHTGER 292          

HSP 3 Score: 77.7962 bits (190), Expect = 3.873e-14
Identity = 33/64 (51.56%), Postives = 42/64 (65.62%), Query Frame = 1
Query: 1042 TGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            T EK F+C +EGCGK ++   +L+ H R HTGDRPY C + GC K FA    LKSH++TH   K
Sbjct:  199 TNEKAFRCDYEGCGKLYTTAHHLKVHERSHTGDRPYQCDHGGCRKAFATGYGLKSHVRTHTGEK 262          

HSP 4 Score: 59.3066 bits (142), Expect = 1.931e-8
Identity = 39/124 (31.45%), Postives = 54/124 (43.55%), Query Frame = 1
Query:  865 TGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQT-HNKNK 1233
            T T  R   C   GC                           G+AF  ++  K H  +HTGEKP+ C+  GC KRF+   +L  H  +HT  +PY C +  CGK + Q + L  H +T HN  +
Sbjct:  317 THTGERPYYCSEPGC---------------------------GRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNH--CGKTYKQISTLAMHKRTAHNDTE 411          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Xenopus
Match: znf143 (zinc finger protein 143 [Source:NCBI gene;Acc:595042])

HSP 1 Score: 119.013 bits (297), Expect = 2.641e-27
Identity = 56/124 (45.16%), Postives = 75/124 (60.48%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            T  R   C H GC KAF     ++ H+ TH G + + CSE  C K+F  S  L++H   HTGE+PF+C FEGCG+ F+     + HIR HTG+RPY C   GCG+ FA +TN K+H++ H   K
Sbjct:  229 TGDRPYQCDHGGCRKAFATGYGLKSHVRTHTGEKPYRCSEENCTKSFKTSGDLQKHVRTHTGERPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYYCSEPGCGRAFASATNYKNHVRIHTGEK 352          

HSP 2 Score: 82.4185 bits (202), Expect = 1.205e-15
Identity = 33/82 (40.24%), Postives = 50/82 (60.98%), Query Frame = 1
Query:  988 CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            CGK +  +  LK H   HTG++P+QC   GC K F+  + L++H+R HTG++PY C    C K F  S +L+ H++TH   +
Sbjct:  211 CGKLYTTAHHLKVHERSHTGDRPYQCDHGGCRKAFATGYGLKSHVRTHTGEKPYRCSEENCTKSFKTSGDLQKHVRTHTGER 292          

HSP 3 Score: 77.411 bits (189), Expect = 4.299e-14
Identity = 33/64 (51.56%), Postives = 42/64 (65.62%), Query Frame = 1
Query: 1042 TGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            T EK F+C +EGCGK ++   +L+ H R HTGDRPY C + GC K FA    LKSH++TH   K
Sbjct:  199 TNEKAFRCDYEGCGKLYTTAHHLKVHERSHTGDRPYQCDHGGCRKAFATGYGLKSHVRTHTGEK 262          

HSP 4 Score: 59.3066 bits (142), Expect = 2.104e-8
Identity = 39/124 (31.45%), Postives = 54/124 (43.55%), Query Frame = 1
Query:  865 TGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQT-HNKNK 1233
            T T  R   C   GC                           G+AF  ++  K H  +HTGEKP+ C+  GC KRF+   +L  H  +HT  +PY C +  CGK + Q + L  H +T HN  +
Sbjct:  317 THTGERPYYCSEPGC---------------------------GRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNH--CGKTYKQISTLAMHKRTAHNDTE 411          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Xenopus
Match: znf143 (zinc finger protein 143 [Source:NCBI gene;Acc:595042])

HSP 1 Score: 119.013 bits (297), Expect = 3.507e-27
Identity = 56/124 (45.16%), Postives = 75/124 (60.48%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            T  R   C H GC KAF     ++ H+ TH G + + CSE  C K+F  S  L++H   HTGE+PF+C FEGCG+ F+     + HIR HTG+RPY C   GCG+ FA +TN K+H++ H   K
Sbjct:  252 TGDRPYQCDHGGCRKAFATGYGLKSHVRTHTGEKPYRCSEENCTKSFKTSGDLQKHVRTHTGERPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYYCSEPGCGRAFASATNYKNHVRIHTGEK 375          

HSP 2 Score: 82.4185 bits (202), Expect = 1.189e-15
Identity = 33/82 (40.24%), Postives = 50/82 (60.98%), Query Frame = 1
Query:  988 CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            CGK +  +  LK H   HTG++P+QC   GC K F+  + L++H+R HTG++PY C    C K F  S +L+ H++TH   +
Sbjct:  234 CGKLYTTAHHLKVHERSHTGDRPYQCDHGGCRKAFATGYGLKSHVRTHTGEKPYRCSEENCTKSFKTSGDLQKHVRTHTGER 315          

HSP 3 Score: 77.7962 bits (190), Expect = 4.047e-14
Identity = 33/64 (51.56%), Postives = 42/64 (65.62%), Query Frame = 1
Query: 1042 TGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            T EK F+C +EGCGK ++   +L+ H R HTGDRPY C + GC K FA    LKSH++TH   K
Sbjct:  222 TNEKAFRCDYEGCGKLYTTAHHLKVHERSHTGDRPYQCDHGGCRKAFATGYGLKSHVRTHTGEK 285          

HSP 4 Score: 59.3066 bits (142), Expect = 1.851e-8
Identity = 39/124 (31.45%), Postives = 54/124 (43.55%), Query Frame = 1
Query:  865 TGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQT-HNKNK 1233
            T T  R   C   GC                           G+AF  ++  K H  +HTGEKP+ C+  GC KRF+   +L  H  +HT  +PY C +  CGK + Q + L  H +T HN  +
Sbjct:  340 THTGERPYYCSEPGC---------------------------GRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNH--CGKTYKQISTLAMHKRTAHNDTE 434          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Xenopus
Match: ENSXETT00000054826.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:29631359:29689376:1 gene:ENSXETG00000018645.1 transcript:ENSXETT00000054826.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 3.087e-23
Identity = 53/112 (47.32%), Postives = 77/112 (68.75%), Query Frame = 1
Query:  901 KGCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            K C K+F     ++KHL  H G + + C+ECG++F  +  L+RH++VHTGEKPF C  + CGK FS+  +L+ H+RIHTG++P+TC    CGK F+Q +NL+SH +TH   K
Sbjct:  346 KECGKSFSLKKGLQKHLPMHTGEKPYACTECGRSFSLNCSLRRHQMVHTGEKPFHC--KECGKSFSIKNDLQKHVRIHTGEKPFTC--TQCGKCFSQKSNLQSHSKTHTGEK 453          

HSP 2 Score: 85.1149 bits (209), Expect = 1.582e-16
Identity = 45/110 (40.91%), Postives = 62/110 (56.36%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C+K F     ++KH+  H G +   C+ECGK F   ++L  H+  HT EKPF C+   CG  FSL   L  H RIHTG++P+TC    CGK F+    L+ H++ H   K
Sbjct:  208 CAKTFSIKEELQKHMWMHSGEKPFACTECGKCFPLKNRLTAHQRTHTAEKPFTCT--ECGISFSLKSRLNIHQRIHTGEKPFTC--TECGKSFSMKNKLQKHVRIHTGEK 313          

HSP 3 Score: 85.1149 bits (209), Expect = 1.638e-16
Identity = 48/123 (39.02%), Postives = 71/123 (57.72%), Query Frame = 1
Query:  865 TGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            T T+ +   C   G S + +   ++ + +HT G +   C+ECGK+F   +KL++H  +HTGEKPF C+   CG+ FSL   L  H RIHTG++P+TC    CGK F+    L+ H+  H   K
Sbjct:  252 THTAEKPFTCTECGISFSLKSRLNIHQRIHT-GEKPFTCTECGKSFSMKNKLQKHVRIHTGEKPFTCT--ECGRSFSLKSRLIAHQRIHTGEKPFTC--KECGKSFSLKKGLQKHLPMHTGEK 369          

HSP 4 Score: 78.5666 bits (192), Expect = 1.879e-14
Identity = 42/110 (38.18%), Postives = 64/110 (58.18%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K+F   SS+  H   H G +   C+ECG++F   ++L +H+ +H+GEKPF CS   C K FS+   L+ H+ +H+G++P+ C    CGK F     L +H +TH   K
Sbjct:  152 CGKSFCHKSSLIAHERAHKGEKPFTCAECGRSFTIKNRLTKHQKMHSGEKPFVCS--ECAKTFSIKEELQKHMWMHSGEKPFAC--TECGKCFPLKNRLTAHQRTHTAEK 257          

HSP 5 Score: 68.9366 bits (167), Expect = 2.017e-11
Identity = 41/113 (36.28%), Postives = 61/113 (53.98%), Query Frame = 1
Query:  901 KGCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTG-----DRPYTCPYAGCGKGFAQSTNLKSHIQTH 1221
            K C K+F   + ++KH+  H G +   C++CGK F + S L+ H   HTGEKPF C    C K FS   +LR H + H+      ++P+ C    CG+GF+    L+ H + H
Sbjct:  402 KECGKSFSIKNDLQKHVRIHTGEKPFTCTQCGKCFSQKSNLQSHSKTHTGEKPFTCP--QCAKCFSHKCSLRKHQKSHSNPKPPIEKPFQC--GQCGRGFSYKFTLRKHQKIH 510          

HSP 6 Score: 68.5514 bits (166), Expect = 2.484e-11
Identity = 36/95 (37.89%), Postives = 54/95 (56.84%), Query Frame = 1
Query:  949 LHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            LHT G +   C+ECGK+F   S L  H   H GEKPF C+   CG+ F++   L  H ++H+G++P+ C  + C K F+    L+ H+  H+  K
Sbjct:  140 LHT-GEKPFSCTECGKSFCHKSSLIAHERAHKGEKPFTCA--ECGRSFTIKNRLTKHQKMHSGEKPFVC--SECAKTFSIKEELQKHMWMHSGEK 229          

HSP 7 Score: 56.225 bits (134), Expect = 1.821e-7
Identity = 30/68 (44.12%), Postives = 39/68 (57.35%), Query Frame = 1
Query: 1030 RLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            RL+HTGEKPF C+   CGK F    +L  H R H G++P+TC  A CG+ F     L  H + H+  K
Sbjct:  138 RLLHTGEKPFSCT--ECGKSFCHKSSLIAHERAHKGEKPFTC--AECGRSFTIKNRLTKHQKMHSGEK 201          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Mouse
Match: Yy1 (YY1 transcription factor [Source:MGI Symbol;Acc:MGI:99150])

HSP 1 Score: 227.639 bits (579), Expect = 2.351e-66
Identity = 99/118 (83.90%), Postives = 107/118 (90.68%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  294 RTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 411          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Mouse
Match: Mbtps2 (membrane-bound transcription factor peptidase, site 2 [Source:MGI Symbol;Acc:MGI:2444506])

HSP 1 Score: 214.157 bits (544), Expect = 8.548e-62
Identity = 93/122 (76.23%), Postives = 105/122 (86.07%), Query Frame = 1
Query:  868 GTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            G   R + C HKGC K F+DNS+MRKHLH HGPRVH C+ECGKAFVESSKLKRH+LVHTGEKP+QC+FEGCG+RFSLDFNLRTH+RIHTGD+P+ CP+  C K FAQSTNLKSHI TH KNK
Sbjct:  254 GDFPRPIACSHKGCEKMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSLDFNLRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKNK 375          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Mouse
Match: Yy2 (Yy2 transcription factor [Source:MGI Symbol;Acc:MGI:3837947])

HSP 1 Score: 214.157 bits (544), Expect = 8.548e-62
Identity = 93/122 (76.23%), Postives = 105/122 (86.07%), Query Frame = 1
Query:  868 GTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            G   R + C HKGC K F+DNS+MRKHLH HGPRVH C+ECGKAFVESSKLKRH+LVHTGEKP+QC+FEGCG+RFSLDFNLRTH+RIHTGD+P+ CP+  C K FAQSTNLKSHI TH KNK
Sbjct:  254 GDFPRPIACSHKGCEKMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSLDFNLRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKNK 375          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Mouse
Match: Zfp42 (zinc finger protein 42 [Source:MGI Symbol;Acc:MGI:99187])

HSP 1 Score: 180.259 bits (456), Expect = 1.388e-50
Identity = 79/117 (67.52%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  877 MRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNK 1227
            +  + CP  GC K  RD +++RKH+  HGPR H C+ECGKAF ESSKLKRH LVHTGEKP+QC+FEGCGKRFSLDFNLRTHIRIHTG+R + CP+ GC K F QS N K HI TH K
Sbjct:  167 LSMLECPQAGCKKKLRDKTALRKHMLVHGPRRHVCAECGKAFTESSKLKRHFLVHTGEKPYQCTFEGCGKRFSLDFNLRTHIRIHTGERRFVCPFDGCEKSFIQSNNQKIHILTHAK 283          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Mouse
Match: Zfp42 (zinc finger protein 42 [Source:MGI Symbol;Acc:MGI:99187])

HSP 1 Score: 180.259 bits (456), Expect = 1.388e-50
Identity = 79/117 (67.52%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  877 MRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNK 1227
            +  + CP  GC K  RD +++RKH+  HGPR H C+ECGKAF ESSKLKRH LVHTGEKP+QC+FEGCGKRFSLDFNLRTHIRIHTG+R + CP+ GC K F QS N K HI TH K
Sbjct:  167 LSMLECPQAGCKKKLRDKTALRKHMLVHGPRRHVCAECGKAFTESSKLKRHFLVHTGEKPYQCTFEGCGKRFSLDFNLRTHIRIHTGERRFVCPFDGCEKSFIQSNNQKIHILTHAK 283          
BLAST of Transcriptional repressor protein YY1B vs. UniProt/SwissProt
Match: sp|P25490|TYY1_HUMAN (Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2)

HSP 1 Score: 228.024 bits (580), Expect = 1.579e-65
Identity = 99/118 (83.90%), Postives = 107/118 (90.68%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  294 RTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 411          
BLAST of Transcriptional repressor protein YY1B vs. UniProt/SwissProt
Match: sp|Q00899|TYY1_MOUSE (Transcriptional repressor protein YY1 OS=Mus musculus OX=10090 GN=Yy1 PE=1 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 1.644e-65
Identity = 99/118 (83.90%), Postives = 107/118 (90.68%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  294 RTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 411          
BLAST of Transcriptional repressor protein YY1B vs. UniProt/SwissProt
Match: sp|Q8ST83|PHO_DROME (Polycomb protein PHO OS=Drosophila melanogaster OX=7227 GN=pho PE=1 SV=2)

HSP 1 Score: 223.787 bits (569), Expect = 5.927e-63
Identity = 103/147 (70.07%), Postives = 120/147 (81.63%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTL---KTFCAPNKISSQSNASCRN 1302
            T+ + + CPHKGC+K FRD+S+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRP+ CP+  C K FAQSTNLKSHI TH K K  T    K+ C+  + +SQS  +  N
Sbjct:  352 TNDKKIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAKAKRNTSISGKSGCSNAESNSQSEDTSAN 498          
BLAST of Transcriptional repressor protein YY1B vs. UniProt/SwissProt
Match: sp|Q2FAY8|TYY2_RATRT (Transcription factor YY2 OS=Rattus rattus OX=10117 GN=Yy2 PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.756e-61
Identity = 94/122 (77.05%), Postives = 105/122 (86.07%), Query Frame = 1
Query:  868 GTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            G   R V C HKGC K F+DNS+MRKHLH HGPRVH C+ECGKAFVESSKLKRH+LVHTGEKP+QC+FEGCG+RFSLDFNLRTH+RIHTGD+P+ CP+  C K FAQSTNLKSHI TH KNK
Sbjct:  252 GDFPRPVACSHKGCGKMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSLDFNLRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKNK 373          
BLAST of Transcriptional repressor protein YY1B vs. UniProt/SwissProt
Match: sp|P0C6P6|TYY2_RAT (Transcription factor YY2 OS=Rattus norvegicus OX=10116 GN=Yy2 PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.959e-61
Identity = 94/122 (77.05%), Postives = 105/122 (86.07%), Query Frame = 1
Query:  868 GTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            G   R V C HKGC K F+DNS+MRKHLH HGPRVH C+ECGKAFVESSKLKRH+LVHTGEKP+QC+FEGCG+RFSLDFNLRTH+RIHTGD+P+ CP+  C K FAQSTNLKSHI TH KNK
Sbjct:  252 GDFPRPVACSHKGCGKMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSLDFNLRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKNK 373          
BLAST of Transcriptional repressor protein YY1B vs. TrEMBL
Match: A0A5J6BW24 (Transcriptional repressor protein YY1B OS=Dugesia japonica OX=6161 GN=yy1B PE=2 SV=1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 381/510 (74.71%), Postives = 424/510 (83.14%), Query Frame = 1
Query:   55 MNISXXXXXXXXXXXXXSEDIALDPLENPLMNLETFQIPNDSQDENCHDYXXXXXXXXXTNNVFLCEGIDVCREEIIENSVTINNTLNHNDLINDFSSKNGINEYFSDCKEFSXXXXXXXXXXXXXXLNSVKLRKKPMVSINDSLIKSSMLKSESTLSNCAIDIVNLPFPKNNRYIRNYPNEFSKIIIKTEPNSSSFNEIFRNSGISNQRSNPLLNLKKERRVMSYDHGHVFTKXXXXXXXXXXXXXXXXXXXXXQHRRRRRTVESMQYGTGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTLKTFCAPNKISSQSNASCRNSN-----LIDEQQLTAPISGQLRRLNXXXXXXXXXXXRELRVQKRSAVQQVDMNCLDSS-GMMLHQN--------NGASGTTGTKGESLPLDEA 1542
            MNISDFFNFNDQFLDDDSEDI LDPLENPLMNL+TFQIPNDSQDENCHDYVDE V ++ TNNVFLCEGIDVCREEIIENS T  N +N+ND+ ND++ K+GI EYFS+CK+F V    +D        N+VK RKK + S NDSLIKSS++KSES++SNCA+DI+N PF KN RY RNYPNE SKII KTEPNS+ F  +     IS+QRSN LLNLKKERR+MS+DHGH FTKEDVLEDDDDELPDDPVAP  PQHRRRRRTV+SMQYGT +SMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTLKTFC+PNKIS+ S+ +  N+      +IDE    +  + QLRRLNSSQGSSSSSSSRELR+QKR++V  V+ NCLDSS G++LH           G   + G  G SLP+DEA
Sbjct:    1 MNISDFFNFNDQFLDDDSEDIVLDPLENPLMNLDTFQIPNDSQDENCHDYVDEVVDED-TNNVFLCEGIDVCREEIIENSATTGNAINNNDM-NDYNLKHGI-EYFSECKDFPVYNYNDDYSIS----NNVKSRKK-IGSANDSLIKSSIIKSESSISNCAVDIINFPFSKNTRYFRNYPNEVSKIIFKTEPNSAVFRPV-----ISDQRSNGLLNLKKERRLMSFDHGHEFTKEDVLEDDDDELPDDPVAPAAPQHRRRRRTVDSMQYGTSSSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTLKTFCSPNKISNNSSNNNNNNCRNSNVVIDEHTPVSGATTQLRRLNSSQGSSSSSSSRELRLQKRASV-DVEGNCLDSSPGILLHHQSSTVGGGGGGTVSSGGGGGVSLPIDEA 496          
BLAST of Transcriptional repressor protein YY1B vs. TrEMBL
Match: A0A1S3I7S2 (transcriptional repressor protein YY1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106161829 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.581e-66
Identity = 103/125 (82.40%), Postives = 111/125 (88.80%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTLKTF 1254
            R VPCPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K +   TF
Sbjct:  218 RTVPCPHKGCNKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNQPTYTF 342          
BLAST of Transcriptional repressor protein YY1B vs. TrEMBL
Match: R7VAY4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_223122 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 4.087e-66
Identity = 107/152 (70.39%), Postives = 123/152 (80.92%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTLKTFCAPNKISSQSNASCRNSNLIDEQQLTA 1335
            R VPCPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K +   T     +I+  S+ +     ++++ QL A
Sbjct:  229 RTVPCPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKQKNQPAYTL---QQIT--SDGTIVQGGVVEQVQLQA 375          
BLAST of Transcriptional repressor protein YY1B vs. TrEMBL
Match: K1R389 (Transcriptional repressor protein YY1 OS=Crassostrea gigas OX=29159 GN=CGI_10027862 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 4.325e-66
Identity = 104/129 (80.62%), Postives = 114/129 (88.37%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTLKTFCAPN 1266
            R VPCPHKGCSK FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K + + T+  P+
Sbjct:  224 RTVPCPHKGCSKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNQAI-TYQPPS 351          
BLAST of Transcriptional repressor protein YY1B vs. TrEMBL
Match: A0A1S3IA78 (transcriptional repressor protein YY1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106161829 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 5.941e-66
Identity = 103/125 (82.40%), Postives = 111/125 (88.80%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTLKTF 1254
            R VPCPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K +   TF
Sbjct:  231 RTVPCPHKGCNKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNQPTYTF 355          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Cavefish
Match: yy1a (transcriptional repressor protein YY1-like [Source:NCBI gene;Acc:103039658])

HSP 1 Score: 227.639 bits (579), Expect = 3.897e-67
Identity = 100/120 (83.33%), Postives = 108/120 (90.00%), Query Frame = 1
Query:  874 SMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            S R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  236 SPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 355          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Cavefish
Match: yy1b (YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2127])

HSP 1 Score: 227.639 bits (579), Expect = 5.388e-67
Identity = 99/118 (83.90%), Postives = 107/118 (90.68%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  249 RTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 366          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Cavefish
Match: znf143a (zinc finger protein 143a [Source:ZFIN;Acc:ZDB-GENE-041114-154])

HSP 1 Score: 110.923 bits (276), Expect = 1.048e-24
Identity = 50/117 (42.74%), Postives = 70/117 (59.83%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C   GC K F     ++ H+ TH G + + C E  C K+F  S  L++H  +HTGEKPF C +EGCG+ F+     + H+R HTG+RPY CP  GC + FA +TN K+HI+ H   +
Sbjct:  270 CDKPGCGKKFATGYGLKSHIRTHTGEKPYCCQELNCKKSFKTSGDLQKHTRIHTGEKPFMCPYEGCGRSFTTSNICKVHVRTHTGERPYHCPEPGCDRAFASATNYKNHIRIHTGER 386          

HSP 2 Score: 88.5817 bits (218), Expect = 9.937e-18
Identity = 39/68 (57.35%), Postives = 47/68 (69.12%), Query Frame = 1
Query: 1030 RLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R V +GEK FQCS+EGCGK ++   +L+ H RIHTGD+PY C   GCGK FA    LKSHI+TH   K
Sbjct:  229 RAVQSGEKSFQCSYEGCGKLYTTAHHLKVHERIHTGDKPYCCDKPGCGKKFATGYGLKSHIRTHTGEK 296          

HSP 3 Score: 84.7297 bits (208), Expect = 1.532e-16
Identity = 38/93 (40.86%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  961 GPRVHECS--ECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            G +  +CS   CGK +  +  LK H  +HTG+KP+ C   GCGK+F+  + L++HIR HTG++PY C    C K F  S +L+ H + H   K
Sbjct:  234 GEKSFQCSYEGCGKLYTTAHHLKVHERIHTGDKPYCCDKPGCGKKFATGYGLKSHIRTHTGEKPYCCQELNCKKSFKTSGDLQKHTRIHTGEK 326          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Cavefish
Match: znf143b (zinc finger protein 143b [Source:NCBI gene;Acc:393954])

HSP 1 Score: 107.842 bits (268), Expect = 6.792e-24
Identity = 51/117 (43.59%), Postives = 69/117 (58.97%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C H GC K F     ++ H+ TH G + + C E  C K+F  S  L++H   HTGEKPF+C FE CG+ F+     + HIR HTG+RPY C    CG+ FA +TN K+H++ H   K
Sbjct:  222 CDHLGCGKKFATGYGLKSHVRTHTGEKPYRCQELNCCKSFKTSGDLQKHTRTHTGEKPFKCPFEACGRSFTTSNIRKVHIRTHTGERPYYCSEPNCGRTFASATNYKNHMRIHTGEK 338          

HSP 2 Score: 83.5741 bits (205), Expect = 3.313e-16
Identity = 39/99 (39.39%), Postives = 54/99 (54.55%), Query Frame = 1
Query:  964 PRVHECSE---------CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            PRV    E         CGK +  +  LK H   HTG+KP+ C   GCGK+F+  + L++H+R HTG++PY C    C K F  S +L+ H +TH   K
Sbjct:  180 PRVQHIGEKSFRCEHEGCGKLYTTAHHLKVHERSHTGDKPYICDHLGCGKKFATGYGLKSHVRTHTGEKPYRCQELNCCKSFKTSGDLQKHTRTHTGEK 278          

HSP 3 Score: 82.4185 bits (202), Expect = 7.975e-16
Identity = 36/80 (45.00%), Postives = 50/80 (62.50%), Query Frame = 1
Query:  994 KAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            K  ++  + +  R+ H GEK F+C  EGCGK ++   +L+ H R HTGD+PY C + GCGK FA    LKSH++TH   K
Sbjct:  169 KIVLQGQESRSPRVQHIGEKSFRCEHEGCGKLYTTAHHLKVHERSHTGDKPYICDHLGCGKKFATGYGLKSHVRTHTGEK 248          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Cavefish
Match: ENSAMXT00000052240.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:14671567:14672574:1 gene:ENSAMXG00000038905.1 transcript:ENSAMXT00000052240.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 9.329e-24
Identity = 52/122 (42.62%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            + ++   CPH  C+K F   +S+++H   H G + ++CS+CGK+F++   LK+H+ VHTGEKP+QC F  CG+ F+    L  H R HTG+RPY C  + CGK F Q ++L+ H +TH+  K
Sbjct:  115 SGVKPYECPH--CAKTFTHKNSLQRHKRVHTGEKPYDCSDCGKSFIDKGHLKKHQRVHTGEKPYQCGF--CGRSFAQQSYLHQHHRTHTGERPYYC--SECGKSFTQLSSLQLHQRTHSGEK 230          

HSP 2 Score: 92.0485 bits (227), Expect = 4.884e-20
Identity = 51/124 (41.13%), Postives = 72/124 (58.06%), Query Frame = 1
Query:  865 TGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            T T  R   C H  C K+F   +S+++H   H G + +EC  C K F   + L+RH+ VHTGEKP+ CS   CGK F    +L+ H R+HTG++PY C +  CG+ FAQ + L  H +TH   +
Sbjct:   85 THTGERPFDCSH--CGKSFTHRNSLQRHQLIHSGVKPYECPHCAKTFTHKNSLQRHKRVHTGEKPYDCS--DCGKSFIDKGHLKKHQRVHTGEKPYQCGF--CGRSFAQQSYLHQHHRTHTGER 202          

HSP 3 Score: 88.5817 bits (218), Expect = 6.838e-19
Identity = 45/106 (42.45%), Postives = 67/106 (63.21%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTH 1221
            C ++F   S + +H  TH G R + CSECGK+F + S L+ H+  H+GEKPF C+  GCG  F+   +L+ H   HTG++PY C +  CG+ F + +NL+ H +TH
Sbjct:  181 CGRSFAQQSYLHQHHRTHTGERPYYCSECGKSFTQLSSLQLHQRTHSGEKPFLCA--GCGTSFTHKSSLQRHQLTHTGEKPYECSW--CGRSFTEQSNLQRHQRTH 282          

HSP 4 Score: 87.8113 bits (216), Expect = 1.235e-18
Identity = 45/110 (40.91%), Postives = 66/110 (60.00%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K+F   S +++H HTH G + + C ECG+ F++ S L+ H+  HTGE+PF CS   CGK F+   +L+ H  IH+G +PY CP+  C K F    +L+ H + H   K
Sbjct:   41 CGKSFTQQSDLQRHQHTHSGDKPYHCLECGRGFIQQSDLQLHQRTHTGERPFDCSH--CGKSFTHRNSLQRHQLIHSGVKPYECPH--CAKTFTHKNSLQRHKRVHTGEK 146          

HSP 5 Score: 74.3294 bits (181), Expect = 5.109e-14
Identity = 38/89 (42.70%), Postives = 55/89 (61.80%), Query Frame = 1
Query:  967 RVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R H C+ECGK+F + S L+RH+  H+G+KP+ C  E CG+ F    +L+ H R HTG+RP+ C +  CGK F    +L+ H   H+  K
Sbjct:   34 RTHLCAECGKSFTQQSDLQRHQHTHSGDKPYHC-LE-CGRGFIQQSDLQLHQRTHTGERPFDCSH--CGKSFTHRNSLQRHQLIHSGVK 118          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Sea Lamprey
Match: yy1b (YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2127])

HSP 1 Score: 227.254 bits (578), Expect = 1.886e-67
Identity = 99/119 (83.19%), Postives = 108/119 (90.76%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKY 1236
            R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K+
Sbjct:  252 RTIACPHKGCNKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCSKKFAQSTNLKSHILTHAKAKH 370          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Sea Lamprey
Match: znf143b (zinc finger protein 143b [Source:NCBI gene;Acc:393954])

HSP 1 Score: 112.849 bits (281), Expect = 4.486e-27
Identity = 55/124 (44.35%), Postives = 73/124 (58.87%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            T  R   C    C KAF     ++ HL TH G + + C +  C K F  S  L++H   HTGEKPF+C FEGCG+ F+     + HIR HTG+RPY CP  GCG+GF+ +TN K+H++ H   K
Sbjct:  160 TGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEK 283          

HSP 2 Score: 97.8265 bits (242), Expect = 4.928e-22
Identity = 56/168 (33.33%), Postives = 90/168 (53.57%), Query Frame = 1
Query:  865 TGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHEC--SECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTL----KTFCAPNKISSQSNASCRNSNLIDEQQLTAPISG 1347
            T T  +   CP + C K F+ +  ++KH+ TH G +  +C    CG++F  S+  K H   HTGE+P+ C   GCG+ FS   N + H+RIHTG++PY C   GCGK F + ++L  H   H   K  +     KT+  P+ +++    S    ++  ++Q  A ++G
Sbjct:  188 THTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHTPVKPYSCSNCSKTYRQPSTLATHKR-SAHGGDVPSKRQRIAYLTG 354          

HSP 3 Score: 86.2705 bits (212), Expect = 3.116e-18
Identity = 36/82 (43.90%), Postives = 53/82 (64.63%), Query Frame = 1
Query:  988 CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            CG+ +  +  LK H   HTG++P++C+   CGK FS  + L++H+R HTG++PY CP   C KGF  S +L+ HI+TH   K
Sbjct:  142 CGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEK 223          

HSP 4 Score: 72.4034 bits (176), Expect = 1.140e-13
Identity = 31/64 (48.44%), Postives = 41/64 (64.06%), Query Frame = 1
Query: 1042 TGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            +GEK F C +EGCG+ ++   +L+ H R HTGDRPY C    CGK F+    LKSH++TH   K
Sbjct:  130 SGEKAFHCRYEGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEK 193          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Sea Lamprey
Match: znf143b (zinc finger protein 143b [Source:NCBI gene;Acc:393954])

HSP 1 Score: 112.079 bits (279), Expect = 9.371e-27
Identity = 55/124 (44.35%), Postives = 73/124 (58.87%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            T  R   C    C KAF     ++ HL TH G + + C +  C K F  S  L++H   HTGEKPF+C FEGCG+ F+     + HIR HTG+RPY CP  GCG+GF+ +TN K+H++ H   K
Sbjct:  129 TGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEK 252          

HSP 2 Score: 95.9005 bits (237), Expect = 1.887e-21
Identity = 53/161 (32.92%), Postives = 86/161 (53.42%), Query Frame = 1
Query:  865 TGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHEC--SECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTL----KTFCAPNKISSQSNASCRNSNLIDEQQ 1326
            T T  +   CP + C K F+ +  ++KH+ TH G +  +C    CG++F  S+  K H   HTGE+P+ C   GCG+ FS   N + H+RIHTG++PY C   GCGK F + ++L  H   H   K  +     KT+  P+ +++   ++  +    +E +
Sbjct:  157 THTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHTPVKPYSCSNCSKTYRQPSTLATHKRSAHGDMEATEESE 317          

HSP 3 Score: 85.8853 bits (211), Expect = 4.192e-18
Identity = 36/82 (43.90%), Postives = 53/82 (64.63%), Query Frame = 1
Query:  988 CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            CG+ +  +  LK H   HTG++P++C+   CGK FS  + L++H+R HTG++PY CP   C KGF  S +L+ HI+TH   K
Sbjct:  111 CGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEK 192          

HSP 4 Score: 73.9442 bits (180), Expect = 2.883e-14
Identity = 36/84 (42.86%), Postives = 47/84 (55.95%), Query Frame = 1
Query:  982 SECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            S CG  F +S          +GEK F C +EGCG+ ++   +L+ H R HTGDRPY C    CGK F+    LKSH++TH   K
Sbjct:   79 SVCGHHFCQSMNRASSSGQPSGEKAFHCRYEGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEK 162          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Sea Lamprey
Match: mtf1 (metal-regulatory transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-020424-1])

HSP 1 Score: 101.679 bits (252), Expect = 9.837e-23
Identity = 48/112 (42.86%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTHGPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTH 1221
            C   GC K+F     ++ H   H      C    C K F   S L++H   HTGE+PFQC   GCGK FS+  +LRTH+R HTG+RP+ CP  GC + F+   +LKSH++ H
Sbjct:   68 CGVSGCEKSFNTLYRLKAHQRIHTGNTFNCDSEGCTKFFTTLSDLRKHVRTHTGERPFQCKHSGCGKAFSVSHHLRTHVRTHTGERPFPCPSGGCERAFSSQHSLKSHMKGH 179          

HSP 2 Score: 88.5817 bits (218), Expect = 1.542e-18
Identity = 49/146 (33.56%), Postives = 73/146 (50.00%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSF-----------------------------EGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C ++GC + +    +++ H  TH G     C +  CGKAF+ S   K H  VHT EKPF+C                               EGC K F+   +LR H+R HTG+RP+ C ++GCGK F+ S +L++H++TH   +
Sbjct:    8 CAYEGCERTYSTAGNLKTHEKTHRGEYTFVCEQTGCGKAFLTSYSRKIHVRVHTREKPFECGVSGCEKSFNTLYRLKAHQRIHTGNTFNCDSEGCTKFFTTLSDLRKHVRTHTGERPFQCKHSGCGKAFSVSHHLRTHVRTHTGER 153          

HSP 3 Score: 66.2402 bits (160), Expect = 1.665e-11
Identity = 29/83 (34.94%), Postives = 44/83 (53.01%), Query Frame = 1
Query:  988 CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKY 1236
            C + +  +  LK H   H GE  F C   GCGK F   ++ + H+R+HT ++P+ C  +GC K F     LK+H + H  N +
Sbjct:   13 CERTYSTAGNLKTHEKTHRGEYTFVCEQTGCGKAFLTSYSRKIHVRVHTREKPFECGVSGCEKSFNTLYRLKAHQRIHTGNTF 95          

HSP 4 Score: 57.7658 bits (138), Expect = 6.279e-9
Identity = 24/61 (39.34%), Postives = 37/61 (60.66%), Query Frame = 1
Query: 1051 KPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            K +QC++EGC + +S   NL+TH + H G+  + C   GCGK F  S + K H++ H + K
Sbjct:    4 KRYQCAYEGCERTYSTAGNLKTHEKTHRGEYTFVCEQTGCGKAFLTSYSRKIHVRVHTREK 64          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004838.1 (pep scaffold:Pmarinus_7.0:GL495265:3215:3667:-1 gene:ENSPMAG00000004400.1 transcript:ENSPMAT00000004838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 1.051e-22
Identity = 48/115 (41.74%), Postives = 70/115 (60.87%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTH 1221
            R+ PC    C + F + + +++H  TH G + H C  CG+AF   S L+ HR VHTGE+P+ C  E CG+ F+   NL+ H R HTG+RP+ C    CG+ F   +N+K+H +TH
Sbjct:   13 RSRPCKRSFCERRFEEPAYLKRHERTHAGEKPHRCDACGRAFARRSGLEYHRRVHTGERPYGC--EVCGRAFAQYGNLKVHRRTHTGERPHRCDV--CGRSFTLCSNMKTHQRTH 123          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 82.8037 bits (203), Expect = 1.102e-16
Identity = 43/102 (42.16%), Postives = 60/102 (58.82%), Query Frame = 1
Query:  952 HTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTLKTFC 1257
            +T   + HEC  C + F +++ L+ H   H G KPF C +  CGKRF+   NLRTH R+HTG++PY+C    C K F++  NL +H+ TH K     LK F 
Sbjct:  586 NTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK-----LKPFV 678          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 82.4185 bits (202), Expect = 1.289e-16
Identity = 49/134 (36.57%), Postives = 73/134 (54.48%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTHGP-RVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYK---TLKTFCAPNKISSQ 1281
            C    C + F     + +HL  H   + ++C  C + F     L +H   H+GEKP++C    C K+F++  +L+ HIR HTG++P  C    CGK F +S+NL  HI+TH K KYK     K+F    K++SQ
Sbjct:  740 CLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQK-KYKCSDCSKSFDDLGKLNSQ 868          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 75.485 bits (184), Expect = 9.505e-15
Identity = 43/109 (39.45%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKH-LHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHI 1212
            C + GC KAF   S + +H L  H G R  +C +C K+FV+ S L+RH   H+  KPFQCS+  CGK  +    L+ H   HT  + + CP  GC   F +   L++HI
Sbjct:   51 CDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRHEVTHT--KSFICPEEGCNLRFYKHPQLRAHI 155          

HSP 2 Score: 67.3958 bits (163), Expect = 3.263e-12
Identity = 52/162 (32.10%), Postives = 68/162 (41.98%), Query Frame = 1
Query:  856 QYGTGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHG-PRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHI-----------------------RIHTG-------DRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTLK 1248
            Q      +RA  C    C+K+F   S + +HL+TH   +  +CS CGK      +LKRH + HT  K F C  EGC  RF     LR HI                       R H         + PY C +AGC K F     + S +Q+H KN +  LK
Sbjct:   70 QLSVHQGLRAFQC--DKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTHT--KSFICPEEGCNLRFYKHPQLRAHILSVHLHKLTCPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEF----RIWSQLQSHIKNDHPKLK 223          

HSP 3 Score: 55.0694 bits (131), Expect = 2.674e-8
Identity = 37/132 (28.03%), Postives = 60/132 (45.45%), Query Frame = 1
Query:  841 TVESMQYGTGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTG---EKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRP-YTCPYAGCGKGFAQSTNLKSHIQTHN 1224
            T + ++    T  ++  CP +GC+  F  +  +R H+ +       C  C K+F    +L+ H   H     E P+QC+F GC K F +   L++HI+    D P   CP   C K       L+ H+  H+
Sbjct:  119 TRQQLKRHEVTHTKSFICPEEGCNLRFYKHPQLRAHILSVHLHKLTCPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIK---NDHPKLKCPI--CSKPCVGENGLQMHMIIHD 245          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 67.3958 bits (163), Expect = 5.086e-12
Identity = 37/94 (39.36%), Postives = 46/94 (48.94%), Query Frame = 1
Query:  964 PRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTC--------PYAGCGKGFAQSTNLKSHIQTH 1221
            P    C  CGK F     LK H   HT E+PF CS   CGK F+   + + H  +HTG + Y C        P+ GCGK FA+S  L  H +T 
Sbjct:  566 PANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFKTE 656          

HSP 2 Score: 55.4546 bits (132), Expect = 2.871e-8
Identity = 34/93 (36.56%), Postives = 45/93 (48.39%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFE-------GCGKRFSLDFNLRTHIRIHTGDRPYTCPY 1161
            C K F    +++ HL TH   R   CS CGKAF      KRH  +HTG+K + C  +       GCGK+F+    L  H +  +G R  T  Y
Sbjct:  574 CGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESGRRCITPLY 666          

HSP 3 Score: 51.6026 bits (122), Expect = 4.334e-7
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 1
Query: 1057 FQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            F C    CGK+F+  +NL++H+R HT +RP+ C  + CGK FA+  + K H   H   K
Sbjct:  569 FACDV--CGKKFTRPYNLKSHLRTHTNERPFIC--SICGKAFARQHDRKRHEDLHTGKK 623          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Yeast
Match: SWI5 (Transcription factor that recruits Mediator and Swi/Snf complexes; activates transcription of genes expressed at the M/G1 phase boundary and in G1 phase; required for expression of the HO gene controlling mating type switching; localization to nucleus occurs during G1 and appears to be regulated by phosphorylation by Cdc28p kinase; SWI5 has a paralog, ACE2, that arose from the whole genome duplication [Source:SGD;Acc:S000002553])

HSP 1 Score: 65.855 bits (159), Expect = 1.696e-11
Identity = 26/63 (41.27%), Postives = 40/63 (63.49%), Query Frame = 1
Query: 1048 EKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKY 1236
            +K F+C F GC K F   +N+R+HI+ H  DRPY+C + GC K F ++ +L  H ++H +  Y
Sbjct:  547 DKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEKAY 609          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Nematostella
Match: EDO36763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHM9])

HSP 1 Score: 213.001 bits (541), Expect = 2.300e-65
Identity = 96/115 (83.48%), Postives = 104/115 (90.43%), Query Frame = 1
Query:  886 VPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKN 1230
            + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+  C K FAQSTNLKSHI TH K 
Sbjct:    3 LACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDACNKRFAQSTNLKSHILTHAKG 117          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Nematostella
Match: EDO46628 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPS8])

HSP 1 Score: 110.923 bits (276), Expect = 4.122e-27
Identity = 53/117 (45.30%), Postives = 74/117 (63.25%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            CP +GC K F   S ++ H+ +H G R   C E  CG +F  + KLKRH+  HTGE+PF CS+EGC K F+   +L+TH+ +HTG++PY CP  GCGK F   ++L  H++ H   K
Sbjct:  121 CPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKHTGERPFVCSWEGCHKSFTRSSHLKTHVLVHTGEKPYVCPADGCGKAFTAGSSLNIHLRKHTGEK 237          

HSP 2 Score: 92.4337 bits (228), Expect = 9.483e-21
Identity = 49/121 (40.50%), Postives = 68/121 (56.20%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHN 1224
            T  R   C  +GC  +F     +++H   H G R   CS   C K+F  SS LK H LVHTGEKP+ C  +GCGK F+   +L  H+R HTG++PY C  + C K +  + NL++H + H 
Sbjct:  144 TGERPFSCDEEGCGWSFTSAYKLKRHKRKHTGERPFVCSWEGCHKSFTRSSHLKTHVLVHTGEKPYVCPADGCGKAFTAGSSLNIHLRKHTGEKPYRCEESSCNKAYTTAANLRAHQKRHE 264          

HSP 3 Score: 83.5741 bits (205), Expect = 8.403e-18
Identity = 46/118 (38.98%), Postives = 60/118 (50.85%), Query Frame = 1
Query:  883 AVPCPHKGCSKAFRDNSSMRKHLHTH----GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHN 1224
            ++ C ++GC KAF     +R H   H     P   E   CGK F     L  H   H+GE+P  C  EGC KRF+    L+ HIR HTG+RP++C   GCG  F  +  LK H + H 
Sbjct:   57 SIACNYEGCDKAFPTLHKLRVHERKHELQDKPYKCEVEGCGKVFAAMGVLTSHLKSHSGERPHGCPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKHT 174          

HSP 4 Score: 79.337 bits (194), Expect = 2.826e-16
Identity = 45/123 (36.59%), Postives = 68/123 (55.28%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECS----ECGKAFVESSKLKRHRLVHT-GEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHN 1224
            T  R   CP KGC + F    +++ H+  H  R +  +     C KAF    KL+ H   H   +KP++C  EGCGK F+    L +H++ H+G+RP+ CP  GC K F +++ LK HI++H 
Sbjct:   23 TGERPFACPEKGCGRRFTTAYNLKTHIRAH-RRTNSIACNYEGCDKAFPTLHKLRVHERKHELQDKPYKCEVEGCGKVFAAMGVLTSHLKSHSGERPHGCPVEGCEKRFTKASKLKLHIRSHT 144          

HSP 5 Score: 75.0998 bits (183), Expect = 6.399e-15
Identity = 41/110 (37.27%), Postives = 53/110 (48.18%), Query Frame = 1
Query:  988 CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIH-------------------------------TGDRPYTCPYAGCGKGFAQSTNLKSHIQTHN 1224
            C  AF  + KLKRH   HTGE+PF C  +GCG+RF+  +NL+THIR H                                 D+PY C   GCGK FA    L SH+++H+
Sbjct:    5 CEWAFTTAYKLKRHERGHTGERPFACPEKGCGRRFTTAYNLKTHIRAHRRTNSIACNYEGCDKAFPTLHKLRVHERKHELQDKPYKCEVEGCGKVFAAMGVLTSHLKSHS 114          

HSP 6 Score: 59.3066 bits (142), Expect = 1.445e-9
Identity = 24/53 (45.28%), Postives = 34/53 (64.15%), Query Frame = 1
Query: 1072 EGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKN 1230
            EGC   F+  + L+ H R HTG+RP+ CP  GCG+ F  + NLK+HI+ H + 
Sbjct:    3 EGCEWAFTTAYKLKRHERGHTGERPFACPEKGCGRRFTTAYNLKTHIRAHRRT 55          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Nematostella
Match: EDO25873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDG9])

HSP 1 Score: 102.834 bits (255), Expect = 1.199e-25
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 1
Query:  901 KGCSKAFRDNSSMRKHLHTH-GPRVHEC--SECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            +GC K F     +  HL +H G R H C    C K F ++SKLK H   HTGE+PF C  EGCG  F+  + L+ H R HTG+RP+ C + GC K F +S++LK+H+  H   K
Sbjct:   30 EGCGKVFAAMGVLTSHLKSHSGERPHGCPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKHTGERPFVCSWEGCHKLFTRSSHLKTHVLVHTGEK 143          

HSP 2 Score: 99.3673 bits (246), Expect = 2.317e-24
Identity = 44/92 (47.83%), Postives = 61/92 (66.30%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCP 1158
            CP +GC K F   S ++ H+ +H G R   C E  CG +F  + KLKRH+  HTGE+PF CS+EGC K F+   +L+TH+ +HTG++PY CP
Sbjct:   57 CPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKHTGERPFVCSWEGCHKLFTRSSHLKTHVLVHTGEKPYVCP 148          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Nematostella
Match: EDO26879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAT8])

HSP 1 Score: 108.227 bits (269), Expect = 4.807e-25
Identity = 53/110 (48.18%), Postives = 74/110 (67.27%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K F  + +M++HL  H G + ++C ECG  F ES KLKRH ++HTGEKP +C  + CGKRF+   +L+TH+RIHTG++PY C    CGK F  S N+K H++ H+  K
Sbjct:  260 CGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESGKLKRHLVIHTGEKPHKC--DDCGKRFTQSGDLKTHLRIHTGEKPYEC--DDCGKRFTLSGNMKKHVKIHSGKK 365          

HSP 2 Score: 92.8189 bits (229), Expect = 4.724e-20
Identity = 45/110 (40.91%), Postives = 70/110 (63.64%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K F   + ++ HL  H G + ++C ECGK F + + LK H ++H+G+KP++C  + CGK F+L  +L+TH+ IH+G++PY C    CGK F QS  +K H++ H   K
Sbjct:   92 CGKCFTRKTHLKTHLMVHSGQKPYKCDECGKCFTQHAHLKAHLVIHSGKKPYKC--DECGKCFTLSGDLKTHLVIHSGEKPYEC--DDCGKCFTQSGAMKRHLRIHTGKK 197          

HSP 3 Score: 90.8929 bits (224), Expect = 2.378e-19
Identity = 45/110 (40.91%), Postives = 69/110 (62.73%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K F  ++ ++ HL  H G + ++C ECGK F  S  LK H ++H+GEKP++C  + CGK F+    ++ H+RIHTG +PY C    CG  F++S +LK+H+  H+  K
Sbjct:  120 CGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCFTLSGDLKTHLVIHSGEKPYEC--DDCGKCFTQSGAMKRHLRIHTGKKPYKCDE--CGNCFSESAHLKAHLVIHSGEK 225          

HSP 4 Score: 88.9669 bits (219), Expect = 9.510e-19
Identity = 45/110 (40.91%), Postives = 68/110 (61.82%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K F  +  ++ HL  H G + +EC +CGK F +S  +KRH  +HTG+KP++C  + CG  FS   +L+ H+ IH+G++PY C    CGK F  S +LK+H+  H+  K
Sbjct:  148 CGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKC--DECGNCFSESAHLKAHLVIHSGEKPYKC--DDCGKCFTLSGDLKTHLVIHSGEK 253          

HSP 5 Score: 85.8853 bits (211), Expect = 8.247e-18
Identity = 43/110 (39.09%), Postives = 66/110 (60.00%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C   F +++ ++ HL  H G + ++C +CGK F  S  LK H ++H+GEKP++C  + CGK F+    ++ H+RIHTG +PY C    CG  F++S  LK H+  H   K
Sbjct:  204 CGNCFSESAHLKAHLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEKPYEC--DDCGKCFTQSGAMKRHLRIHTGKKPYKCDE--CGNCFSESGKLKRHLVIHTGEK 309          

HSP 6 Score: 85.1149 bits (209), Expect = 1.759e-17
Identity = 46/116 (39.66%), Postives = 69/116 (59.48%), Query Frame = 1
Query:  895 PHKG--CSKAFRDNSSMRKHLHTHGP-RVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            PHK   C K F  + +++ HL  H   + +EC  CGK F   + LK H +VH+G+KP++C  + CGK F+   +L+ H+ IH+G +PY C    CGK F  S +LK+H+  H+  K
Sbjct:   58 PHKCDECGKCFTQSGTLKTHLRIHTKVKPYECEVCGKCFTRKTHLKTHLMVHSGQKPYKC--DECGKCFTQHAHLKAHLVIHSGKKPYKCDE--CGKCFTLSGDLKTHLVIHSGEK 169          

HSP 7 Score: 78.9518 bits (193), Expect = 1.571e-15
Identity = 39/89 (43.82%), Postives = 56/89 (62.92%), Query Frame = 1
Query:  967 RVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            + H+C ECGK F +S  LK H  +HT  KP++C  E CGK F+   +L+TH+ +H+G +PY C    CGK F Q  +LK+H+  H+  K
Sbjct:   57 KPHKCDECGKCFTQSGTLKTHLRIHTKVKPYEC--EVCGKCFTRKTHLKTHLMVHSGQKPYKCDE--CGKCFTQHAHLKAHLVIHSGKK 141          

HSP 8 Score: 77.7962 bits (190), Expect = 4.515e-15
Identity = 42/101 (41.58%), Postives = 61/101 (60.40%), Query Frame = 1
Query:  895 PHK--GCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQ 1188
            PHK   C K F  +  ++ HL  H G + +EC +CGK F  S  +K+H  +H+G+KP++C  + CGK F+    L+TH+ IH+G +PY C    CGK F Q
Sbjct:  310 PHKCDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKKHVKIHSGKKPYKC--DECGKSFTEHAYLKTHLIIHSGKKPYKC--YECGKCFTQ 406          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Nematostella
Match: EDO35311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLW8])

HSP 1 Score: 104.375 bits (259), Expect = 7.553e-25
Identity = 53/123 (43.09%), Postives = 71/123 (57.72%), Query Frame = 1
Query:  865 TGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTHG---PRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHN 1224
            TG + R   C   GC K+F   S + KH+ TH    P   E   CG+ +  +  LK H   HTGEKPF+CSFE C K F+  + L++H+R HTG++PY CP   C K F  S +L+ HI+TH 
Sbjct:   26 TGDTFR---CEENGCDKSFITQSDLTKHVRTHSGEKPFRCEVDGCGRVYTTAHHLKVHERAHTGEKPFKCSFEQCDKAFATGYGLKSHMRTHTGEKPYKCPKETCAKAFKTSGDLQKHIRTHT 145          

HSP 2 Score: 102.449 bits (254), Expect = 2.913e-24
Identity = 49/121 (40.50%), Postives = 73/121 (60.33%), Query Frame = 1
Query:  871 TSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHN 1224
            T  +   C  + C KAF     ++ H+ TH G + ++C +  C KAF  S  L++H   HTGE+PF+C +EGCG+ F+     + H+R HTG+RPY C + GCG+ FA +TN K+H + H 
Sbjct:   85 TGEKPFKCSFEQCDKAFATGYGLKSHMRTHTGEKPYKCPKETCAKAFKTSGDLQKHIRTHTGERPFKCPYEGCGRSFTTSNIRKVHMRTHTGERPYICEHPGCGRAFASATNYKNHSRIHT 205          

HSP 3 Score: 95.1301 bits (235), Expect = 9.690e-22
Identity = 51/126 (40.48%), Postives = 73/126 (57.94%), Query Frame = 1
Query:  865 TGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHEC--SECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSH--IQTHNK 1227
            T T  +   CP + C+KAF+ +  ++KH+ TH G R  +C    CG++F  S+  K H   HTGE+P+ C   GCG+ F+   N + H RIHTG+RPY C   GC K F + ++L  H  + TH K
Sbjct:  113 THTGEKPYKCPKETCAKAFKTSGDLQKHIRTHTGERPFKCPYEGCGRSFTTSNIRKVHMRTHTGERPYICEHPGCGRAFASATNYKNHSRIHTGERPYVCQVIGCNKRFTEYSSLYKHHVVHTHTK 238          

HSP 4 Score: 93.9745 bits (232), Expect = 2.907e-21
Identity = 48/122 (39.34%), Postives = 68/122 (55.74%), Query Frame = 1
Query:  904 GCSKAFRDNSSMRKHLHTHGPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK-YKTLKTFCA 1260
            GC K F     ++ H  +H      C E  C K+F+  S L +H   H+GEKPF+C  +GCG+ ++   +L+ H R HTG++P+ C +  C K FA    LKSH++TH   K YK  K  CA
Sbjct:    7 GCGKQFSTAYRLKAHGRSHTGDTFRCEENGCDKSFITQSDLTKHVRTHSGEKPFRCEVDGCGRVYTTAHHLKVHERAHTGEKPFKCSFEQCDKAFATGYGLKSHMRTHTGEKPYKCPKETCA 128          

HSP 5 Score: 81.2629 bits (199), Expect = 5.990e-17
Identity = 45/121 (37.19%), Postives = 69/121 (57.02%), Query Frame = 1
Query:  865 TGTSMRAVPCPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQT 1218
            T T  R   CP++GC ++F  ++  + H+ TH G R + C    CG+AF  ++  K H  +HTGE+P+ C   GC KRF+   +L  H  +HT  +PYTC    C K + Q++ L +H +T
Sbjct:  143 THTGERPFKCPYEGCGRSFTTSNIRKVHMRTHTGERPYICEHPGCGRAFASATNYKNHSRIHTGERPYVCQVIGCNKRFTEYSSLYKHHVVHTHTKPYTC--NACNKTYRQTSTLANHKRT 261          

HSP 6 Score: 52.373 bits (124), Expect = 2.545e-7
Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 1
Query: 1057 FQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            + C+ +GCGK+FS  + L+ H R HTGD  + C   GC K F   ++L  H++TH+  K
Sbjct:    1 YHCNIDGCGKQFSTAYRLKAHGRSHTGD-TFRCEENGCDKSFITQSDLTKHVRTHSGEK 58          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Medaka
Match: yy1a (transcriptional repressor protein YY1 [Source:NCBI gene;Acc:101173824])

HSP 1 Score: 228.024 bits (580), Expect = 2.780e-67
Identity = 99/118 (83.90%), Postives = 107/118 (90.68%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  229 RTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 346          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Medaka
Match: YY1 (transcriptional repressor protein YY1 [Source:NCBI gene;Acc:101158814])

HSP 1 Score: 228.024 bits (580), Expect = 3.818e-67
Identity = 99/118 (83.90%), Postives = 107/118 (90.68%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  240 RTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 357          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Medaka
Match: YY1 (transcriptional repressor protein YY1 [Source:NCBI gene;Acc:101158814])

HSP 1 Score: 228.024 bits (580), Expect = 5.399e-67
Identity = 99/118 (83.90%), Postives = 107/118 (90.68%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            R + CPHKGC+K FRDNS+MRKHLHTHGPRVH C+ECGKAFVESSKLKRH+LVHTGEKPFQC+FEGCGKRFSLDFNLRTH+RIHTGDRPY CP+ GC K FAQSTNLKSHI TH K K
Sbjct:  258 RTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 375          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Medaka
Match: ENSORLT00000041554.1 (zinc finger protein 616 [Source:NCBI gene;Acc:101174938])

HSP 1 Score: 106.301 bits (264), Expect = 9.159e-24
Identity = 53/110 (48.18%), Postives = 72/110 (65.45%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K+F +NS++ KH+ TH G +   C  CGK F E+S L +H   HTGEKP+ C  + CGK FSL  NL  HIR HTG++P++C    CGK F+QS  LK+H+++H   K
Sbjct:  280 CDKSFPENSTLTKHMRTHTGEKPFSCEVCGKGFPENSTLTKHMRTHTGEKPYSC--KECGKSFSLSTNLTKHIRTHTGEKPFSCVL--CGKSFSQSVTLKNHMRSHTGEK 385          

HSP 2 Score: 102.449 bits (254), Expect = 1.301e-22
Identity = 51/110 (46.36%), Postives = 68/110 (61.82%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C K F +NS++ KH+ TH G + + C ECGK+F  S+ L +H   HTGEKPF C    CGK FS    L+ H+R HTG++P++C    CGK F Q  NL+ H+ TH   K
Sbjct:  308 CGKGFPENSTLTKHMRTHTGEKPYSCKECGKSFSLSTNLTKHIRTHTGEKPFSCVL--CGKSFSQSVTLKNHMRSHTGEKPFSC--GECGKSFKQRGNLRVHMLTHTGGK 413          

HSP 3 Score: 102.449 bits (254), Expect = 1.518e-22
Identity = 55/112 (49.11%), Postives = 68/112 (60.71%), Query Frame = 1
Query:  901 KGCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            K C K FRDN  +  H+ TH G R   C+ C K+F E+S L +H   HTGEKPF C  E CGK F  +  L  H+R HTG++PY+C    CGK F+ STNL  HI+TH   K
Sbjct:  250 KECGKCFRDNCILMSHMRTHTGDRPFSCTLCDKSFPENSTLTKHMRTHTGEKPFSC--EVCGKGFPENSTLTKHMRTHTGEKPYSC--KECGKSFSLSTNLTKHIRTHTGEK 357          

HSP 4 Score: 80.8777 bits (198), Expect = 1.365e-15
Identity = 40/109 (36.70%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C     +++  RK      P+ H C ECGK F ++  L  H   HTG++PF C+   C K F  +  L  H+R HTG++P++C    CGKGF +++ L  H++TH   K
Sbjct:  225 CGTLPNNSTPTRKQKRPPKPKRHTCKECGKCFRDNCILMSHMRTHTGDRPFSCTL--CDKSFPENSTLTKHMRTHTGEKPFSCEV--CGKGFPENSTLTKHMRTHTGEK 329          

HSP 5 Score: 80.1073 bits (196), Expect = 2.775e-15
Identity = 44/112 (39.29%), Postives = 63/112 (56.25%), Query Frame = 1
Query:  901 KGCSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            K C K+F  ++++ KH+ TH G +   C  CGK+F +S  LK H   HTGEKPF C    CGK F    NLR H+  HTG + ++C    C + F +   L  H+Q+H + +
Sbjct:  334 KECGKSFSLSTNLTKHIRTHTGEKPFSCVLCGKSFSQSVTLKNHMRSHTGEKPFSCG--ECGKSFKQRGNLRVHMLTHTGGKLFSCQV--CSQNFGKRDTLTEHLQSHAETQ 441          

HSP 6 Score: 51.9878 bits (123), Expect = 1.896e-6
Identity = 28/80 (35.00%), Postives = 44/80 (55.00%), Query Frame = 1
Query:  907 CSKAFRDNSSMRKHLHTH-GPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSF--EGCGKRFSLDFNLRTHIRIHTG 1137
            C K+F  + +++ H+ +H G +   C ECGK+F +   L+ H L HTG K F C    +  GKR +L  +L++H     G
Sbjct:  364 CGKSFSQSVTLKNHMRSHTGEKPFSCGECGKSFKQRGNLRVHMLTHTGGKLFSCQVCSQNFGKRDTLTEHLQSHAETQDG 443          
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Medaka
Match: mtf1 (metal regulatory transcription factor 1 [Source:NCBI gene;Acc:101170051])

HSP 1 Score: 106.301 bits (264), Expect = 3.420e-23
Identity = 49/116 (42.24%), Postives = 69/116 (59.48%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTHGPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C  +GC KAF     ++ H   H  +   C    C K F   S L++H   HTGEKPF+C  +GCGK F+   +L+TH+R HTG++P+ CP  GC K F+   +LKSHI+ H+K +
Sbjct:  220 CDVQGCEKAFNTLYRLKAHQRLHTGKTFNCETEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGEKPFNCPSDGCEKTFSSQYSLKSHIRGHDKGQ 335          

HSP 2 Score: 96.6709 bits (239), Expect = 3.853e-20
Identity = 53/146 (36.30%), Postives = 74/146 (50.68%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDF-----------------------------NLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            C  +GC + +    ++R H  TH G     C++  CGKAF+ S  LK H  VHT EKPF+C  +GC K F+  +                             +LR HIR HTG++P+ C + GCGK FA S +LK+H++TH   K
Sbjct:  160 CTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCETEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGEK 305          

HSP 3 Score: 82.0333 bits (201), Expect = 1.254e-15
Identity = 41/90 (45.56%), Postives = 54/90 (60.00%), Query Frame = 1
Query:  892 CPHKGCSKAFRDNSSMRKHLHTH-GPRVHECSE--CGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYT 1152
            C  +GC+K F   S +RKH+ TH G +   C    CGKAF  S  LK H   HTGEKPF C  +GC K FS  ++L++HIR H   +P++
Sbjct:  249 CETEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGEKPFNCPSDGCEKTFSSQYSLKSHIRGHDKGQPFS 338          

HSP 4 Score: 64.3142 bits (155), Expect = 4.342e-10
Identity = 27/59 (45.76%), Postives = 37/59 (62.71%), Query Frame = 1
Query: 1057 FQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            +QC+FEGC + +S   NLRTH + H G+  + C   GCGK F  S +LK H++ H K K
Sbjct:  158 YQCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTKEK 216          
BLAST of Transcriptional repressor protein YY1B vs. Planmine SMEST
Match: SMESG000057001.1 (SMESG000057001.1)

HSP 1 Score: 228.024 bits (580), Expect = 9.026e-66
Identity = 104/133 (78.20%), Postives = 113/133 (84.96%), Query Frame = 1
Query:  838 RTVESMQYGTGTSM-RAVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            + V S  Y     + R VPCP+KGCSK+FRDNSSMRKHLHTHGPRVH CSECGKAFVESSKLKRH+LVHTGEKP+QC+FEGCGK+FSLDFNLRTH+RIHTGDRPY CPY  C K FAQSTNLKSHI TH K K
Sbjct:  229 KVVNSSHYNYNNDIPRPVPCPNKGCSKSFRDNSSMRKHLHTHGPRVHVCSECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGKKFSLDFNLRTHVRIHTGDRPYLCPYENCNKRFAQSTNLKSHIVTHAKLK 361          
BLAST of Transcriptional repressor protein YY1B vs. Planmine SMEST
Match: SMESG000039253.1 (SMESG000039253.1)

HSP 1 Score: 165.236 bits (417), Expect = 4.223e-45
Identity = 73/116 (62.93%), Postives = 84/116 (72.41%), Query Frame = 1
Query:  883 AVPCPHKGCSKAFRDNSSMRKHLHTHGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKN 1230
             + C   GC+K F+D S MRKHLHTH  + H C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP+ CPY  C K FAQSTNLKSH  TH KN
Sbjct:  202 GISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 317          
BLAST of Transcriptional repressor protein YY1B vs. Planmine SMEST
Match: SMESG000022958.1 (SMESG000022958.1)

HSP 1 Score: 94.7449 bits (234), Expect = 6.051e-20
Identity = 48/131 (36.64%), Postives = 70/131 (53.44%), Query Frame = 1
Query:  850 SMQYGTGTSMRAVPCPHKGCS---KAFRDNSSMRKHLHTH-GPRVHEC--SECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHN 1224
            +M +  G       C  K C    KAF+    +  H+  H G +  +C  S CGK F  S  LK H+  HTGEKPF+C FEGC +RF+   + + H+ +H  D+PY C   GC K +   ++L+ H++ HN
Sbjct:  220 TMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 350          

HSP 2 Score: 88.5817 bits (218), Expect = 4.891e-18
Identity = 48/121 (39.67%), Postives = 62/121 (51.24%), Query Frame = 1
Query:  901 KGCSKAFRDNSSMRKHL---HTHGPR-------VHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNK 1233
            K C K +     +  HL   H  GP          +C    KAF    KL  H  VHTGEKPFQC F  CGK F+   NL+ H R HTG++P+ C + GC + FA S++ K H+  H  +K
Sbjct:  203 KPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDK 323          
BLAST of Transcriptional repressor protein YY1B vs. Planmine SMEST
Match: SMESG000052644.1 (SMESG000052644.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.170e-19
Identity = 45/117 (38.46%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  892 CPHKGCS---KAFRDNSSMRKHLHTH-GPRVHECS--ECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHN 1224
            C  K C+   K F+    +  HL  H G +  +C    CGK F  S  LK H+  HTGEKPF+C FEGC +RF+   + + H+ +H  D+PY C   GC K +   ++L+ H++ HN
Sbjct:  224 CYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN 340          
BLAST of Transcriptional repressor protein YY1B vs. Planmine SMEST
Match: SMESG000053472.1 (SMESG000053472.1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.926e-19
Identity = 51/121 (42.15%), Postives = 73/121 (60.33%), Query Frame = 1
Query:  880 RAVPCPHKGCSKAFRDNSSMRKH-LHTHGP-RVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDFNLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHI-QTHNKNK 1233
            R  PC    CS++F     +R H LH H   R H+C+ CGK+F +SS L +H  VH+GE+P++C +  C K F+    LRTHIR H+G++P+ C Y  C K FA      SH+ +TH +N+
Sbjct:  384 RKFPCSQ--CSRSFEKRDRLRIHVLHVHEKHRPHKCTVCGKSFSQSSSLNKHLRVHSGERPYKCIY--CDKAFTASSILRTHIRQHSGEKPFKCKY--CWKSFASHAAHDSHVRRTHGQNE 498          
The following BLAST results are available for this feature:
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YY13.287e-6683.90YY1 transcription factor [Source:HGNC Symbol;Acc:H... [more]
YY22.185e-5872.13YY2 transcription factor [Source:HGNC Symbol;Acc:H... [more]
ZFP425.978e-5166.94ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:... [more]
ZFP425.978e-5166.94ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:... [more]
ZFP425.978e-5166.94ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ref-22.539e-1936.07REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
ref-23.370e-1936.07REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
ref-23.370e-1936.07REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
fezf-11.791e-1841.32FEZ Family zinc finger protein [Source:UniProtKB/... [more]
lin-294.420e-1844.44Transcription factor [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pho5.913e-6470.07gene:FBgn0002521 transcript:FBtr0089204[more]
pho5.913e-6470.07gene:FBgn0002521 transcript:FBtr0089205[more]
phol1.406e-5576.72gene:FBgn0035997 transcript:FBtr0345600[more]
phol1.406e-5576.72gene:FBgn0035997 transcript:FBtr0076475[more]
MTF-18.740e-2139.50gene:FBgn0040305 transcript:FBtr0344236[more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yy1b1.960e-6784.75YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GE... [more]
yy1a2.543e-6783.33YY1 transcription factor a [Source:ZFIN;Acc:ZDB-GE... [more]
znf10241.439e-2551.35zinc finger protein 1024 [Source:ZFIN;Acc:ZDB-GENE... [more]
si:dkeyp-82h4.34.576e-2546.36si:dkeyp-82h4.3 [Source:ZFIN;Acc:ZDB-GENE-120709-1... [more]
znf9974.598e-2547.27zinc finger protein 997 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcn17.955e-6783.90hyperpolarization activated cyclic nucleotide gate... [more]
znf1432.571e-2745.16zinc finger protein 143 [Source:NCBI gene;Acc:5950... [more]
znf1432.641e-2745.16zinc finger protein 143 [Source:NCBI gene;Acc:5950... [more]
znf1433.507e-2745.16zinc finger protein 143 [Source:NCBI gene;Acc:5950... [more]
ENSXETT00000054826.13.087e-2347.32pep primary_assembly:Xenopus_tropicalis_v9.1:9:296... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Yy12.351e-6683.90YY1 transcription factor [Source:MGI Symbol;Acc:MG... [more]
Mbtps28.548e-6276.23membrane-bound transcription factor peptidase, sit... [more]
Yy28.548e-6276.23Yy2 transcription factor [Source:MGI Symbol;Acc:MG... [more]
Zfp421.388e-5067.52zinc finger protein 42 [Source:MGI Symbol;Acc:MGI:... [more]
Zfp421.388e-5067.52zinc finger protein 42 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25490|TYY1_HUMAN1.579e-6583.90Transcriptional repressor protein YY1 OS=Homo sapi... [more]
sp|Q00899|TYY1_MOUSE1.644e-6583.90Transcriptional repressor protein YY1 OS=Mus muscu... [more]
sp|Q8ST83|PHO_DROME5.927e-6370.07Polycomb protein PHO OS=Drosophila melanogaster OX... [more]
sp|Q2FAY8|TYY2_RATRT2.756e-6177.05Transcription factor YY2 OS=Rattus rattus OX=10117... [more]
sp|P0C6P6|TYY2_RAT2.959e-6177.05Transcription factor YY2 OS=Rattus norvegicus OX=1... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J6BW240.000e+074.71Transcriptional repressor protein YY1B OS=Dugesia ... [more]
A0A1S3I7S21.581e-6682.40transcriptional repressor protein YY1 isoform X2 O... [more]
R7VAY44.087e-6670.39Uncharacterized protein OS=Capitella teleta OX=283... [more]
K1R3894.325e-6680.62Transcriptional repressor protein YY1 OS=Crassostr... [more]
A0A1S3IA785.941e-6682.40transcriptional repressor protein YY1 isoform X1 O... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yy1a3.897e-6783.33transcriptional repressor protein YY1-like [Source... [more]
yy1b5.388e-6783.90YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GE... [more]
znf143a1.048e-2442.74zinc finger protein 143a [Source:ZFIN;Acc:ZDB-GENE... [more]
znf143b6.792e-2443.59zinc finger protein 143b [Source:NCBI gene;Acc:393... [more]
ENSAMXT00000052240.19.329e-2442.62pep primary_assembly:Astyanax_mexicanus-2.0:3:1467... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yy1b1.886e-6783.19YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GE... [more]
znf143b4.486e-2744.35zinc finger protein 143b [Source:NCBI gene;Acc:393... [more]
znf143b9.371e-2744.35zinc finger protein 143b [Source:NCBI gene;Acc:393... [more]
mtf19.837e-2342.86metal-regulatory transcription factor 1 [Source:ZF... [more]
ENSPMAT00000004838.11.051e-2241.74pep scaffold:Pmarinus_7.0:GL495265:3215:3667:-1 ge... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AZF11.102e-1642.16Zinc-finger transcription factor; involved in diau... [more]
ZAP11.289e-1636.57Zinc-regulated transcription factor; binds to zinc... [more]
PZF19.505e-1539.45Transcription factor IIIA (TFIIIA); essential DNA ... [more]
CRZ15.086e-1239.36Transcription factor, activates transcription of s... [more]
SWI51.696e-1141.27Transcription factor that recruits Mediator and Sw... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367632.300e-6583.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466284.122e-2745.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258731.199e-2543.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268794.807e-2548.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353117.553e-2543.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yy1a2.780e-6783.90transcriptional repressor protein YY1 [Source:NCBI... [more]
YY13.818e-6783.90transcriptional repressor protein YY1 [Source:NCBI... [more]
YY15.399e-6783.90transcriptional repressor protein YY1 [Source:NCBI... [more]
ENSORLT00000041554.19.159e-2448.18zinc finger protein 616 [Source:NCBI gene;Acc:1011... [more]
mtf13.420e-2342.24metal regulatory transcription factor 1 [Source:NC... [more]
back to top
BLAST of Transcriptional repressor protein YY1B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057001.19.026e-6678.20SMESG000057001.1[more]
SMESG000039253.14.223e-4562.93SMESG000039253.1[more]
SMESG000022958.16.051e-2036.64SMESG000022958.1[more]
SMESG000052644.11.170e-1938.46SMESG000052644.1[more]
SMESG000053472.11.926e-1942.15SMESG000053472.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001476 ID=SMED30001476|Name=Transcriptional repressor protein YY1B|organism=Schmidtea mediterranea sexual|type=transcript|length=2444bp
CTATATAAATCTTATATGATTAAAGAATTTTTTTTAGTTAAATAATTACA
AGTTATGAATATATCAGATTTTTTTAATTTCAATGATCAATTTCTGGATG
ATGATAGTGAGGATATTGCTTTGGATCCGCTAGAAAATCCATTAATGAAT
CTGGAAACATTTCAAATACCCAATGATTCTCAAGATGAAAATTGTCATGA
TTATGTTGACGAAGAAGTTGTTGATGAAGACACAAACAATGTTTTCTTAT
GTGAAGGTATTGATGTTTGTCGAGAAGAAATAATTGAAAATTCAGTTACT
ATTAATAATACATTAAATCACAATGACCTAATAAACGACTTCAGTTCGAA
AAATGGAATTAATGAATATTTTTCAGACTGCAAGGAATTTTCTGTCGTTT
ATAATTATAATGATGATTATAATGTAAATAATAACTTAAATTCTGTCAAA
CTAAGAAAAAAACCCATGGTATCTATCAATGATTCGCTTATAAAATCAAG
CATGTTGAAATCGGAGTCAACATTATCCAACTGTGCAATAGATATAGTAA
ATTTACCCTTCCCAAAAAATAATCGCTACATTCGCAATTATCCCAATGAA
TTTTCAAAGATCATTATCAAAACTGAACCAAATTCTAGTTCATTTAATGA
AATTTTCCGCAATTCAGGAATATCAAATCAAAGATCAAATCCTTTACTTA
ATTTGAAAAAAGAACGCAGAGTAATGTCCTATGATCACGGGCATGTTTTC
ACAAAAGAAGACGTATTAGAAGATGATGATGATGAACTGCCCGACGACCC
GGTGGCACCAGTTGTCCCACAACATCGTAGGCGTAGGAGAACTGTTGAAT
CGATGCAATACGGTACCGGTACGTCGATGCGTGCTGTACCCTGTCCACAC
AAAGGCTGTAGCAAAGCATTCAGGGATAATTCATCGATGCGCAAGCACTT
GCATACTCATGGTCCTCGTGTTCACGAGTGCAGTGAGTGTGGGAAAGCAT
TTGTCGAAAGCAGTAAATTGAAGCGTCACAGATTGGTCCACACAGGAGAA
AAGCCGTTTCAGTGCTCATTTGAAGGCTGTGGCAAACGATTCTCTCTGGA
TTTCAATTTGCGCACTCATATCCGTATTCACACCGGCGACAGGCCGTACA
CATGTCCTTATGCCGGTTGCGGCAAGGGATTCGCCCAATCGACAAACCTC
AAGTCACACATCCAAACCCACAACAAGAACAAATACAAGACTCTCAAAAC
ATTTTGCGCTCCTAACAAAATTTCTAGTCAATCCAATGCCAGTTGTCGCA
ATTCTAATTTAATCGATGAACAACAGCTCACTGCACCGATTAGTGGCCAA
TTACGCCGTCTGAATTCATCTCAGGGCTCCTCGTCGAGTTCTTCGTCTCG
GGAATTGCGCGTCCAGAAACGAAGTGCCGTGCAGCAAGTCGACATGAATT
GCCTCGATTCCAGCGGCATGATGCTGCATCAAAACAATGGTGCCTCCGGC
ACAACAGGAACAAAGGGAGAAAGTCTTCCATTGGATGAAGCTGAAGATAA
TTCGTCATTTGAATTCTGATTTCTATGATCTGATCTGAATCACCATCATA
ATCATTTTTCATACTCGTTGTCGTTGTCGCCATCTTCGTCGTGTTTTAAT
CAATTACTTTATCTCGTTACACTGTTGCTATTGGCGATGATCGCTAGTAC
CGTTTCTATGGATTCCATTAGCATTTTCAATTGTAAATAGACATTTGGAC
TTCGTGTCCGCTATAATATGCAGCTGTTACCTGTGGAGATTTACCCATGT
ACATATTTCTCGATATCTGTTAACGTTCCCTCGTACCCCAGGTTCTCAAT
CCGACAACTATCGATTGATATTGCCGATTACGCAATTGCTGTAATTGGCA
TTGAGTTGTCTCATAGTAGCAGCCCCCCTCATAGTCCCCCATGTTCCCTT
TTGCTGGAGCAGCGATTTTATCATTTATATTTATGCTGCTACAAATATAT
ATTTATCTAATAAATAGAGAGAACGATTTCGCATTTAGTTTTCTTTTGCG
CATCATTTTTAGTATGTATGTCACTCTGAGTTTTGCGGTTGCCGTTGTTA
TTGTTTATGTTGTTGATGTGATTTTTATTGATTATTTGTACATCTTTCTG
GTTCTTAGTTGTGATTTTTACTATTGGGATTTTATGTGCAGTTTTGTTTG
TTTTCTTTTTTATATTCTATCTCAATGTGTATTTTTCAAAATTTATTGAT
CCAATTTCGCGTGTGTGTGTGTGTAAAATATTCGTTTTTATACTTTTATT
GTGTGAAATTTTGCCGGTTACACGCGGCCGGGTTATTTTCCCTCGATCAA
TTACTCAGTTGTTATTTGTTTGTGTGTGTCAGCTTGAATGTGAAATTTGG
AATTTTTTTCCAATTGTAAATAAATATGTTTAATTATGAAAAAA
back to top

protein sequence of SMED30001476-orf-1

>SMED30001476-orf-1 ID=SMED30001476-orf-1|Name=SMED30001476-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=505bp
MNISDFFNFNDQFLDDDSEDIALDPLENPLMNLETFQIPNDSQDENCHDY
VDEEVVDEDTNNVFLCEGIDVCREEIIENSVTINNTLNHNDLINDFSSKN
GINEYFSDCKEFSVVYNYNDDYNVNNNLNSVKLRKKPMVSINDSLIKSSM
LKSESTLSNCAIDIVNLPFPKNNRYIRNYPNEFSKIIIKTEPNSSSFNEI
FRNSGISNQRSNPLLNLKKERRVMSYDHGHVFTKEDVLEDDDDELPDDPV
APVVPQHRRRRRTVESMQYGTGTSMRAVPCPHKGCSKAFRDNSSMRKHLH
THGPRVHECSECGKAFVESSKLKRHRLVHTGEKPFQCSFEGCGKRFSLDF
NLRTHIRIHTGDRPYTCPYAGCGKGFAQSTNLKSHIQTHNKNKYKTLKTF
CAPNKISSQSNASCRNSNLIDEQQLTAPISGQLRRLNSSQGSSSSSSSRE
LRVQKRSAVQQVDMNCLDSSGMMLHQNNGASGTTGTKGESLPLDEAEDNS
SFEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007126meiotic nuclear division
GO:0008584male gonad development
GO:0008585female gonad development
GO:0006351transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm