Lipoxygenase homology domain-containing protein 1

Overview
NameLipoxygenase homology domain-containing protein 1
Smed IDSMED30001473
Length (bp)7681
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lipoxygenase homology domain-containing protein 1 (SMED30001473) t-SNE clustered cells

Violin plots show distribution of expression levels for Lipoxygenase homology domain-containing protein 1 (SMED30001473) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lipoxygenase homology domain-containing protein 1 (SMED30001473) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lipoxygenase homology domain-containing protein 1 (SMED30001473) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001473

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30001473SMESG000059926.1 SMESG000059927.1 SmedASXL_018394SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30001473SMESG000059926.1 SMESG000059927.1 SmedASXL_018393SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30001473SMESG000059926.1 SMESG000059927.1 dd_Smed_v4_10460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001473SMESG000059926.1 SMESG000059927.1 dd_Smed_v4_10460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001473SMESG000059926.1 SMESG000059927.1 dd_Smed_v4_10460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30001473SMESG000059926.1 SMESG000059927.1 dd_Smed_v4_10460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30001473SMESG000059926.1 SMESG000059927.1 dd_Smed_v4_10460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30001473SMESG000059926.1 SMESG000059927.1 dd_Smed_v6_10460_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001473SMESG000059926.1 SMESG000059927.1 dd_Smed_v4_10460_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30001473SMESG000059926.1 SMESG000059927.1 dd_Smed_v4_10460_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30001473SMESG000059926.1 SMESG000059927.1 dd_Smed_v4_10460_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Human
Match: LOXHD1 (lipoxygenase homology domains 1 [Source:HGNC Symbol;Acc:HGNC:26521])

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 487/1321 (36.87%), Postives = 749/1321 (56.70%), Query Frame = 1
Query: 3691 IDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKN-GDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKD--------NKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-----DKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNY-FAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAG-MPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK-KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTPS 7560
            I+++ F  +RWLA  ++DN +V EL+P  + G P  N     Y V V TGN   +GTDANV+LTI+G+  GD+GER LK +  +  NKFE+   D F I AIDLG L KI+IRHDN+   A W+LD + + D ++E  Y FPC  WLA  +D G LS+++ P + +      +        N LD     + Q+DK   F+V + T  K  AGTDANV I L+G  +D+G+  LK S T+S+KFE  + + F V+  DLG+L K+R+GHDN+G    W +  VE++A  LG+   FPC  W++K++ DG++ R+L+     T    P + YEIT  TS+   AGT+AN++I +YG +  CT++  L  N    K   +      F V +EDV + IEKIRIGH+N G+   WH   V ++RLL +K+ +    FPC+RWLA  E+D    REL+P     +K ++ GS+  + + +++       L    Y+++++TG     GT+A V++ +YG+ GD+GER L  S+  T+KFE+   D F  EA DLG ++KI +RHDNS +   DW+++K+EI +  + + +LF C RWLS  K+D +++R  Y   Y G+RS+  S  +       ++ +      +  G  A    E        I Y +++ TG  KD  +    ++ L G  + ++  I L        F+ GS E   V   DV  IK++E+ ++G   ES W +  + + +PT+G  Y + C  WL+K  G+  TSR+F + D M+ N+  K+ Y ++V TGDV  GGT+S +F+ L+G  G++    LDK +  FER   D F +E+ D+    K+RI+ DG G RP WFLE++ + N +T +   F Y ++LS+  G KK L  ++  + D    ++ T Y V VKTS++  AGT + V +  +GE GDSG L LK     NK F+ N  D F FPDMLSLG L + +VWH+N G    WHL Y+++K+     ++ F C+ WLS ++ D Q  R+  C N  N       ET+YE+ + TG   N G    +VW +  G KN S +F+MEN+  +++ F + + D  +   +YLG++ ++ +G +  ++      +  W    + +  +     Y F     I +  K +    ++F+++   E    ++V+ L     VKYE++V TG   G GTDANVF+T+FG N ++GKR L QK RNLFE+G  D+F LE ++LG++ K+++EHD S + S W +++V+V N ST     + C  WL K +G    W+ L PS
Sbjct:  987 IEQHKFEAHRWLARGKEDNELVVELVPAGKPG-PERN----TYEVQVVTGNVPKAGTDANVYLTIYGEEYGDTGERPLKKS--DKSNKFEQGQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLD--NLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEP------LDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCA-DWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPI-----IPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKG-KKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACAN--NKICDELEETTYEIVIETG---NGGETRENVWLILEGRKNRSKEFLMENS-SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYF--KVFEVTKTTE-SFASKVQSLVP---VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPS 2272          

HSP 2 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 330/865 (38.15%), Postives = 508/865 (58.73%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELT---GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT----LEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            YE+V  TGD+  +GTD+ VFI+L G  G+SP++QL  ++   F++G    F +    VG I K+RI  D +G  +SWYLD V +TD+K P  RY+F C NWLSK  GD    R++  +   M +    +Y++  YT +  GAG+ AD++I IFGE G++    ++N KD F++G+     L    LG L KI VG+ N G    WFL++++I D+   R ++FP  +WL+  + +G +++ + V           Y + + TG+   A T S+ Y+++ G           +++ KI++E   F  G TD+  +EL   LSPL+ +  G    G N+ WF + +VI CP TGI+Q+F C NWL   +     E  L E +S RK +      +  W + ++T+D+K A TNS + + +YG  G+TD+I++ P +     G + +FR EL  +G  YK+R  HD   + S W+LE++ +   +N D+Y F CNRWL  + +D   VRE+ A GP + +   + +Y V + TG    AGTDANV++ ++G+ GDTG+R L +   NT+ FEKG  DEF IE+V +  + ++++ HD K +GSGW++D+V++ EE  P S++V F C  W D  + DG  VREL     +  L    Y + +KTG V GA TDS V+I+++G   DT    L  S  N K+ FE G  D F +E  +IG I  + I HD TG  ++WF+  + + VP+ G +Y F  N+WLD       LE +L PS++ +I K + Y++ ++TGDV  AGT ++V++QIYG+  KT+ L L S+S  FER ++D F++ AADVG + K+R+GH G+  G  WF+D V
Sbjct:   45 YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGG--AETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGN-------KNSGKIFLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKR----LKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTV 896          

HSP 3 Score: 477.248 bits (1227), Expect = 2.010e-135
Identity = 313/963 (32.50%), Postives = 502/963 (52.13%), Query Frame = 1
Query: 2116 FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK--LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGD-EYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRE-LTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGD--TGNVQLKTSMTNKNKFEFGATDLFKIE-AEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLE-------YDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE----SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENF--NVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK-----FESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKL-QTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANK 4926
            +    + V   T D++ A T++ V + L+G+NG +  + + + SK   + G+V  FR     VG+ YK+R +HDN+G N+SW L+ +++T        Y F CN WLS    D    R++ A+   +  P    KY+V++YTG+ + AGTDA+VFINI+GE GDTG+R L +   N   FEKG  D F+++A  LG + KI +GH++K   +GWF+ +++I E+        F  N W    E DG   R+ L G      +TY V V TG V+GAGT S +++ ++G  G+  +G + L+  +     F+ G TD+F IE A  +  +  + + H + G    WF +++ ++ P  G++  F  + WLD K  +       Y++   +  ++ K  P+ + V+T D+  AGT+S +FIQIYG+  +TD++ L   +  F+ G             +I+K RI    + P  G F    +                                        + S S   L +++     N D+Y F CNRWL ++EDDN IVRE+  T E       +   +Y V V TG   G+GTDANV+L +FG  GD+GER L N  +N+ + FE+ + D+F I+++ +  + +++IRHD    G+ WYLD VLV +E    SD   FPC  WL  +KD G L +++ P++ +                      L+NF  ++ + T     A TD+ V+I LYG+ +D+    +KQ L  S+      FE G  DEF ++  ++G + ++ IGHD++G +A W L  V+I   + G+ + FP N W+ K++ DG LE ELYP   + + K   + YE+   T +  GAGT+A VY+Q+YG    TE   L   S +SK+ +    D F +   DV + + K+R+GH  +G G +W ++ V ++ L+  +
Sbjct:   40 YKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRG-NKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN---FEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVI-EDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRL-KKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPNNKWFKPG-------------IIEKFRI----ELPDLGRFYKIRVWHDK------------------------------------RSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREM--TAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNT-DLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSA--------------------TLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDT----IKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKL--VHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFL---SSRSKVFERASKDTFQLEAADVGE-VYKLRLGHTGEGFGPSWFVDTVWLRHLVVRE 905          

HSP 4 Score: 449.899 bits (1156), Expect = 7.157e-127
Identity = 375/1371 (27.35%), Postives = 607/1371 (44.27%), Query Frame = 1
Query:  865 FTCNHWLSLYKEDGKVSRELFAFKSV---RTKYEIVVITGDLDDSGTDSKVFISLCGR----TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR-----------------------TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGF-----TDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLD--DIVIFCP-QTGIEQ-SFICGNWLSPSRPGCQTEVSLV----------EDLSKRKLKTVIDFTENT--WMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI---------------PA-------------------TGP--GIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTF--RCNCWFDSSEGDGLTVR--ELTGTTLLG---KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKIDKT-----IPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSD--TFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG------AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQL 4614
            F  + WL+  KED ++  EL         R  YE+ V+TG++  +GTD+ V++++ G     TG  P  +  K N   F++GQT  F I A  +G ++KIRIR D +G+++ W+LDR+ ITD+ N E  Y+F C+ WL+ +  D    RE+    E   +                          T + ++  T  K  AG+ A+++I +FG   ++ +  +K    N D F+  SI   T+    LG L K+++G+ N G  P WF++ V ++     +   FPCG+WL+  + +G  +  +   +     Y  +  YE+ + T +   A T +  ++I+ G        D + +  K    N + ++ F          VEL +    + +I  G N  G N  W     DI    P + G E  +F C  WL+ S    +T   LV          +D S R++   ++   +   + V I+T +I  A T++KV + +YGD G T +  +       +K + G+   F  E A +G+ YK++ +HDNS   + W +EK+ +    N DE+ FLC RWLS   ED    R                 PA                   TGP    V+  PI  Y V + TG    A TD+  FI + GE  +   R           F +G ++EF +  + +G I KI+LGHD     S W V+++ +     P+    +   CNCW     GDG+T R  +L    ++    KV YE+ V TG V G GTDSN+F+ ++G  G T  +QL      K +FE    D F +E  DI     +RI  D  G+   WF+++I +     G   +F+   WL  +  +  L       ID+        Y + V T D++ AGTD+ VFI I+G++  +  L LK  ++   FER N D F   +   +G + K+R+ HD K    GW                                                      LS +  ++ +  + + F C+ WL+  E D   VR+    + K      L+E  Y + ++TGN  G  T  NV+L + G+   S E  ++N+  +    F + + D F   +I LG +  + + H             AW++  + + +    + Y F C   +   +   +            +K ++  K  +S     Q      + V V T  +  AGTDANV + ++G   D+G   LKQ +   N FE G+ D F ++  +LGEL+K+R+ HD+SG  + W + KVE+     G + +F C  W+ K + DG   R+L+P +
Sbjct:  992 FEAHRWLARGKEDNELVVELVPAGKPGPERNTYEVQVVTGNVPKAGTDANVYLTIYGEEYGDTGERPLKKSDKSNK--FEQGQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNN-EITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYG-------CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCL---AVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKK---KARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGW-----------------------------------------------------HLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNK--ICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENS--SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKY------------FKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPSV 2273          

HSP 5 Score: 396.741 bits (1018), Expect = 2.429e-110
Identity = 265/862 (30.74%), Postives = 428/862 (49.65%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGE--TNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDL-GELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNET--YLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKN--LKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKL 6249
            RY+F CN WL+  E D    R+LL +    NP+   +  KY V V TG+  G+GTDA+VF+ IFG+ GD+GER L+N  DN    FE+ + D+F++ A DLG L KI + H+N  G A W+L  +++ D  ++  Y FP   WLA ++D G + +DI                         E     + V V+T     AGT + +++++YG     +SG I L+  +     F+ G  D F ++   L   L ++ +GH N G N  W   KV I     G    FPC+ W+ + K DG +ER+LY  +SL   +  K  + +   T++ K AGTN+ ++IQ+YG+   T++  LN   +    + G  + F + + D+     KIR+ HD +  GS WHLE++ +   L NK+K   Y F CNRWL  +E+D  I RE           M A G ++ ++  +A       Y + V TG     GT+ANV+L ++G+ GD+GER L + + +TD FEK N DEF  E+V +  V ++ IRHD  G     W+L ++ + ++   E+    F C RWL K KDD ++ R L            PS                                + +A  +   Y I++ TG      +    +++LYG K+  +K  ++       +YF  G  +  ++E  ++ NI ++ I ++     +SW+L S+ I +P +GK Y      WL K   + +      +    +  + K + Y + + TGDV   GT++ +++Q++G +G + +  L      FER  +D F+LE  DVG++ K+R+ + G G  P WF++ +
Sbjct:  137 RYYFNCNNWLSKVEGDRQWCRDLLAS---FNPMDMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN----FEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGA--------------------ETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLN--PNNKWFKPGIIEKFRIELPDL-GRFYKIRVWHDKRSSGSGWHLERMTLMNTL-NKDK---YNFNCNRWLDANEDDNEIVRE-----------MTAEGPTVRRIMGMAR------YHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKG-SGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELL-----------PS--------------------------------DSSATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLE--VELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTV 896          

HSP 6 Score: 381.333 bits (978), Expect = 1.325e-105
Identity = 285/1010 (28.22%), Postives = 480/1010 (47.52%), Query Frame = 1
Query: 2890 TYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVI-VPKLGLKYIFFLNKWLD--------SKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNG--DSGERALKNTVDNSVNKFEEKSLDKFLIK-AIDLGTLEKIKIRHDNSNGGAAWYLDYV--LVNDESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGR-NDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGETG--TNANVFLKVYGENGDSGERQLVDSKTHT-DKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSI 5865
             YEV   TG V+GAGTD+NVFI +FG+ G +  +QL +   +K+ FE G  D+F++   ++G I  +RI HD+TG  ++W++D + V  + +  L+Y F  N WL          + L    +P  + + +K   Y++ V+TGDV+ AGTD+ VFI I+G+   T +  L+++ D FE+G ED F ++A D+G + KI +GH+ K   +GWF                                                     LSQI  ++  N  +Y F  NRWLA DEDD  I R++L    +   ++      Y+V V TG+  G+GT + ++L ++G  G  +SG+  L+  V      F+    D F I+ A+ L  L ++ + H N      W+ + V  L      +  FPC +WL   K  G + + ++              L K + K +       +++ V+TT    AGT++ + I +YG+   +  I L     ++  F+ G  ++F+++  DLG   KIR+ HD     + WHL ++ +        + F CN W+  ++ D  + RE+  +           +Y +T  T   +GAGT+ANVY+ ++G   D  E+   N  ++    + G  D F +    + + + ++RI HD KG GS W+L++VLV+     + +S   EFPC RWL +D++DG + RELLP                   DS A  L+   Y I + TG  +G  T++ V++K+YG+  D+ ++ L+ S  +  D FE+  +DEF  E +++G + ++ I HD++G     WFL  ++I      + Y F   RWL K++ D +++  LY           PS             ++ QK                      + Y + I TG     G+S   +M++YG K  KT ++ L    +  F   SK+   +EA DV  + ++ + + G     SW+++++
Sbjct:   44 VYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSK--SKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRGNK---YEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWF-----------------------------------------------------LSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAIT------YIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV------FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEM----------VSLRKKRLKKFP------WSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNP---NNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRN-VRRVRIRHDGKGSGSGWYLDRVLVRE--EGQPESDNVEFPCLRWLDKDKDDGQLVRELLPS------------------DSSAT-LKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTG-MHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELY-----------PS-----------EVVEIQK---------------------LVHYEVEIWTGDVGGAGTSARVYMQIYGEKG-KTEVLFLSS-RSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTV 896          

HSP 7 Score: 364.385 bits (934), Expect = 1.941e-100
Identity = 262/962 (27.23%), Postives = 459/962 (47.71%), Query Frame = 1
Query: 1690 ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIF-CPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD-SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGD--TGDRFLTHSTTNTNKFEKGQMDEFLIE-AVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVRELTGTT-----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK------TLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVN--DESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKV 4506
            E Y+   YE+  +TG+   A T +  ++ L G   ++ +  K++ T+K     + F++G  DV  V  N  +  + ++    +  G N  W+LD +++    +  +   F C NWLS      Q    L+   +   +        N + V +YT D+  A T++ V + ++G+ G T +  +  +    + G+   F  +   +G   K+   H+N G ++ W L +I++    N  +Y F  NRWL+   +D    R+I   G           Y V ++TG+   AGT + +++ +YG +G+  +G  FL         F++G+ D F IE AV L  +S++ +GH +     GWF +KV+I     P   +  TF C+ W D  + DGL  R+L          L K  + + V T  ++ AGT+S +FI+I+GQ G T  + L     N   F+ G  + F+IE  D+G    IR+ HD   +GS W ++++ ++      KY F  N+WLD+         E   +   + +I     Y +TV TG++  AGTD+ V++ ++G    T +  L   ++ +D FE+GN D F I +  +  ++++RI HDGK  GSGW+LD+VL                                                   + E+ +   D   F C RWL  D+DD  +VRELLP+D      + LK  +Y + +KTG+  G+ TD+ V++ ++G   D+ ++ L  + +N  + FE   +D+F ++ +++G + ++ I HD++   A+W+L  V +    +  +Y FP   WL  N+  G L  +++P+                  ++ +  KL ++ V+++T     AGT A V++ +YGE   + ++ L    + S  FE  + D FQ++  D+GE+ K+R+GH   G    W +  V
Sbjct:   38 EYYKARVYEVVTATGDVRGAGTDANVFITLFG---ENGLSPKLQLTSK---SKSAFEKGNVDVFRVRTN-NVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPR-----GNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGA----ETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVI---LCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNP---NNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVL---------------------------------------------------VREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSS----ATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPS------------------EVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLS---SRSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTV 896          

HSP 8 Score: 359.377 bits (921), Expect = 5.986e-99
Identity = 269/988 (27.23%), Postives = 467/988 (47.27%), Query Frame = 1
Query: 4579 DGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVE-APDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWL----SKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKK----TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRS--WKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIM---ENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKI 7494
            +G LE E Y         + ++ YE+ T T + +GAGT+ANV+I ++G N  + K  L + S KS  + G  DVF V   +V   I K+RI HDN GL ++W+L+ V+V  +   K   + Y F CN WL++ E D    R+LL        S N +           ++ +   Y ++VYTG     GT+A+VF+ ++GE GD+GER+L + K   D FEK   D F  +A DLG++ KI++ H+N G     WFL +I I D  +   Y F   RWL+  +DD KIQR + + G                                             A+T  I Y +T+ TG  +  G+    ++ +YG +  K +      LE   F  G  ++  +E A  +  + +V + +  V     W+   + I  P  G      C  WL    +  + ER+   + S++ K +    KK  + + V T D+ + GTNS +F+Q++G +G +    L+ N   F+ G  + F++E+ D+G+  KIR+ +D       W LE++ + N    + Y F  N +L  N    + +    A    +++      Y V V T  ++ AGT + V +  +G+ GD+G+  L     N   F+    DEF   + +++ ++ R ++ H+  G  S W+L+ + ++E     S   +FPC +WL    DD Q+ REL+    P+ +  +     Y +++ TGD   A     V+   YG+K+ + K ++   +NN+  +  F R   D+  +  + +G +  + +G     ++       WF   V ++     K Y F    W++ ++     + E++           + V E++K  +V YE+ + TG   G GT A V++ ++GE  ++    L  + + +FE+  +D F LE  D+G++ K+++ H    F   WF+D V +++L   ++
Sbjct:   32 EGELEHEYY---------KARV-YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKS-KSAFEKGNVDVFRVRTNNVG-LIYKVRIEHDNTGLNASWYLDHVIVTDM---KRPHLRYYFNCNNWLSKVEGDRQWCRDLL-------ASFNPM-----------DMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEK---DNFEKGAEDRFILDAPDLGQLMKINVGHNNKGG-SAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGG---------------------------------------------AETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIF--LEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRL----KKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTI-ESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELL----PSDSSATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNL--KDYFERGRVDEFTLETLNIGNINRLVIG-----HDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELY----------PSEVVEIQK--LVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSK-VFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTVWLRHLVVREV 906          

HSP 9 Score: 350.903 bits (899), Expect = 2.680e-96
Identity = 272/969 (28.07%), Postives = 467/969 (48.19%), Query Frame = 1
Query: 3817 YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESD---EYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGC-----TDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHD--NSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGP-KNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNV--TCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNS---SLYPLDKN-EDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAP--INDIKK-TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTR 6657
            Y V   TG+  G+GTDANVF+T+FG+NG S +  L +    S + FE+ ++D F ++  ++G + K++I HDN+   A+WYLD+V+V D       Y F C +WL+  +      +D+  +          N +D  +   Y+        VKVYT   + AGTDA+V I ++GE  D+G   L+      + FE G  D F +   DLG+L KI +GH+N G +A W L+++ IE     + + FP N W++  + DG ++R++    + T      I Y +T  T + +GAGT + +Y+ +YG          N  S K  L+ G      TD+F++ +  +  P+ ++ +GH N G+   W  EKV++          I   FPC+ WL   + DG IER+L     +R+                   L+K  +++ V+T    + GTN+ +F+++YG+ G + E  L     +   F+   +++F  E  DLG+ +KI + HD  +SG     W L+++ +++  + + Y F+C RWL  ++DD +I R +   G        P+ R      G A                               Y +T+ TG  +  G+    ++ L+G   +    ++   +  T+ F  G+ +  ++E+  + N+++V I ++G    S WYL+ + +    + +  NV   C  WL K   + +  R     D   T   K   Y IS+ TGDV    T+S ++++L+G + ++    L   D N +D FERG  D F LE  ++G I ++ I +D  G    WFL  + I      + Y F  N +L KN     +L ++L P  + +I+K   Y+V + T +V  AGTS+ V ++ YGE G +  L L +    +K F+    D F   +   +G++ + ++ H   GF   W ++ + ++ +  R
Sbjct:   45 YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTS---KSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASF---------NPMDMPRGNKYE--------VKVYTGDVIGAGTDADVFINIFGEYGDTGERRLEN---EKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTA----ITYIVTVFTGDVRGAGTKSKIYLVMYGARG-------NKNSGKIFLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFT----GIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKR-----------------LKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILL---NPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSG---SGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEG--------PTVRR---IMGMAR------------------------------YHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSAT--LKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQAD-GRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSS---RSKVFERASKDTFQL-EAADVGEVYKLRLGHTGEGFGPSWFVDTVWLRHLVVR 904          

HSP 10 Score: 339.732 bits (870), Expect = 6.408e-93
Identity = 259/914 (28.34%), Postives = 442/914 (48.36%), Query Frame = 1
Query:  532 NYLSNHDE----------ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFA-FKSVRT----KYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL-EKIL--PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIK-DKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI----PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVRE-IPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQI 3144
            NY S  DE           +Y+V   T DV+GAGT   ++I++ G+    P+++L          +      G+  +F +R +++G +  + IEHD      SW L  V + +++   + + F CN+WLS  + D +  R+L A F  +      KYE+ V TGD+  +GTD+ VFI++ G  G + + +L  E    F++G   +F++ A  +G + KI +  +  G  + W+L ++ I D+ N   +Y F    WL+ D  D    R+I  G  E   I     Y ++ +T +  GAG+ + IY+ ++G  G  +   I     F EG +F+       H      L  L ++ VG+ N G    WF  KV+I      + Q+    FPC  WL + K +GL E+ L   V    +R +K+ + + + T +   A T S  ++ + G + + D+IL  +   NK W     FK G  +   +EL + L    +I    +       W L+ + +       + +F C  WL  +    + +  +V +++              + V++ T +++ A T++ V L L+GD G T + ++          + G+  EF  E   +    ++R +HD  G+ S W L+++L+ +      D  +F C RWL    +D   VRE +P+     +K     +Y + + TG+   A TD+ V+I +YG+K DT  + L  S  N  + FE+G++DEF +E + +G I+++ +GHDS    + WF+  V I          TF  N W D ++ DG    EL  + ++     V YEVE+ TG V GAGT + V+++I+G+ G T  + L    +    FE  + D F++EA D+GE+  +R+ H   G G +WFVD +
Sbjct:   25 NYASEDDEGELEHEYYKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQL-------TSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN-FEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKR-KYDFPLNRWLALDEDDGKIQRDILVGGAETTAIT----YIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKI-----FLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQT----FPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEIL--LNPNNK-W-----FKPGIIEKFRIELPD-LGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDAN----EDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSATLKN---FRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQI-RVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLS---SRSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTV 896          

HSP 11 Score: 330.872 bits (847), Expect = 3.504e-90
Identity = 293/1094 (26.78%), Postives = 491/1094 (44.88%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK-------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLF----KENTQCFQRGQTSKFVIPATCVGPI-SKIRIRQDESGSKSSWYLDRVCITDL---KNPEWRYFFQCKNWLSKDHGDHATVREI-----------------RGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKV-IINDLDQSRVFEFPCGQWLSDVKGEG-LEKIL--------------------------------------PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVEL---NEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICK---YKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEF-LIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTT-----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISH---DDTGAGS---AWFVDQICVIVPKLGLKYIF-------------FLNKWLDSKTLEYDLDPSKIDKIDKTIP--YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK-SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            + V + T   K AGT   ++I++ G + +     LK  K ++ K         S +IF +   DLGDL  + + HD       W +  VE+      +   F C  WL+  ++DG + R+LF    ++T+       YEI + T D+  +GTD+ +FI + G   +  Q +      +E  Q F+R   S+F++    VG I  KIRI  + +G    W+   V I  L   K+      F C  WL+    D  T+RE+                 +  KE+        Y +  +T N PGAG+ A +YI I+G+    GE  +   +N+ + F+ G+     +    LG + KIK+ + N+     W++ KV I ND ++   F F CG+WLS  K +G LE++                                       P+    +      Y + ++TG    A+T SRA++ L G +         E + +IW++  + K GF+     E       +  + +I  G +       W ++++ +  P  G +    C  WL+  R    T  S V DL    +  +    +  + ++++T D+    T+S + + LYG NG T+++ +    ++ +      F  E+  +    K+R + D  G+   W LE+IL+     GD   F    WLS      + V E+ A    ++    + +   Y V + T + + AGTDANVFI I+GE GD+G   L  S  N NKFE+   D F   + + LG + K+++ HD+K    GW +  V + ++ +   +  F+C+CW   SEGDG TVR+           L + TYE+ ++TG   G  T  NV++ + G+   +    ++ S + +  F  G TD F+ ++  +G+I S+ + H   +D        AW V  I +   + G  Y F             +   +  +KT E     S   K+   +P  Y++ V TG    AGTD+ VF+ I+G +  T +  LK K  + FERG+ D F +   ++G ++K+R+ HD     SGW ++KV
Sbjct: 1177 FSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDK-----FERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLF-HAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDE-FLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDD--------ERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGIT--SRVFDLLDAMVVNI--GVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCA----VIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSA-NWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDV-KDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETG--NGGETRENVWLILEGRKNRSKEFLMENS-SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTE-----SFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKV 2237          

HSP 12 Score: 314.694 bits (805), Expect = 2.899e-85
Identity = 278/1083 (25.67%), Postives = 487/1083 (44.97%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAF----------------------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCGR---TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAK-EIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI------KNKDGFKEGSIFEHTLPLRQLG-TLKKIKVGNKNNGPQPRWFLNKV----IINDLDQSRVFEFPCGQWL--SDVKGEGLEKILPVKKLPERYQK-------YK----------YEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLS------------------------PSRPGCQTEVSLVEDLSKRKLKTVI----DFTEN----TWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVI--PADSK-LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTT----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKI-EAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTL-EYDLDPSKI-DKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKINAADVGVIQKIRIGH 3468
            Y+V V T +V  AGT   +Y++I G++      R        K     K   G T  F I   DLG L  I I HD    +  W L  ++I ++ N+  + F C  WL++ ++DG++SREL                               K   T + + + TG   ++GTD+ VFI+L G    TG++  ++  K N+  F+R     F +    +G + K+R+  D +G    W++D V + D  +      F C  WL+K+  D + +R++  A+ +         Y+I+ YT +   AG+ A+I+I I+G +              + K  F+  S     + L  +G  ++KI++G+ N G  P W  + V    ++ D D +    FPC +WL  S+   + + +++P     E+Y K       YK          Y ++I TGN   A T ++ Y+ + G   +  ++ L K E+         KF+ G  D   +E  + L  + +I    +      DW+++ + I+      E  F+CG WLS                         S P    E++L   ++   + TV     D+ +      + VS+ T   K+A+T+S+  + L G D+ ++  I +  P   +    GSV EF      VGI  K+   HD +   S W +E++ +     G +Y   CN WL+    D  T R        +V       Y++ ++TG+ +  GTD+N+F+ +YG  G T +  L        +FE+ Q D F++E + +   +K+++  D   +   WF++++++ +  N  +   F    W    +G    V E+        ++   +Y V VKT  + GAGTD+NVFI IFG+ GD+G + LK S  N NKFE   TD F   +   +G +  +R+ HD+ G    W +  + V        + F  + WL     D +T+ ++    +KI D++++T  Y+I + TG+     T   V++ + G+  ++ +  ++  S+   F +G  D F+ ++  +G I  + +GH
Sbjct: 1024 YEVQVVTGNVPKAGTDANVYLTIYGEEYGDTGER-----PLKKSDKSNKFEQGQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMT-LLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEV-DAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTN------KFERGTADTFIIEAAD-LGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKA---RFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILL-KNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQS-ANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETT-YEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGH 2084          

HSP 13 Score: 293.123 bits (749), Expect = 1.261e-78
Identity = 270/986 (27.38%), Postives = 439/986 (44.52%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDL-ESILIEHDGLEPKDSWLLQGVEIMNV----ENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKY----------------------EIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFK-EN-TQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR----------------------EIRGAKEIMGIASRT---------------RYKISFYTENKPGAGSHADIYIQIFGENGESDV---IDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGL-EKILPV--KKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKG--PEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTE----NTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS---KLDSGSVVEFR-TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSK---------LAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFD-SSEGDGLTVRELTGTT--------LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK 3210
            + Y++ + T+DV  AGT   I+I I G  A   + +     K  +K         S   F +   D+G++ E I I H+       W    V+I  +    +      F C+ WL+  ++D K  REL  +     KY                       + + TG++  +GTD+KV+I++ G  G + +  L K EN T  F+RG    F+I A  +G I KI++R D S   + WY+++V I +  N +  + F C  WLS    D    R                      EI  + ++  +   T                Y +S  T     A + +  +I + GE+ E      +D  + K GF  GS+ E  +    +G +KKI++G+    P+  W + ++ +    Q   +   C  WL+  +G+G+  ++  +    +     K  YEM + TG+     T S  ++ L G     ++  LDK         + A+F+    D   +E+ + ++P T++   I+  G   +WFL+ I++    TG    F  G+WLS  R G +T V         ++  VID  E     ++ V++ TSDI  A T++ V ++++G+NG +  + +   +   K +  +   F   ++  +G   KLR  HDN G    W+L  + +      + + F C+ WLS S  D  TVR+       I        Y++ I TGN     T  NV++ + G K  + + FL  +++    F KG  D F  +++ LG I+ + +GH ++         LA   W V K I   E    N   F C+C      +     V E+T TT         L  V YEV V TG   GAGTD+NVF+ IFG  GDTG  +LK  M  +N FE G+TD F +E  ++GE++ +R+ HD +G  S W V+++ V     G+  IF   +WLD K
Sbjct: 1306 VPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQF---FERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNED-EFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDK---------KKARFEREQNDTFIMEILD-IAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLS-QRKGKKTLVC--------EMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETGNG--GETRENVWLILEGRKNRSKE-FLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELA---WHV-KTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKK 2259          

HSP 14 Score: 266.544 bits (680), Expect = 1.602e-70
Identity = 217/847 (25.62%), Postives = 398/847 (46.99%), Query Frame = 1
Query: 5089 LQKKAYTIRVY-----TGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIID-KFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDV-GKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLAIDLAPIND--IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPT-KTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKT--YVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNL---FEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI---LTPSE 7563
            L+ + Y  RVY     TG     GT+ANVF+ ++GENG S + QL  SK+ +  FEK N+D F     ++G ++K+ I HDN+G     W+L  + + D K  +  Y F+C  WLSK + D++  R L                       S N +D  +                        Y + + TG     G+    ++ ++G     T   RL+  E + F  G+++   ++APD+  + ++ + +      + W+L+ I IE     + Y+     WL+    + K  R   +     T     ITY+++V TGDV   GT S ++L ++G +GN +   +      F+RG  D F +E+  +   + ++ + +   G    WF EK+ I    T     F  + +L   K  G  ++   ++  +    +KK  + + V T+++K AGT+S + ++ YG+ G + ++ L     NNK FK   +++F   ++  LG   + +VWH+     S WHLE + +     +  + F CN+WL   +DD +I RE+  E    PT +       Y VTV TG+ + AG   +V+   +G+   + + ++ N  +   LF + + D+  +  V +  ++ +++     +++       W+ + V V+     ++    F    W++  +     DG++  +  ++   + A ++  +      Y I + TG  +G  TD+ V+I L+G+ S++ K+ L+    NL   FE+G+ D+F LE +++G I ++ I HD +   + WFL  VQ++     K + +P N WL K++   ++   L PSE
Sbjct:   35 LEHEYYKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLT-SKSKS-AFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGL-NASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLL---------------------ASFNPMDMPRGNK---------------------YEVKVYTGDVIGAGTDADVFINIFGEYG-DTGERRLEN-EKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETT----AITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLN---PNNKWFKPGIIEKFRI-ELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEG---PTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRI-----RHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKD----DGQL--VRELLPSDSSATLKNFR------YHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSE 806          

HSP 15 Score: 252.292 bits (643), Expect = 3.257e-66
Identity = 220/836 (26.32%), Postives = 362/836 (43.30%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF---------------------AFKSVRTKYEIVVITGDL---------------------DDSGTDSKVFISLCGRTG-ISPQIQL-FKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR--EIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK---LDSGSVVEFR------TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED-----FSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT--FRCNCWFDSSEGDGLTVREL 2862
            D +LY V + T ++ GAGT   +YI+I GD  +     L K +    K        G+   F I  +DLG +  I + HD  +    W ++ VEI N  N+  +LF C  WLSL KEDG++ R  +                     A  S     +I  +TG +                      D+ TDS+ FI L G     S +I L +    + F RG   +F +    VG I KI +  D +  +S W ++ +C+  +     +Y   C  WL+KD GD  T R  ++  A  ++ I  +  Y+++ +T +  G G+ ++I++ ++G NG ++ + + K K  F+        + +  +    K+++     G +P WFL ++++ +++   +  F  G WLS  KG+   + ++  V    E  +   Y + + T +   A T +  ++I+ G       L   +S N  W    KF+   TD         L  L ++    +  G    W L  + +          F C  WLS S    QT    V D +    K   +  E T+ + I T +     T   V L+L G   ++ + ++   S+      G+   F        ++A + + +  R          +W+++ I +T+   G+ Y F C+  +    +      F   +   +    +    P+ KY+V + TG +  AGTDANVF+ I+G  GDTG R L     N   FE+G  D F +E ++LG + K++L HDS    SGW V+KV   E  N S  V   F C  W D   GDGLT R+L
Sbjct: 1458 DIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNK-----FERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLA-VPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAM-VVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSAN--W---NKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQT----VRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPV-KYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL--FERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKV---EVTNTSTGVATIFNCGRWLDKKRGDGLTWRDL 2269          

HSP 16 Score: 233.802 bits (595), Expect = 1.417e-60
Identity = 181/634 (28.55%), Postives = 305/634 (48.11%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDL-GDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRG----AKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQ--SRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAK--FKEGFTDVVPVE-LNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKL-DSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAV 2388
            I Y V V T DV+GAGT   IY+ + G + N    ++                 G T IF I  + L   L  + + H  +     W  + V I+         F C++WL   K DG + R+L+   S+R K      + + V T DL  +GT+S +FI + G+ G + +I L   N + F+ G   KF I    +G   KIR+  D+  S S W+L+R+ + +  N + +Y F C  WL  +  D+  VRE+       + IMG+A   RY ++  T    GAG+ A++Y+ +FG+    GE  + + +N  D F++G+  E T+    +  ++++++ +   G    W+L++V++ +  Q  S   EFPC +WL   K +G  + ++LP        + ++Y + + TG+ + AST SR Y+ L G +      D I+    +   N K  F+ G  D   +E LN  +  +  ++ G +  G +  WFL  + I  P+ G + +F    WL  ++   + EV L         K V       + V I+T D+  A T+++V + +YG+ GKT+ + + + SK+ +  S   F+ E A VG  YKLR  H   G   SW ++ + +   V
Sbjct:  296 ITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV--------FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEI-LLNPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKD-KYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMA---RYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDS-SATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKS-----DTIKQVLLVSDNNLKDYFERGRVDEFTLETLN--IGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLV------HYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTVWLRHLV 902          

HSP 17 Score: 233.032 bits (593), Expect = 2.601e-60
Identity = 190/680 (27.94%), Postives = 306/680 (45.00%), Query Frame = 1
Query: 5566 FAFETDENDTAQTEYIA--YTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISI-EMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL--VQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQV----QNLSTNKIWKYPCNEWLSKSKG---LWKILTPSE 7563
            +A E DE +     Y A  Y +   TG  +  G+    ++ L+G   L   + +L     + F  G+ +V  V   +V  I +V I ++     +SWYL+ + + +M      Y   C  WLSK  G+R+  R        M ++ +   Y + V TGDV   GT++ +F+ +FG  G++    L+  +DNFE+G  D F L+  D+G++ KI + ++  G    WFL ++ I +      Y F  N +L+ +    K     L    +     Y V V T +V+ AGT S + +  YG  G  +SG + L+        F   + D F     + L  LSR  V H N G +  W  E + +    T     FPC+ WL     D  I R+L      +  K    +  + + V T D K AG    ++   YG+K  +D+ ++  N    K F     +K ++    LG    I++      ++  S    W    + + N      Y F    W++ +E   E   E+       E P   R+      G+ +Y + V TG+  G GTDANV++ LFG+  ++G+R L   +   +LFE+G  D+F +E V +  + +++I HD     S W+LDRV V    Q  S N   ++PC  WL K K    L + L PS+
Sbjct:   26 YASEDDEGELEHEYYKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKL-QLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPM-DMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLE-----GGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLY--EMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPN---NKWFKPGIIEKFRIELPDLGRFYKIRVW-----HDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREM-----TAEGPTVRRI-----MGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNV--EFPCLRWLDKDKDDGQLVRELLPSD 676          

HSP 18 Score: 93.5893 bits (231), Expect = 5.048e-18
Identity = 51/131 (38.93%), Postives = 77/131 (58.78%), Query Frame = 1
Query: 7147 DISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKI-WKYPCNEWLSKSKG 7536
            ++ N   + ++  +E    K  V YE++  TG   G GTDANVFITLFGEN  S K  L  K ++ FE+G  D F +   ++G I K++IEHD++   + W+LD V V ++    + + + CN WLSK +G
Sbjct:   22 ELLNYASEDDEGELEHEYYKARV-YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEG 151          

HSP 19 Score: 93.2041 bits (230), Expect = 7.493e-18
Identity = 71/293 (24.23%), Postives = 132/293 (45.05%), Query Frame = 1
Query:  466 DCYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEH----DGLEPKD--SWLLQGVEIMNVENKRIWLFTCNHWLSL-----YKEDGKVSRELFAFKS-----VRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            DC+ S  + +   +R  +          +E  Y++ + T +  G  T   +++ + G K       ++   +            G+T  F      LGD+ S+ + H    D   PK   +W ++ + I  +E   ++ F C+  + L     Y +  +V++   +F S     V  KYE++V TG    +GTD+ VF+++ G  G + + +L ++    F+RG T +F +    +G + K+R+  D SG  S W +++V +T+         F C  WL K  GD  T R++
Sbjct: 1986 DCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRA------FRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGV-ATIFNCGRWLDKKRGDGLTWRDL 2269          

HSP 20 Score: 58.5362 bits (140), Expect = 2.070e-7
Identity = 37/124 (29.84%), Postives = 59/124 (47.58%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+V VTT    GAGT   ++++I G   +  +  LK+  ++           GST  F +   +LG+L  + +EHD       WL++ VE+ N       +F C  WL   + DG   R+LF
Sbjct: 2154 VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL-------FERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLF 2270          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Human
Match: LOXHD1 (lipoxygenase homology domains 1 [Source:HGNC Symbol;Acc:HGNC:26521])

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 473/1329 (35.59%), Postives = 736/1329 (55.38%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSG-----------ERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKD--------NKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-----DKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNY-FAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAG-MPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK-KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTPS 7560
            +Y F  NRWL  ++ D  +  EL P++     +   K + Y V++ TG+  G+GT A V++ I+G+ G +            ERA K+T             D F I AIDLG L KI+IRHDN+   A W+LD + + D ++E  Y FPC  WLA  +D G LS+++ P + +      +        N LD     + Q+DK   F+V + T  K  AGTDANV I L+G  +D+G+  LK S T+S+KFE  + + F V+  DLG+L K+R+GHDN+G    W +  VE++A  LG+   FPC  W++K++ DG++ R+L+     T    P + YEIT  TS+   AGT+AN++I +YG +  CT++  L  N    K   +      F V +EDV + IEKIRIGH+N G+   WH   V ++RLL +K+ +    FPC+RWLA  E+D    REL+P     +K ++ GS+  + + +++       L    Y+++++TG     GT+A V++ +YG+ GD+GER L  S+  T+KFE+   D F  EA DLG ++KI +RHDNS +   DW+++K+EI +  + + +LF C RWLS  K+D +++R  Y   Y G+RS+  S  +       ++ +      +  G  A    E        I Y +++ TG  KD  +    ++ L G  + ++  I L        F+ GS E   V   DV  IK++E+ ++G   ES W +  + + +PT+G  Y + C  WL+K  G+  TSR+F + D M+ N+  K+ Y ++V TGDV  GGT+S +F+ L+G  G++    LDK +  FER   D F +E+ D+    K+RI+ DG G RP WFLE++ + N +T +   F Y ++LS+  G KK L  ++  + D    ++ T Y V VKTS++  AGT + V +  +GE GDSG L LK     NK F+ N  D F FPDMLSLG L + +VWH+N G    WHL Y+++K+     ++ F C+ WLS ++ D Q  R+  C N  N       ET+YE+ + TG   N G    +VW +  G KN S +F+MEN+  +++ F + + D  +   +YLG++ ++ +G +  ++      +  W    + +  +     Y F     I +  K +    ++F+++   E    ++V+ L     VKYE++V TG   G GTDANVF+T+FG N ++GKR L QK RNLFE+G  D+F LE ++LG++ K+++EHD S + S W +++V+V N ST     + C  WL K +G    W+ L PS
Sbjct:  780 QYTFPANRWLDKNQADGRLEVELYPSE----VVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQT----------DTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLD--NLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEP------LDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCA-DWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPI-----IPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKG-KKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACAN--NKICDELEETTYEIVIETG---NGGETRENVWLILEGRKNRSKEFLMENS-SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYF--KVFEVTKTTE-SFASKVQSLVP---VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPS 2066          

HSP 2 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 553/1915 (28.88%), Postives = 920/1915 (48.04%), Query Frame = 1
Query: 2116 FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK--LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGD-EYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRE-LTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGD--TGNVQLKTSMTNKNKFEFGATDLFKIE-AEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLE-------YDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE----SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENF--NVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK-----FESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNAS---DKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP---DKVIRRGSMNALGESIDQVDSVANILQKK----AYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRL---QKLETNYFAPGSKEVISVEAPDV-ENIKQVEICNEGVDRESSWYLNSISIE--MPTKGKLYNVT--CGVWLSKFMGERKTSR------IFS---IQDKMMTNVSKK-------ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN---FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLA------------------------------IDLA----PINDIKK----TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGD-SGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKL-FSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGR-NLFEQGQEDKF-ILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            +    + V   T D++ A T++ V + L+G+NG +  + + + SK   + G+V  FR     VG+ YK+R +HDN+G N+SW L+ +++T        Y F CN WLS    D    R++ A+   +  P    KY+V++YTG+ + AGTDA+VFINI+GE GDTG+R L +   N   FEKG  D F+++A  LG + KI +GH++K   +GWF+ +++I E+        F  N W    E DG   R+ L G      +TY V V TG V+GAGT S +++ ++G  G+  +G + L+  +     F+ G TD+F IE A  +  +  + + H + G    WF +++ ++ P  G++  F  + WLD K  +       Y++   +  ++ K  P+ + V+T D+  AGT+S +FIQIYG+  +TD++ L   +  F+ G             +I+K RI    + P  G F    +                                        + S S   L +++     N D+Y F CNRWL ++EDDN IVRE+  T E       +   +Y V V TG   G+GTDANV+L +FG  GD+GER L N  +N+ + FE+ + D+F I+++ +  + +++IRHD    G+ WYLD VLV +E    SD   FPC  WL  +KD G L +++ P++ +                      L+NF  ++ + T     A TD+ V+I LYG+ +D+    +KQ L  S+      FE G  DEF ++  ++G + ++ IGHD++G +A W L  V+I   + G+ + FP N W+ K++ DG LE ELYP   + + K   + YE+   T +  GAGT+A VY+Q+YG    TE   L++ S   +++   T  TD F +   D+   + KIRI HDN G  + W L+++ +     + N  I Y FPC RWLA +E+DG + RELLP     V+ +      G   + +D++A  L++K     +++ + TG     GT+ANVF+ ++G   D+G   L  SKT++DKFE+++++ F  E +DLG ++K+ + HDN+G     WF+  +E+      +   F C RWL+K++DD  I R L+ A  Q             +Y                              T ++ Y IT+ T      G+    ++ +YG   + T    L   ++ +  +F   S     VE  DV E I+++ I +        W+ + + I   +P K     +T  C  WL+    ++KT R      IF+   ++D  +  V K+       + Y + + TG++   GT++ +++ ++G  G++    L K+E+    FERG  D F +E  D+G I KI++++D +     W++EK++I N++  + + F    +LS  K  G+ ++L                               +D++    P+ D  +      Y V V T   K A T S   +   GE  + S  + L  P +  + F    ++EF +   L +G + + ++ H+ +   S W +E + +        +   CN WL+    D    R     +A       +    YE+TV TGD    G   +++   YG    ++    E  +DK+K  F R   D   +  + +     +++     + +      +WF   + +KN+ T    +F    W+   +  +    E+            A ++E +      Y + V T    G GTDANVFI +FGEN +SG   L Q    N FE+   D F   + + LG + K+++ HD+      W L  V V++ S ++ + + C+ WLSKS+G
Sbjct:   40 YKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRG-NKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN---FEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVI-EDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRL-KKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPNNKWFKPG-------------IIEKFRI----ELPDLGRFYKIRVWHDK------------------------------------RSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREM--TAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNT-DLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSA--------------------TLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDT----IKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKL--VHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQTDTFTIYAIDL-GALTKIRIRHDNTGNRAGWFLDRIDI----TDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLA--LEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTG-KAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQ-----------TRLY------------------------------TPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYP-RGKRGFSRGSVEEF-YVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVK--VLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTE----EMQLDKKKARFEREQNDTFIMEILDIAPFTKMRI-----RIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMC-----------AVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEG 1788          

HSP 3 Score: 612.068 bits (1577), Expect = 1.340e-180
Identity = 330/870 (37.93%), Postives = 507/870 (58.28%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELT---GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT----LEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFK-----INAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            YE+V  TGD+  +GTD+ VFI+L G  G+SP++QL  ++   F++G    F +    VG I K+RI  D +G  +SWYLD V +TD+K P  RY+F C NWLSK  GD    R++  +   M +    +Y++  YT +  GAG+ AD++I IFGE G++    ++N KD F++G+     L    LG L KI VG+ N G    WFL++++I D+   R ++FP  +WL+  + +G +++ + V           Y + + TG+   A T S+ Y+++ G           +++ KI++E   F  G TD+  +EL   LSPL+ +  G    G N+ WF + +VI CP TGI+Q+F C NWL   +     E  L E +S RK +      +  W + ++T+D+K A TNS + + +YG  G+TD+I++ P +     G + +FR EL  +G  YK+R  HD   + S W+LE++ +   +N D+Y F CNRWL  + +D   VRE+ A GP + +   + +Y V + TG    AGTDANV++ ++G+ GDTG+R L +   NT+ FEKG  DEF IE+V +  + ++++ HD K +GSGW++D+V++ EE  P S++V F C  W D  + DG  VREL     +  L    Y + +KTG V GA TDS V+I+++G   DT    L  S  N K+ FE G  D F +E  +IG I  + I HD TG  ++WF+  + + VP+ G +Y F  N+WLD       LE +L PS++ +I K + Y++ ++TGDV  AGT ++V++QIYG+  KT+ L L S+S  FER ++D F+     I A D+G + KIRI HD     +GWFLD++
Sbjct:   45 YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAET--TAITYIVTVFTGDVRGAGTKSKIYLVMYGARGN-------KNSGKIFLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKR----LKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRI 901          

HSP 4 Score: 608.216 bits (1567), Expect = 2.769e-179
Identity = 543/2062 (26.33%), Postives = 917/2062 (44.47%), Query Frame = 1
Query: 1690 ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIF-CPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD-SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGD--TGDRFLTHSTTNTNKFEKGQMDEFLIE-AVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVRELTGTT-----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK------TLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVN--DESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQ-----VKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYP-----------------------QLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKS-KLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDK--FEKNNMDEFEWEAVDLGKVF-KIDIRHDNSGFFKKDWFLKKIEI----IDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLE--TNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIF----------------------SIQDKM-----------MTNVSKK---ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSL-----YPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVG----QKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNE-TSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVT-CVYLGELKNIKLGAVVNKNELYSDSK----KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRN-LFEQGQEDKFILECVDLGKIEKIKIEH--DDSRF----RSDWFLDRVQVQNLSTNKIWKYPCN 7512
            E Y+   YE+  +TG+   A T +  ++ L G   ++ +  K++ T+K     + F++G  DV  V  N  +  + ++    +  G N  W+LD +++    +  +   F C NWLS      Q    L+   +   +        N + V +YT D+  A T++ V + ++G+ G T +  +  +    + G+   F  +   +G   K+   H+N G ++ W L +I++    N  +Y F  NRWL+   +D    R+I   G           Y V ++TG+   AGT + +++ +YG +G+  +G  FL         F++G+ D F IE AV L  +S++ +GH +     GWF +KV+I     P   +  TF C+ W D  + DGL  R+L          L K  + + V T  ++ AGT+S +FI+I+GQ G T  + L     N   F+ G  + F+IE  D+G    IR+ HD   +GS W ++++ ++      KY F  N+WLD+         E   +   + +I     Y +TV TG++  AGTD+ V++ ++G    T +  L   ++ +D FE+GN D F I +  +  ++++RI HDGK  GSGW+LD+VL                                                   + E+ +   D   F C RWL  D+DD  +VRELLP+D      + LK  +Y + +KTG+  G+ TD+ V++ ++G   D+ ++ L  + +N  + FE   +D+F ++ +++G + ++ I HD++   A+W+L  V +    +  +Y FP   WL  N+  G L  +++P+                  ++ +  KL ++ V+++T     AGT A V++ +YGE   + ++ L    + S  FE  + D FQ     +   DLG L KIRI HDN+G  A W L +++I       ++ FPC  W++  + DG L REL P                        L+L   K     + +T  T  +K AGT+ANV+I ++G  D T  T L ++   S K +    ++F V   D+ D + K+R+GHDN G    W ++ V V      K       FPC RWLA++E+DG+I R+L   ++  R     +                  Y I +YT      GT+AN+F+ +YG +    +++ + +     K  FE+ +   F  E  D+G++  KI I H+N+G     W    ++I     DK   ET  F C+RWL+ S+DDKK  R L       E+     G  R +Y      LD                         + Y++ I TG     G+    ++ +YG     T    L K E  TN F  G+ +   +EA D+  I ++++ ++     + WY+  + I   T    +   CG WLS    + +  R+F                      ++  KM           M +  ++   I Y +SV TG      T+S  F+ L G     S      YP  K    F RG  + F +   DVG IKKI + +DG      W +E+L +   +    Y    N +L+K+ G     +    +D   +N   K  Y++ V T +V   GT S + +  YG  G + +++L   ++    F+  Q D FI  ++L +   ++ ++  +  G    W LE I +K + T     F    WLS     R+  + L+CE      +    E TSY V V T D   AG   +V+ + +GE   S    ++ + +  K F R++ D       + LG L  ++         ++ D+K     W  + V VK+ +  +T+ F+   W+       E DG+   + +     NK   +EL++     YEI++ T  GNG  T  NV++ L G  + S +  +    R   F +G  D F  + + LG I  + + H   + RF       W +  + +  +    ++ + C+
Sbjct:   38 EYYKARVYEVVTATGDVRGAGTDANVFITLFG---ENGLSPKLQLTSK---SKSAFEKGNVDVFRVRTN-NVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPR-----GNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGA----ETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVI---LCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNP---NNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVL---------------------------------------------------VREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSS----ATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPS------------------EVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLS---SRSKVFERASKDTFQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQ-KDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGD-LWKVRLGHDNTGKAPGWFVDWVEVDAPSLGK----CMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFV-----------------PYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTG-MNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKY-MKDGSLRQVYKEVEEPLD------------------------IVLYSVQIFTGNIPGAGTDAKVYITIYGDLG-DTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKR--GFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQL---DKKKARFEREQNDTFIM-EILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQ----RKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFPDMLSLGHLCKLR---------VWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKS----EGDGQT--VRDFACANNKI-CDELEE---TTYEIVIET--GNGGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCD 1914          

HSP 5 Score: 480.715 bits (1236), Expect = 4.058e-137
Identity = 395/1474 (26.80%), Postives = 650/1474 (44.10%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK----YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRG-----QTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR-----------------------TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGF-----TDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLD--DIVIFCP-QTGIEQ-SFICGNWLSPSRPGCQTEVSLV----------EDLSKRKLKTVIDFTENT--WMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI---------------PA-------------------TGP--GIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTF--RCNCWFDSSEGDGLTVR--ELTGTTLLG---KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKIDKT-----IPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSD--TFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG------AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQL 4614
            Y +++ T DV GA T   +YI + GDK++  +  L     + K +       G    F +   ++G++  ++I HD      SW L  V+I      + + F  N WL   + DG++  EL+  + V  +    YE+ + TGD+  +GT ++V++ + G  G   ++      ++ F+R      QT  F I A  +G ++KIRIR D +G+++ W+LDR+ ITD+ N E  Y+F C+ WL+ +  D    RE+    E   +                          T + ++  T  K  AG+ A+++I +FG   ++ +  +K    N D F+  SI   T+    LG L K+++G+ N G  P WF++ V ++     +   FPCG+WL+  + +G  +  +   +     Y  +  YE+ + T +   A T +  ++I+ G        D + +  K    N + ++ F          VEL +    + +I  G N  G N  W     DI    P + G E  +F C  WL+ S    +T   LV          +D S R++   ++   +   + V I+T +I  A T++KV + +YGD G T +  +       +K + G+   F  E A +G+ YK++ +HDNS   + W +EK+ +    N DE+ FLC RWLS   ED    R                 PA                   TGP    V+  PI  Y V + TG    A TD+  FI + GE  +   R           F +G ++EF +  + +G I KI+LGHD     S W V+++ +     P+    +   CNCW     GDG+T R  +L    ++    KV YE+ V TG V G GTDSN+F+ ++G  G T  +QL      K +FE    D F +E  DI     +RI  D  G+   WF+++I +     G   +F+   WL  +  +  L       ID+        Y + V T D++ AGTD+ VFI I+G++  +  L LK  ++   FER N D F   +   +G + K+R+ HD K    GW                                                      LS +  ++ +  + + F C+ WL+  E D   VR+    + K      L+E  Y + ++TGN  G  T  NV+L + G+   S E  ++N+  +    F + + D F   +I LG +  + + H             AW++  + + +    + Y F C   +   +   +            +K ++  K  +S     Q      + V V T  +  AGTDANV + ++G   D+G   LKQ +   N FE G+ D F ++  +LGEL+K+R+ HD+SG  + W + KVE+     G + +F C  W+ K + DG   R+L+P +
Sbjct:  686 YHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDY----FERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKG-KTEVLFLSSRSKVFERASKDTFQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNN-EITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYG-------CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCL---AVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKK---KARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGW-----------------------------------------------------HLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNK--ICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENS--SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKY------------FKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPSV 2067          

HSP 6 Score: 431.795 bits (1109), Expect = 1.564e-121
Identity = 331/1076 (30.76%), Postives = 529/1076 (49.16%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDL-GDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRG----AKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQ--SRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAK--FKEGFTDVVPVE-LNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKL-DSGSVVEFRTELAIV-----GIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPA-----------PI-----------CKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPS--NSVTFRCNCWFDSSEGDGLTVRELTGTTLLGK-----VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNK----FEFGATDLFKIEAEDIGEI-KSIRISHDDTGAGSAWFVDQICV--IVP-KLGLKYIFF-LNKWL-----DSKTLE----YDLDPSK-------------IDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            I Y V V T DV+GAGT   IY+ + G + N    ++                 G T IF I  + L   L  + + H  +     W  + V I+         F C++WL   K DG + R+L+   S+R K      + + V T DL  +GT+S +FI + G+ G + +I L   N + F+ G   KF I    +G   KIR+  D+  S S W+L+R+ + +  N + +Y F C  WL  +  D+  VRE+       + IMG+A   RY ++  T    GAG+ A++Y+ +FG+    GE  + + +N  D F++G+  E T+    +  ++++++ +   G    W+L++V++ +  Q  S   EFPC +WL   K +G  + ++LP        + ++Y + + TG+ + AST SR Y+ L G +      D I+    +   N K  F+ G  D   +E LN  +  +  ++ G +  G +  WFL  + I  P+ G + +F    WL  ++   + EV L         K V       + V I+T D+  A T+++V + +YG+ GKT+ + + + SK+ +  S   F+T+   +     G   K+R +HDN+G  + W L++I +T   N   Y F C RWL+   +D    RE+       V P            P+             + V I TG K  AGTDANVFI ++G + DTG   L  S TN++KFE+  ++ F +E + LG + K++LGHD+     GWFVD V   E   PS    +TF C  W   +E DG  +R+L    L  +     V YE+ + T  V  AGTD+N+FI I+G   D    Q K   TNK +    FE  +   F +E ED+GEI + IRI H++TG    W    + +  ++P K G + + F  ++WL     D KT+     YD+   K             +++    + Y + +FTG++  AGTD+KV+I IYG    T +  L   +++++ FERG  D F I AAD+GVI KI++ HD  K  + W+++KV
Sbjct:  296 ITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV--------FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEI-LLNPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKD-KYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMA---RYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDS-SATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKS-----DTIKQVLLVSDNNLKDYFERGRVDEFTLETLN--IGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLV------HYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWV---EVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYG--CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKV 1339          

HSP 7 Score: 425.246 bits (1092), Expect = 1.797e-119
Identity = 317/1107 (28.64%), Postives = 515/1107 (46.52%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIM--------NVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRT----KYEIVVITGDLDDSGTDSKVFISLCG-RTGISPQIQLFKENT--QCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN---------KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS--DVKGEGLEKILPVKK-----------------------LPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVIPADSK-----LDSGSVVEFRTELAIVG-IPYKLRAQHDNSGTNSSWNLEKI----LMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPA----------------TGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTG--------------------------TTLLGK----------VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDS------KTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVL 3513
            Y V V T +++GAGT   +Y+ + GD  +     L   + +           G+   F I    + ++  + I HDG      W L  V +         NVE      F C  WL   K+DG++ REL    S  T    +Y I + TGD+  + TDS+V+I L G ++    Q+ L  +N     F+RG+  +F +    +G I+++ I  D +G  +SW+L  V I   +  + +Y F    WL K+  D     E+    E++ I     Y++  +T +  GAG+ A +Y+QI+GE G+++V+ + +         KD F+  +    T+    LG L KI++ + N G +  WFL+++ I D++    + FPC +WL+  +  G+   ++LPV +                       L ++ +   + + I TG + +A T +  ++ L G +  D  +  ++S+      + KF+    ++  VE  + L  L ++  G +  GK   WF+D + +  P  G   +F CG WL+ +    + + S++ DL   +L+T +      + +++YTSD+  A T++ + +++YG D   T    +  + +      +  S   F  EL  VG I  K+R  H+N+G N  W+   +    L+      +   F C+RWL+ S +D  T+RE+                      + +P  I  Y VQI+TGN   AGTDA V+I IYG+ GDTG+R+L  S   TNKFE+G  D F+IEA  LG I KIKL HD+    + W+V+KV IW + N  +   F C  W    + DG   R     E TG                          +T+ G           + Y V V TGK + A TDS  FI + G+  +            K  F  G+ + F +   D+G IK I + HD     S W V+++C+ VP  G KY+   N WL         +  +DL  + +  I   + Y++TV+TGDV+  GTDS +F+ +YG +  T+++ L  K   FER   D F +   D+    K+RI  DG      WFL+++L
Sbjct:  555 YHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDL-----FEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVE------FPCLRWLDKDKDDGQLVRELLPSDSSATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGK-QYTFPANRWLDKNQADGRLEVELY-PSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQTDTF---TIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQ-DDTGMTLLKSSK---TNSDKFERDSIEIFTVETLD-LGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKN----EDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTN-EDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERIL 1635          

HSP 8 Score: 392.504 bits (1007), Expect = 3.048e-109
Identity = 300/1053 (28.49%), Postives = 507/1053 (48.15%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFA-FKSVRT----KYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL-EKIL--PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIK-DKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI----PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVRE-IPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKT-----SMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPS------------------------KIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK---SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            +Y+V   T DV+GAGT   ++I++ G+    P+++L          +      G+  +F +R +++G +  + IEHD      SW L  V + +++   + + F CN+WLS  + D +  R+L A F  +      KYE+ V TGD+  +GTD+ VFI++ G  G + + +L  E    F++G   +F++ A  +G + KI +  +  G  + W+L ++ I D+ N   +Y F    WL+ D  D    R+I  G  E   I     Y ++ +T +  GAG+ + IY+ ++G  G  +   I     F EG +F+       H      L  L ++ VG+ N G    WF  KV+I      + Q+    FPC  WL + K +GL E+ L   V    +R +K+ + + + T +   A T S  ++ + G + + D+IL  +   NK W     FK G  +   +EL + L    +I    +       W L+ + +       + +F C  WL  +    + +  +V +++              + V++ T +++ A T++ V L L+GD G T + ++          + G+  EF  E   +    ++R +HD  G+ S W L+++L+ +      D  +F C RWL    +D   VRE +P+     +K     +Y + + TG+   A TD+ V+I +YG+K DT  + L  S  N  + FE+G++DEF +E + +G I+++ +GHDS    + WF+  V I          TF  N W D ++ DG    EL  + ++     V YEVE+ TG V GAGT + V+++I+G+ G T  + L +        +K+ F+   TD F I A D+G +  IRI HD+TG  + WF+D+I +      + Y F   +WL    D   L  +L P                          +++ DK+  + +T+ TG   +AGTD+ VFI ++G    T    LKS    SD FER + ++F +   D+G + K+R+GHD      GWF+D V
Sbjct:   44 VYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQL-------TSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN-FEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKR-KYDFPLNRWLALDEDDGKIQRDILVGGAETTAIT----YIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKI-----FLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQT----FPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEIL--LNPNNK-W-----FKPGIIEKFRIELPD-LGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDAN----EDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSATLKNF---RYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQI-RVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQ---TDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWV 1054          

HSP 9 Score: 322.013 bits (824), Expect = 1.362e-87
Identity = 279/1085 (25.71%), Postives = 491/1085 (45.25%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAF----------------------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCGR---TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAK-EIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI------KNKDGFKEGSIFEHTLPLRQLG-TLKKIKVGNKNNGPQPRWFLNKV----IINDLDQSRVFEFPCGQWL--SDVKGEGLEKILPVKKLPERYQK-------YK----------YEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLS------------------------PSRPGCQTEVSLVEDLSKRKLKTVI----DFTEN----TWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVI--PADSK-LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTT----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKI-EAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTL-EYDLDPSKI-DKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKINAADVGVIQKIRIGH 3468
            + Y+V + T DV GAGTS  +Y+ I G+K     + L    K  ++ +        T  F I   DLG L  I I HD    +  W L  ++I ++ N+  + F C  WL++ ++DG++SREL                               K   T + + + TG   ++GTD+ VFI+L G    TG++  ++  K N+  F+R     F +    +G + K+R+  D +G    W++D V + D  +      F C  WL+K+  D + +R++  A+ +         Y+I+ YT +   AG+ A+I+I I+G +              + K  F+  S     + L  +G  ++KI++G+ N G  P W  + V    ++ D D +    FPC +WL  S+   + + +++P     E+Y K       YK          Y ++I TGN   A T ++ Y+ + G   +  ++ L K E+         KF+ G  D   +E  + L  + +I    +      DW+++ + I+      E  F+CG WLS                         S P    E++L   ++   + TV     D+ +      + VS+ T   K+A+T+S+  + L G D+ ++  I +  P   +    GSV EF      VGI  K+   HD +   S W +E++ +     G +Y   CN WL+    D  T R        +V       Y++ ++TG+ +  GTD+N+F+ +YG  G T +  L        +FE+ Q D F++E + +   +K+++  D   +   WF++++++ +  N  +   F    W    +G    V E+        ++   +Y V VKT  + GAGTD+NVFI IFG+ GD+G + LK S  N NKFE   TD F   +   +G +  +R+ HD+ G    W +  + V        + F  + WL     D +T+ ++    +KI D++++T  Y+I + TG+     T   V++ + G+  ++ +  ++  S+   F +G  D F+ ++  +G I  + +GH
Sbjct:  814 VHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTF---QTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMT-LLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEV-DAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTN------KFERGTADTFIIEAAD-LGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKA---RFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILL-KNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQS-ANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEET-TYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGH 1878          

HSP 10 Score: 293.508 bits (750), Expect = 8.023e-79
Identity = 270/986 (27.38%), Postives = 439/986 (44.52%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDL-ESILIEHDGLEPKDSWLLQGVEIMNV----ENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKY----------------------EIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFK-EN-TQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR----------------------EIRGAKEIMGIASRT---------------RYKISFYTENKPGAGSHADIYIQIFGENGESDV---IDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGL-EKILPV--KKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKG--PEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTE----NTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS---KLDSGSVVEFR-TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSK---------LAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFD-SSEGDGLTVRELTGTT--------LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK 3210
            + Y++ + T+DV  AGT   I+I I G  A   + +     K  +K         S   F +   D+G++ E I I H+       W    V+I  +    +      F C+ WL+  ++D K  REL  +     KY                       + + TG++  +GTD+KV+I++ G  G + +  L K EN T  F+RG    F+I A  +G I KI++R D S   + WY+++V I +  N +  + F C  WLS    D    R                      EI  + ++  +   T                Y +S  T     A + +  +I + GE+ E      +D  + K GF  GS+ E  +    +G +KKI++G+    P+  W + ++ +    Q   +   C  WL+  +G+G+  ++  +    +     K  YEM + TG+     T S  ++ L G     ++  LDK         + A+F+    D   +E+ + ++P T++   I+  G   +WFL+ I++    TG    F  G+WLS  R G +T V         ++  VID  E     ++ V++ TSDI  A T++ V ++++G+NG +  + +   +   K +  +   F   ++  +G   KLR  HDN G    W+L  + +      + + F C+ WLS S  D  TVR+       I        Y++ I TGN     T  NV++ + G K  + + FL  +++    F KG  D F  +++ LG I+ + +GH ++         LA   W V K I   E    N   F C+C      +     V E+T TT         L  V YEV V TG   GAGTD+NVF+ IFG  GDTG  +LK  M  +N FE G+TD F +E  ++GE++ +R+ HD +G  S W V+++ V     G+  IF   +WLD K
Sbjct: 1100 VPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQF---FERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNED-EFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDK---------KKARFEREQNDTFIMEILD-IAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLS-QRKGKKTLVC--------EMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETGNG--GETRENVWLILEGRKNRSKE-FLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELA---WHV-KTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKK 2053          

HSP 11 Score: 266.544 bits (680), Expect = 1.495e-70
Identity = 217/847 (25.62%), Postives = 398/847 (46.99%), Query Frame = 1
Query: 5089 LQKKAYTIRVY-----TGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIID-KFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDV-GKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLAIDLAPIND--IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPT-KTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKT--YVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNL---FEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI---LTPSE 7563
            L+ + Y  RVY     TG     GT+ANVF+ ++GENG S + QL  SK+ +  FEK N+D F     ++G ++K+ I HDN+G     W+L  + + D K  +  Y F+C  WLSK + D++  R L                       S N +D  +                        Y + + TG     G+    ++ ++G     T   RL+  E + F  G+++   ++APD+  + ++ + +      + W+L+ I IE     + Y+     WL+    + K  R   +     T     ITY+++V TGDV   GT S ++L ++G +GN +   +      F+RG  D F +E+  +   + ++ + +   G    WF EK+ I    T     F  + +L   K  G  ++   ++  +    +KK  + + V T+++K AGT+S + ++ YG+ G + ++ L     NNK FK   +++F   ++  LG   + +VWH+     S WHLE + +     +  + F CN+WL   +DD +I RE+  E    PT +       Y VTV TG+ + AG   +V+   +G+   + + ++ N  +   LF + + D+  +  V +  ++ +++     +++       W+ + V V+     ++    F    W++  +     DG++  +  ++   + A ++  +      Y I + TG  +G  TD+ V+I L+G+ S++ K+ L+    NL   FE+G+ D+F LE +++G I ++ I HD +   + WFL  VQ++     K + +P N WL K++   ++   L PSE
Sbjct:   35 LEHEYYKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLT-SKSKS-AFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGL-NASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLL---------------------ASFNPMDMPRGNK---------------------YEVKVYTGDVIGAGTDADVFINIFGEYG-DTGERRLEN-EKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETT----AITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLN---PNNKWFKPGIIEKFRI-ELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEG---PTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRI-----RHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKD----DGQL--VRELLPSDSSATLKNFR------YHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSE 806          

HSP 12 Score: 252.677 bits (644), Expect = 2.238e-66
Identity = 220/836 (26.32%), Postives = 362/836 (43.30%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF---------------------AFKSVRTKYEIVVITGDL---------------------DDSGTDSKVFISLCGRTG-ISPQIQL-FKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR--EIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK---LDSGSVVEFR------TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED-----FSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT--FRCNCWFDSSEGDGLTVREL 2862
            D +LY V + T ++ GAGT   +YI+I GD  +     L K +    K        G+   F I  +DLG +  I + HD  +    W ++ VEI N  N+  +LF C  WLSL KEDG++ R  +                     A  S     +I  +TG +                      D+ TDS+ FI L G     S +I L +    + F RG   +F +    VG I KI +  D +  +S W ++ +C+  +     +Y   C  WL+KD GD  T R  ++  A  ++ I  +  Y+++ +T +  G G+ ++I++ ++G NG ++ + + K K  F+        + +  +    K+++     G +P WFL ++++ +++   +  F  G WLS  KG+   + ++  V    E  +   Y + + T +   A T +  ++I+ G       L   +S N  W    KF+   TD         L  L ++    +  G    W L  + +          F C  WLS S    QT    V D +    K   +  E T+ + I T +     T   V L+L G   ++ + ++   S+      G+   F        ++A + + +  R          +W+++ I +T+   G+ Y F C+  +    +      F   +   +    +    P+ KY+V + TG +  AGTDANVF+ I+G  GDTG R L     N   FE+G  D F +E ++LG + K++L HDS    SGW V+KV   E  N S  V   F C  W D   GDGLT R+L
Sbjct: 1252 DIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNK-----FERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLA-VPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAM-VVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSAN--W---NKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQT----VRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPV-KYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL--FERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKV---EVTNTSTGVATIFNCGRWLDKKRGDGLTWRDL 2063          

HSP 13 Score: 233.032 bits (593), Expect = 2.192e-60
Identity = 190/680 (27.94%), Postives = 306/680 (45.00%), Query Frame = 1
Query: 5566 FAFETDENDTAQTEYIA--YTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISI-EMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL--VQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQV----QNLSTNKIWKYPCNEWLSKSKG---LWKILTPSE 7563
            +A E DE +     Y A  Y +   TG  +  G+    ++ L+G   L   + +L     + F  G+ +V  V   +V  I +V I ++     +SWYL+ + + +M      Y   C  WLSK  G+R+  R        M ++ +   Y + V TGDV   GT++ +F+ +FG  G++    L+  +DNFE+G  D F L+  D+G++ KI + ++  G    WFL ++ I +      Y F  N +L+ +    K     L    +     Y V V T +V+ AGT S + +  YG  G  +SG + L+        F   + D F     + L  LSR  V H N G +  W  E + +    T     FPC+ WL     D  I R+L      +  K    +  + + V T D K AG    ++   YG+K  +D+ ++  N    K F     +K ++    LG    I++      ++  S    W    + + N      Y F    W++ +E   E   E+       E P   R+      G+ +Y + V TG+  G GTDANV++ LFG+  ++G+R L   +   +LFE+G  D+F +E V +  + +++I HD     S W+LDRV V    Q  S N   ++PC  WL K K    L + L PS+
Sbjct:   26 YASEDDEGELEHEYYKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKL-QLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPM-DMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLE-----GGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLY--EMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPN---NKWFKPGIIEKFRIELPDLGRFYKIRVW-----HDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREM-----TAEGPTVRRI-----MGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNV--EFPCLRWLDKDKDDGQLVRELLPSD 676          

HSP 14 Score: 93.9745 bits (232), Expect = 4.695e-18
Identity = 51/131 (38.93%), Postives = 77/131 (58.78%), Query Frame = 1
Query: 7147 DISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKI-WKYPCNEWLSKSKG 7536
            ++ N   + ++  +E    K  V YE++  TG   G GTDANVFITLFGEN  S K  L  K ++ FE+G  D F +   ++G I K++IEHD++   + W+LD V V ++    + + + CN WLSK +G
Sbjct:   22 ELLNYASEDDEGELEHEYYKARV-YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEG 151          

HSP 15 Score: 93.2041 bits (230), Expect = 7.840e-18
Identity = 71/293 (24.23%), Postives = 132/293 (45.05%), Query Frame = 1
Query:  466 DCYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEH----DGLEPKD--SWLLQGVEIMNVENKRIWLFTCNHWLSL-----YKEDGKVSRELFAFKS-----VRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            DC+ S  + +   +R  +          +E  Y++ + T +  G  T   +++ + G K       ++   +            G+T  F      LGD+ S+ + H    D   PK   +W ++ + I  +E   ++ F C+  + L     Y +  +V++   +F S     V  KYE++V TG    +GTD+ VF+++ G  G + + +L ++    F+RG T +F +    +G + K+R+  D SG  S W +++V +T+         F C  WL K  GD  T R++
Sbjct: 1780 DCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRA------FRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGV-ATIFNCGRWLDKKRGDGLTWRDL 2063          

HSP 16 Score: 58.9214 bits (141), Expect = 1.945e-7
Identity = 37/124 (29.84%), Postives = 59/124 (47.58%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+V VTT    GAGT   ++++I G   +  +  LK+  ++           GST  F +   +LG+L  + +EHD       WL++ VE+ N       +F C  WL   + DG   R+LF
Sbjct: 1948 VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL-------FERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLF 2064          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Human
Match: LOXHD1 (lipoxygenase homology domains 1 [Source:HGNC Symbol;Acc:HGNC:26521])

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 466/1321 (35.28%), Postives = 713/1321 (53.97%), Query Frame = 1
Query: 3691 IDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKN-GDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKD--------NKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-----DKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNY-FAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAG-MPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK-KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTPS 7560
            I+++ F  +RWLA  ++DN +V EL+P  + G P  N     Y V V TGN   +GTDANV+LTI+G+  GD+GER LK +  +  NKFE+   D F I AIDLG L KI+IRHDN+   A W+LD + + D ++E  Y FPC  WLA  +D G LS+++ P + +      +        N LD     + Q+DK   F+V + T  K  AGTDANV I L+G  +D+G+  LK S T+S+KFE  + + F V+  DLG+L K+R+GHDN+G    W +  VE++A  LG+   FPC  W++K++ DG++ R+L+     T    P + YEIT  TS+   AGT+AN++I +YG +  CT++  L  N    K   +      F V +EDV + IEKIRIGH+N G+   WH   V ++RLL +K+ +    FPC+RWLA  E+D    REL+P     +K ++ GS+  + + +++       L    Y+++++TG     GT+A V++ +YG+ GD+GER L  S+  T+KFE+   D F  EA DLG ++KI +RHDNS +   DW+++K+EI +  + + +LF C RWLS  K+D +++R  Y   Y G+RS+  S  +       ++ +      +  G  A    E        I Y +++ TG  KD  +    ++ L G  + ++  I L        F+ GS E   V   DV  IK++E+                         LY +T  VW    +G                                   GGT+S +F+ L+G  G++    LDK +  FER   D F +E+ D+    K+RI+ DG G RP WFLE++ + N +T +   F Y ++LS+  G KK L  ++  + D    ++ T Y V VKTS++  AGT + V +  +GE GDSG L LK     NK F+ N  D F FPDMLSLG L + +VWH+N G    WHL Y+++K+     ++ F C+ WLS ++ D Q  R+  C N  N       ET+YE+ + TG   N G    +VW +  G KN S +F+MEN+  +++ F + + D  +   +YLG++ ++ +G +  ++      +  W    + +  +     Y F     I +  K +    ++F+++   E    ++V+ L     VKYE++V TG   G GTDANVF+T+FG N ++GKR L QK RNLFE+G  D+F LE ++LG++ K+++EHD S + S W +++V+V N ST     + C  WL K +G    W+ L PS
Sbjct:  987 IEQHKFEAHRWLARGKEDNELVVELVPAGKPG-PERN----TYEVQVVTGNVPKAGTDANVYLTIYGEEYGDTGERPLKKS--DKSNKFEQGQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLD--NLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEP------LDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWC-ADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPI-----IPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIEV-------------------------LYEMT--VWTGDVVG-----------------------------------GGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKG-KKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACAN--NKICDELEETTYEIVIETG---NGGETRENVWLILEGRKNRSKEFLMENS-SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYF--KVFEVTKTTE-SFASKVQSLVP---VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPS 2210          

HSP 2 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 330/865 (38.15%), Postives = 508/865 (58.73%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELT---GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT----LEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            YE+V  TGD+  +GTD+ VFI+L G  G+SP++QL  ++   F++G    F +    VG I K+RI  D +G  +SWYLD V +TD+K P  RY+F C NWLSK  GD    R++  +   M +    +Y++  YT +  GAG+ AD++I IFGE G++    ++N KD F++G+     L    LG L KI VG+ N G    WFL++++I D+   R ++FP  +WL+  + +G +++ + V           Y + + TG+   A T S+ Y+++ G           +++ KI++E   F  G TD+  +EL   LSPL+ +  G    G N+ WF + +VI CP TGI+Q+F C NWL   +     E  L E +S RK +      +  W + ++T+D+K A TNS + + +YG  G+TD+I++ P +     G + +FR EL  +G  YK+R  HD   + S W+LE++ +   +N D+Y F CNRWL  + +D   VRE+ A GP + +   + +Y V + TG    AGTDANV++ ++G+ GDTG+R L +   NT+ FEKG  DEF IE+V +  + ++++ HD K +GSGW++D+V++ EE  P S++V F C  W D  + DG  VREL     +  L    Y + +KTG V GA TDS V+I+++G   DT    L  S  N K+ FE G  D F +E  +IG I  + I HD TG  ++WF+  + + VP+ G +Y F  N+WLD       LE +L PS++ +I K + Y++ ++TGDV  AGT ++V++QIYG+  KT+ L L S+S  FER ++D F++ AADVG + K+R+GH G+  G  WF+D V
Sbjct:   45 YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAET--TAITYIVTVFTGDVRGAGTKSKIYLVMYGARGN-------KNSGKIFLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKR----LKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTV 896          

HSP 3 Score: 478.019 bits (1229), Expect = 7.519e-136
Identity = 313/963 (32.50%), Postives = 502/963 (52.13%), Query Frame = 1
Query: 2116 FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK--LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGD-EYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRE-LTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGD--TGNVQLKTSMTNKNKFEFGATDLFKIE-AEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLE-------YDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE----SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENF--NVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK-----FESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKL-QTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANK 4926
            +    + V   T D++ A T++ V + L+G+NG +  + + + SK   + G+V  FR     VG+ YK+R +HDN+G N+SW L+ +++T        Y F CN WLS    D    R++ A+   +  P    KY+V++YTG+ + AGTDA+VFINI+GE GDTG+R L +   N   FEKG  D F+++A  LG + KI +GH++K   +GWF+ +++I E+        F  N W    E DG   R+ L G      +TY V V TG V+GAGT S +++ ++G  G+  +G + L+  +     F+ G TD+F IE A  +  +  + + H + G    WF +++ ++ P  G++  F  + WLD K  +       Y++   +  ++ K  P+ + V+T D+  AGT+S +FIQIYG+  +TD++ L   +  F+              G+I+K RI    + P  G F    +                                        + S S   L +++     N D+Y F CNRWL ++EDDN IVRE+  T E       +   +Y V V TG   G+GTDANV+L +FG  GD+GER L N  +N+ + FE+ + D+F I+++ +  + +++IRHD    G+ WYLD VLV +E    SD   FPC  WL  +KD G L +++ P++ +                      L+NF  ++ + T     A TD+ V+I LYG+ +D+    +KQ L  S+      FE G  DEF ++  ++G + ++ IGHD++G +A W L  V+I   + G+ + FP N W+ K++ DG LE ELYP   + + K   + YE+   T +  GAGT+A VY+Q+YG    TE   L   S +SK+ +    D F +   DV + + K+R+GH  +G G +W ++ V ++ L+  +
Sbjct:   40 YKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRG-NKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN---FEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVI-EDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRL-KKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPNNKWFK-------------PGIIEKFRI----ELPDLGRFYKIRVWHDK------------------------------------RSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREM--TAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNT-DLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSA--------------------TLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDT----IKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKL--VHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFL---SSRSKVFERASKDTFQLEAADVGE-VYKLRLGHTGEGFGPSWFVDTVWLRHLVVRE 905          

HSP 4 Score: 397.127 bits (1019), Expect = 1.604e-110
Identity = 265/862 (30.74%), Postives = 428/862 (49.65%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGE--TNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDL-GELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNET--YLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKN--LKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKL 6249
            RY+F CN WL+  E D    R+LL +    NP+   +  KY V V TG+  G+GTDA+VF+ IFG+ GD+GER L+N  DN    FE+ + D+F++ A DLG L KI + H+N  G A W+L  +++ D  ++  Y FP   WLA ++D G + +DI                         E     + V V+T     AGT + +++++YG     +SG I L+  +     F+ G  D F ++   L   L ++ +GH N G N  W   KV I     G    FPC+ W+ + K DG +ER+LY  +SL   +  K  + +   T++ K AGTN+ ++IQ+YG+   T++  LN   +    + G  + F + + D+     KIR+ HD +  GS WHLE++ +   L NK+K   Y F CNRWL  +E+D  I RE           M A G ++ ++  +A       Y + V TG     GT+ANV+L ++G+ GD+GER L + + +TD FEK N DEF  E+V +  V ++ IRHD  G     W+L ++ + ++   E+    F C RWL K KDD ++ R L            PS                                + +A  +   Y I++ TG      +    +++LYG K+  +K  ++       +YF  G  +  ++E  ++ NI ++ I ++     +SW+L S+ I +P +GK Y      WL K   + +      +    +  + K + Y + + TGDV   GT++ +++Q++G +G + +  L      FER  +D F+LE  DVG++ K+R+ + G G  P WF++ +
Sbjct:  137 RYYFNCNNWLSKVEGDRQWCRDLLAS---FNPMDMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN----FEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGA--------------------ETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLN--PNNKWFKPGIIEKFRIELPDL-GRFYKIRVWHDKRSSGSGWHLERMTLMNTL-NKDK---YNFNCNRWLDANEDDNEIVRE-----------MTAEGPTVRRIMGMAR------YHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKG-SGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELL-----------PS--------------------------------DSSATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLE--VELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTV 896          

HSP 5 Score: 381.719 bits (979), Expect = 9.241e-106
Identity = 285/1010 (28.22%), Postives = 480/1010 (47.52%), Query Frame = 1
Query: 2890 TYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVI-VPKLGLKYIFFLNKWLD--------SKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNG--DSGERALKNTVDNSVNKFEEKSLDKFLIK-AIDLGTLEKIKIRHDNSNGGAAWYLDYV--LVNDESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGR-NDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGETG--TNANVFLKVYGENGDSGERQLVDSKTHT-DKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSI 5865
             YEV   TG V+GAGTD+NVFI +FG+ G +  +QL +   +K+ FE G  D+F++   ++G I  +RI HD+TG  ++W++D + V  + +  L+Y F  N WL          + L    +P  + + +K   Y++ V+TGDV+ AGTD+ VFI I+G+   T +  L+++ D FE+G ED F ++A D+G + KI +GH+ K   +GWF                                                     LSQI  ++  N  +Y F  NRWLA DEDD  I R++L    +   ++      Y+V V TG+  G+GT + ++L ++G  G  +SG+  L+  V      F+    D F I+ A+ L  L ++ + H N      W+ + V  L      +  FPC +WL   K  G + + ++              L K + K +       +++ V+TT    AGT++ + I +YG+   +  I L     ++  F+ G  ++F+++  DLG   KIR+ HD     + WHL ++ +        + F CN W+  ++ D  + RE+  +           +Y +T  T   +GAGT+ANVY+ ++G   D  E+   N  ++    + G  D F +    + + + ++RI HD KG GS W+L++VLV+     + +S   EFPC RWL +D++DG + RELLP                   DS A  L+   Y I + TG  +G  T++ V++K+YG+  D+ ++ L+ S  +  D FE+  +DEF  E +++G + ++ I HD++G     WFL  ++I      + Y F   RWL K++ D +++  LY           PS             ++ QK                      + Y + I TG     G+S   +M++YG K  KT ++ L    +  F   SK+   +EA DV  + ++ + + G     SW+++++
Sbjct:   44 VYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSK--SKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRGNK---YEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWF-----------------------------------------------------LSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAIT------YIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV------FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEM----------VSLRKKRLKKFP------WSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLN---PNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRN-VRRVRIRHDGKGSGSGWYLDRVLVRE--EGQPESDNVEFPCLRWLDKDKDDGQLVRELLPS------------------DSSAT-LKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTG-MHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELY-----------PS-----------EVVEIQK---------------------LVHYEVEIWTGDVGGAGTSARVYMQIYGEKG-KTEVLFLSS-RSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTV 896          

HSP 6 Score: 365.155 bits (936), Expect = 1.040e-100
Identity = 262/962 (27.23%), Postives = 459/962 (47.71%), Query Frame = 1
Query: 1690 ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIF-CPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS-KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGD--TGDRFLTHSTTNTNKFEKGQMDEFLIE-AVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVRELTGTT-----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK------TLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVN--DESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKV 4506
            E Y+   YE+  +TG+   A T +  ++ L G   ++ +  K++ T+K     + F++G  DV  V  N  +  + ++    +  G N  W+LD +++    +  +   F C NWLS      Q    L+   +   +        N + V +YT D+  A T++ V + ++G+ G T +  +  +    + G+   F  +   +G   K+   H+N G ++ W L +I++    N  +Y F  NRWL+   +D    R+I   G           Y V ++TG+   AGT + +++ +YG +G+  +G  FL         F++G+ D F IE AV L  +S++ +GH +     GWF +KV+I     P   +  TF C+ W D  + DGL  R+L          L K  + + V T  ++ AGT+S +FI+I+GQ G T  + L     N   F+ G  + F+IE  D+G    IR+ HD   +GS W ++++ ++      KY F  N+WLD+         E   +   + +I     Y +TV TG++  AGTD+ V++ ++G    T +  L   ++ +D FE+GN D F I +  +  ++++RI HDGK  GSGW+LD+VL                                                   + E+ +   D   F C RWL  D+DD  +VRELLP+D      + LK  +Y + +KTG+  G+ TD+ V++ ++G   D+ ++ L  + +N  + FE   +D+F ++ +++G + ++ I HD++   A+W+L  V +    +  +Y FP   WL  N+  G L  +++P+                  ++ +  KL ++ V+++T     AGT A V++ +YGE   + ++ L    + S  FE  + D FQ++  D+GE+ K+R+GH   G    W +  V
Sbjct:   38 EYYKARVYEVVTATGDVRGAGTDANVFITLFG---ENGLSPKLQLTSK---SKSAFEKGNVDVFRVRTN-NVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPR-----GNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGA----ETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVI---LCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNP---NNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVL---------------------------------------------------VREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSS----ATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPS------------------EVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLS---SRSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTV 896          

HSP 7 Score: 359.762 bits (922), Expect = 4.650e-99
Identity = 269/988 (27.23%), Postives = 467/988 (47.27%), Query Frame = 1
Query: 4579 DGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVE-APDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWL----SKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKK----TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRS--WKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIM---ENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKI 7494
            +G LE E Y         + ++ YE+ T T + +GAGT+ANV+I ++G N  + K  L + S KS  + G  DVF V   +V   I K+RI HDN GL ++W+L+ V+V  +   K   + Y F CN WL++ E D    R+LL        S N +           ++ +   Y ++VYTG     GT+A+VF+ ++GE GD+GER+L + K   D FEK   D F  +A DLG++ KI++ H+N G     WFL +I I D  +   Y F   RWL+  +DD KIQR + + G                                             A+T  I Y +T+ TG  +  G+    ++ +YG +  K +      LE   F  G  ++  +E A  +  + +V + +  V     W+   + I  P  G      C  WL    +  + ER+   + S++ K +    KK  + + V T D+ + GTNS +F+Q++G +G +    L+ N   F+ G  + F++E+ D+G+  KIR+ +D       W LE++ + N    + Y F  N +L  N    + +    A    +++      Y V V T  ++ AGT + V +  +G+ GD+G+  L     N   F+    DEF   + +++ ++ R ++ H+  G  S W+L+ + ++E     S   +FPC +WL    DD Q+ REL+    P+ +  +     Y +++ TGD   A     V+   YG+K+ + K ++   +NN+  +  F R   D+  +  + +G +  + +G     ++       WF   V ++     K Y F    W++ ++     + E++           + V E++K  +V YE+ + TG   G GT A V++ ++GE  ++    L  + + +FE+  +D F LE  D+G++ K+++ H    F   WF+D V +++L   ++
Sbjct:   32 EGELEHEYY---------KARV-YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKS-KSAFEKGNVDVFRVRTNNVG-LIYKVRIEHDNTGLNASWYLDHVIVTDM---KRPHLRYYFNCNNWLSKVEGDRQWCRDLL-------ASFNPM-----------DMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEK---DNFEKGAEDRFILDAPDLGQLMKINVGHNNKGG-SAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGG---------------------------------------------AETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIF--LEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRL----KKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTI-ESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELL----PSDSSATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNL--KDYFERGRVDEFTLETLNIGNINRLVIG-----HDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELY----------PSEVVEIQK--LVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSK-VFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTVWLRHLVVREV 906          

HSP 8 Score: 350.903 bits (899), Expect = 2.264e-96
Identity = 272/969 (28.07%), Postives = 467/969 (48.19%), Query Frame = 1
Query: 3817 YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESD---EYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGC-----TDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHD--NSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGP-KNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNV--TCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNS---SLYPLDKN-EDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAP--INDIKK-TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTR 6657
            Y V   TG+  G+GTDANVF+T+FG+NG S +  L +    S + FE+ ++D F ++  ++G + K++I HDN+   A+WYLD+V+V D       Y F C +WL+  +      +D+  +          N +D  +   Y+        VKVYT   + AGTDA+V I ++GE  D+G   L+      + FE G  D F +   DLG+L KI +GH+N G +A W L+++ IE     + + FP N W++  + DG ++R++    + T      I Y +T  T + +GAGT + +Y+ +YG          N  S K  L+ G      TD+F++ +  +  P+ ++ +GH N G+   W  EKV++          I   FPC+ WL   + DG IER+L     +R+                   L+K  +++ V+T    + GTN+ +F+++YG+ G + E  L     +   F+   +++F  E  DLG+ +KI + HD  +SG     W L+++ +++  + + Y F+C RWL  ++DD +I R +   G        P+ R      G A                               Y +T+ TG  +  G+    ++ L+G   +    ++   +  T+ F  G+ +  ++E+  + N+++V I ++G    S WYL+ + +    + +  NV   C  WL K   + +  R     D   T   K   Y IS+ TGDV    T+S ++++L+G + ++    L   D N +D FERG  D F LE  ++G I ++ I +D  G    WFL  + I      + Y F  N +L KN     +L ++L P  + +I+K   Y+V + T +V  AGTS+ V ++ YGE G +  L L +    +K F+    D F   +   +G++ + ++ H   GF   W ++ + ++ +  R
Sbjct:   45 YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTS---KSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASF---------NPMDMPRGNKYE--------VKVYTGDVIGAGTDADVFINIFGEYGDTGERRLEN---EKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTA----ITYIVTVFTGDVRGAGTKSKIYLVMYGARG-------NKNSGKIFLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFT----GIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKR-----------------LKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILL---NPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSG---SGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEG--------PTVRR---IMGMAR------------------------------YHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSAT--LKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQAD-GRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSS---RSKVFERASKDTFQL-EAADVGEVYKLRLGHTGEGFGPSWFVDTVWLRHLVVR 904          

HSP 9 Score: 340.502 bits (872), Expect = 3.539e-93
Identity = 254/895 (28.38%), Postives = 437/895 (48.83%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFA-FKSVRT----KYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL-EKIL--PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIK-DKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI----PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVRE-IPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQI 3144
            +Y+V   T DV+GAGT   ++I++ G+    P+++L          +      G+  +F +R +++G +  + IEHD      SW L  V + +++   + + F CN+WLS  + D +  R+L A F  +      KYE+ V TGD+  +GTD+ VFI++ G  G + + +L  E    F++G   +F++ A  +G + KI +  +  G  + W+L ++ I D+ N   +Y F    WL+ D  D    R+I  G  E   I     Y ++ +T +  GAG+ + IY+ ++G  G  +   I     F EG +F+       H      L  L ++ VG+ N G    WF  KV+I      + Q+    FPC  WL + K +GL E+ L   V    +R +K+ + + + T +   A T S  ++ + G + + D+IL  +   NK W     FK G  +   +EL + L    +I    +       W L+ + +       + +F C  WL  +    + +  +V +++              + V++ T +++ A T++ V L L+GD G T + ++          + G+  EF  E   +    ++R +HD  G+ S W L+++L+ +      D  +F C RWL    +D   VRE +P+     +K     +Y + + TG+   A TD+ V+I +YG+K DT  + L  S  N  + FE+G++DEF +E + +G I+++ +GHDS    + WF+  V I          TF  N W D ++ DG    EL  + ++     V YEVE+ TG V GAGT + V+++I+G+ G T  + L    +    FE  + D F++EA D+GE+  +R+ H   G G +WFVD +
Sbjct:   44 VYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQL-------TSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN-FEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKR-KYDFPLNRWLALDEDDGKIQRDILVGGAETTAIT----YIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKI-----FLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQT----FPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEIL--LNPNNK-W-----FKPGIIEKFRIELPD-LGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDAN----EDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSATLKN---FRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQI-RVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLS---SRSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTV 896          

HSP 10 Score: 307.76 bits (787), Expect = 4.328e-83
Identity = 283/1091 (25.94%), Postives = 477/1091 (43.72%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK-------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLF----KENTQCFQRGQTSKFVIPATCVGP-ISKIRIRQDESGSKSSWYLDRVCITDL---KNPEWRYFFQCKNWLSKDHGDHATVREI-----------------RGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIF---GENGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKV-IINDLDQSRVFEFPCGQWLSDVKGEG-LEKIL--------------------------------------PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICK---YKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEF-LIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTT-----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISH---DDTGAGS---AWFVDQICVIVPKLGLKYIF-------------FLNKWLDSKTLEYDLDPSKIDKIDKTIP--YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK-SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            + V + T   K AGT   ++I++ G + +     LK  K ++ K         S +IF +   DLGDL  + + HD       W +  VE+      +   F C  WL+  ++DG + R+LF    ++T+       YEI + T D+  +GTD+ +FI + G   +  Q +      +E  Q F+R   S+F++    VG  I KIRI  + +G    W+   V I  L   K+      F C  WL+    D  T+RE+                 +  KE+        Y +  +T N PGAG+ A +YI I+   G+ GE  +   +N+ + F+ G+     +    LG + KIK+ + N+     W++ KV I ND ++   F F CG+WLS  K +G LE++                                       P+    +      Y + ++TG    A+T SRA++ L G +         E + +IW++  + K GF+                                        +  +E+ ++ G            +V ++     +K++ + + T       ++T D+    T+S + + LYG NG T+++ +    ++ +      F  E+  +    K+R + D  G+   W LE+IL+     GD   F    WLS      + V E+ A    ++    + +   Y V + T + + AGTDANVFI I+GE GD+G   L  S  N NKFE+   D F   + + LG + K+++ HD+K    GW +  V + ++ +   +  F+C+CW   SEGDG TVR+           L + TYE+ ++TG   G  T  NV++ + G+   +    ++ S + +  F  G TD F+ ++  +G+I S+ + H   +D        AW V  I +   + G  Y F             +   +  +KT E     S   K+   +P  Y++ V TG    AGTD+ VF+ I+G +  T +  LK K  + FERG+ D F +   ++G ++K+R+ HD     SGW ++KV
Sbjct: 1177 FSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDK-----FERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLF-HAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDE-FLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGED--------DERSKRIWLDYPRGKRGFS----------------------------------------RGSVEEFYVAG-----------LDVGII-----KKIEVLYEMT-------VWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCA----VIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQS-ANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDV-KDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETG--NGGETRENVWLILEGRKNRSKEFLMENS-SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTE-----SFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKV 2175          

HSP 11 Score: 305.834 bits (782), Expect = 1.636e-82
Identity = 267/988 (27.02%), Postives = 425/988 (43.02%), Query Frame = 1
Query:  865 FTCNHWLSLYKEDGKVSRELFAFKSV---RTKYEIVVITGDLDDSGTDSKVFISLCGR----TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIAS-----------------------RTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGF-----TDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLD--DIVIFCP-QTGIEQ-SFICGNWLSPSRPGCQTEVSLV----------EDLSKRKLKTVIDFTENT--WMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI---------------PA-------------------TGP--GIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKIDKT-----IPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKS--DTFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            F  + WL+  KED ++  EL         R  YE+ V+TG++  +GTD+ V++++ G     TG  P  +  K N   F++GQT  F I A  +G ++KIRIR D +G+++ W+LDR+ ITD+ N E  Y+F C+ WL+ +  D    RE+    E   +                          T + ++  T  K  AG+ A+++I +FG   ++ +  +K    N D F+  SI   T+    LG L K+++G+ N G  P WF++ V ++     +   FPCG+WL+  + +G  +  +   +     Y  +  YE+ + T +   A T +  ++I+ G        D + +  K    N + ++ F          VEL +    + +I  G N  G N  W     DI    P + G E  +F C  WL+ S    +T   LV          +D S R++   ++   +   + V I+T +I  A T++KV + +YGD G T +  +       +K + G+   F  E A +G+ YK++ +HDNS   + W +EK+ +    N DE+ FLC RWLS   ED    R                 PA                   TGP    V+  PI  Y V + TG    A TD+  FI + GE  +   R           F +G ++EF +  + +G I KI+                            V +    W              TG  + G                GTDSN+F+ ++G  G T  +QL      K +FE    D F +E  DI     +RI  D  G+   WF+++I +     G   +F+   WL  +  +  L       ID+        Y + V T D++ AGTD+ VFI I+G++  +  L LK  +  + FER N D F   +   +G + K+R+ HD K    GW L  V
Sbjct:  992 FEAHRWLARGKEDNELVVELVPAGKPGPERNTYEVQVVTGNVPKAGTDANVYLTIYGEEYGDTGERPLKKSDKSNK--FEQGQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNN-EITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYG-------CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIE----------------------------VLYEMTVW--------------TGDVVGG----------------GTDSNIFMTLYGINGSTEEMQLDKK---KARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYV 1908          

HSP 12 Score: 268.855 bits (686), Expect = 3.215e-71
Identity = 262/952 (27.52%), Postives = 428/952 (44.96%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDL-ESILIEHDGLEPKDSWLLQGVEIMNV----ENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKY----------------------EIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFK-EN-TQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIY-IQIFGENGESDVIDIKN--KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVF-EFPCGQW------LSDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKG--PEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTE----NTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS---KLDSGSVVEFR-TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSK---------LAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFD-SSEGDGLTVRELTGTT--------LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK 3210
            + Y++ + T+DV  AGT   I+I I G  A   + +     K  +K         S   F +   D+G++ E I I H+       W    V+I  +    +      F C+ WL+  ++D K  REL  +     KY                       + + TG++  +GTD+KV+I++ G  G + +  L K EN T  F+RG    F+I A  +G I KI++R D S   + WY+++V I +  N +  + F C  WLS    D              G   R  Y+  +  +      S AD + I +  +  + D+  +     D  +EG I  + + +    T  K    +K+     R F+  +  +D    R++ ++P G+       + +    GL+ +  +KK+     +  YEM + TG+     T S  ++ L G     ++  LDK         + A+F+    D   +E+ + ++P T++   I+  G   +WFL+ I++    TG    F  G+WLS  R G +T V         ++  VID  E     ++ V++ TSDI  A T++ V ++++G+NG +  + +   +   K +  +   F   ++  +G   KLR  HDN G    W+L  + +      + + F C+ WLS S  D  TVR+       I        Y++ I TGN     T  NV++ + G K  + + FL  +++    F KG  D F  +++ LG I+ + +GH ++         LA   W V K I   E    N   F C+C      +     V E+T TT         L  V YEV V TG   GAGTD+NVF+ IFG  GDTG  +LK  M  +N FE G+TD F +E  ++GE++ +R+ HD +G  S W V+++ V     G+  IF   +WLD K
Sbjct: 1306 VPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQF---FERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNED-EFLFLCGRWLSLKKED--------------GRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSV----TTGK----HKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLD-VGIIKKI-----EVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDK---------KKARFEREQNDTFIMEILD-IAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLS-QRKGKKTLVC--------EMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETGNG--GETRENVWLILEGRKNRSKE-FLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELA---WHV-KTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKK 2197          

HSP 13 Score: 266.929 bits (681), Expect = 1.274e-70
Identity = 217/847 (25.62%), Postives = 398/847 (46.99%), Query Frame = 1
Query: 5089 LQKKAYTIRVY-----TGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIID-KFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDV-GKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLAIDLAPIND--IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPT-KTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKT--YVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNL---FEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI---LTPSE 7563
            L+ + Y  RVY     TG     GT+ANVF+ ++GENG S + QL  SK+ +  FEK N+D F     ++G ++K+ I HDN+G     W+L  + + D K  +  Y F+C  WLSK + D++  R L                       S N +D  +                        Y + + TG     G+    ++ ++G     T   RL+  E + F  G+++   ++APD+  + ++ + +      + W+L+ I IE     + Y+     WL+    + K  R   +     T     ITY+++V TGDV   GT S ++L ++G +GN +   +      F+RG  D F +E+  +   + ++ + +   G    WF EK+ I    T     F  + +L   K  G  ++   ++  +    +KK  + + V T+++K AGT+S + ++ YG+ G + ++ L     NNK FK   +++F   ++  LG   + +VWH+     S WHLE + +     +  + F CN+WL   +DD +I RE+  E    PT +       Y VTV TG+ + AG   +V+   +G+   + + ++ N  +   LF + + D+  +  V +  ++ +++     +++       W+ + V V+     ++    F    W++  +     DG++  +  ++   + A ++  +      Y I + TG  +G  TD+ V+I L+G+ S++ K+ L+    NL   FE+G+ D+F LE +++G I ++ I HD +   + WFL  VQ++     K + +P N WL K++   ++   L PSE
Sbjct:   35 LEHEYYKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLT-SKSKS-AFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGL-NASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLL---------------------ASFNPMDMPRGNK---------------------YEVKVYTGDVIGAGTDADVFINIFGEYG-DTGERRLEN-EKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETT----AITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNP---NNKWFKPGIIEKFRI-ELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEG---PTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRI-----RHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKD----DGQL--VRELLPSDSSATLKNFR------YHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSE 806          

HSP 14 Score: 234.572 bits (597), Expect = 9.608e-61
Identity = 181/634 (28.55%), Postives = 305/634 (48.11%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDL-GDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRG----AKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQ--SRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAK--FKEGFTDVVPVE-LNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKL-DSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAV 2388
            I Y V V T DV+GAGT   IY+ + G + N    ++                 G T IF I  + L   L  + + H  +     W  + V I+         F C++WL   K DG + R+L+   S+R K      + + V T DL  +GT+S +FI + G+ G + +I L   N + F+ G   KF I    +G   KIR+  D+  S S W+L+R+ + +  N + +Y F C  WL  +  D+  VRE+       + IMG+A   RY ++  T    GAG+ A++Y+ +FG+    GE  + + +N  D F++G+  E T+    +  ++++++ +   G    W+L++V++ +  Q  S   EFPC +WL   K +G  + ++LP        + ++Y + + TG+ + AST SR Y+ L G +      D I+    +   N K  F+ G  D   +E LN  +  +  ++ G +  G +  WFL  + I  P+ G + +F    WL  ++   + EV L         K V       + V I+T D+  A T+++V + +YG+ GKT+ + + + SK+ +  S   F+ E A VG  YKLR  H   G   SW ++ + +   V
Sbjct:  296 ITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV--------FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEI-LLNPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKD-KYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMA---RYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDS-SATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKS-----DTIKQVLLVSDNNLKDYFERGRVDEFTLETLN--IGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLV------HYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQLEAADVGEVYKLRLGHTGEGFGPSWFVDTVWLRHLV 902          

HSP 15 Score: 233.032 bits (593), Expect = 2.215e-60
Identity = 190/680 (27.94%), Postives = 306/680 (45.00%), Query Frame = 1
Query: 5566 FAFETDENDTAQTEYIA--YTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISI-EMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL--VQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQV----QNLSTNKIWKYPCNEWLSKSKG---LWKILTPSE 7563
            +A E DE +     Y A  Y +   TG  +  G+    ++ L+G   L   + +L     + F  G+ +V  V   +V  I +V I ++     +SWYL+ + + +M      Y   C  WLSK  G+R+  R        M ++ +   Y + V TGDV   GT++ +F+ +FG  G++    L+  +DNFE+G  D F L+  D+G++ KI + ++  G    WFL ++ I +      Y F  N +L+ +    K     L    +     Y V V T +V+ AGT S + +  YG  G  +SG + L+        F   + D F     + L  LSR  V H N G +  W  E + +    T     FPC+ WL     D  I R+L      +  K    +  + + V T D K AG    ++   YG+K  +D+ ++  N    K F     +K ++    LG    I++      ++  S    W    + + N      Y F    W++ +E   E   E+       E P   R+      G+ +Y + V TG+  G GTDANV++ LFG+  ++G+R L   +   +LFE+G  D+F +E V +  + +++I HD     S W+LDRV V    Q  S N   ++PC  WL K K    L + L PS+
Sbjct:   26 YASEDDEGELEHEYYKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKL-QLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPM-DMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLE-----GGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLY--EMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPN---NKWFKPGIIEKFRIELPDLGRFYKIRVW-----HDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREM-----TAEGPTVRRI-----MGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNV--EFPCLRWLDKDKDDGQLVRELLPSD 676          

HSP 16 Score: 201.06 bits (510), Expect = 1.390e-50
Identity = 201/795 (25.28%), Postives = 339/795 (42.64%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVF--ISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPE-WRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTR--YKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK---LDSGSVVEFR------TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED-----FSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT--FRCNCWFDSSEGDGLTVREL 2862
            D +LY V + T ++ GAGT   +YI+I GD  +     L K +    K        G+   F I  +DLG +  I + HD  +    W ++ VEI N  N+  +LF C  WLSL KEDG++ R LF  K           TGD   + +    F  I+L  +        +        Q G    + +  T          +  ++ + S  ++  +   D ++   W  + + K   S+      +V E   A   +GI  +    Y+++ +T +  G G+ ++I++ ++G NG ++ + + K K  F+        + +  +    K+++     G +P WFL ++++ +++   +  F  G WLS  KG+   + ++  V    E  +   Y + + T +   A T +  ++I+ G       L   +S N  W    KF+   TD         L  L ++    +  G    W L  + +          F C  WLS S    QT    V D +    K   +  E T+ + I T +     T   V L+L G   ++ + ++   S+      G+   F        ++A + + +  R          +W+++ I +T+   G+ Y F C+  +    +      F   +   +    +    P+ KY+V + TG +  AGTDANVF+ I+G  GDTG R L     N   FE+G  D F +E ++LG + K++L HDS    SGW V+KV   E  N S  V   F C  W D   GDGLT R+L
Sbjct: 1458 DIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNK-----FERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLER-LFYEKEY---------TGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTG--------KHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSR-----GSVEEFYVAGLDVGIIKKIEVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSAN--W---NKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQT----VRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPV-KYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL--FERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKV---EVTNTSTGVATIFNCGRWLDKKRGDGLTWRDL 2207          

HSP 17 Score: 192.586 bits (488), Expect = 4.535e-48
Identity = 159/593 (26.81%), Postives = 258/593 (43.51%), Query Frame = 1
Query: 2884 KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKIDKT-----IPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSD--TFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG------AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQL 4614
            +V YE+ V TG V G GTDSN+F+ ++G  G T  +QL      K +FE    D F +E  DI     +RI  D  G+   WF+++I +     G   +F+   WL  +  +  L       ID+        Y + V T D++ AGTD+ VFI I+G++  +  L LK  ++   FER N D F   +   +G + K+R+ HD K    GW                                                      LS +  ++ +  + + F C+ WL+  E D   VR+    + K      L+E  Y + ++TGN  G  T  NV+L + G+   S E  ++N+  +    F + + D F   +I LG +  + + H             AW++  + + +    + Y F C   +   +                +K ++  K  +S     Q      + V V T  +  AGTDANV + ++G   D+G   LKQ +   N FE G+ D F ++  +LGEL+K+R+ HD+SG  + W + KVE+     G + +F C  W+ K + DG   R+L+P +
Sbjct: 1695 EVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKK---KARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGW-----------------------------------------------------HLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNK--ICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENS--SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKR------------KRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPSV 2211          

HSP 18 Score: 169.088 bits (427), Expect = 6.786e-41
Identity = 172/694 (24.78%), Postives = 296/694 (42.65%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAF----------------------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCGR---TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAK-EIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----------NKDGFKEGSIFEHTLPLRQLG-TLKKIKVGNKNNGPQPRWFLNKV----IINDLDQSRVFEFPCGQWL--SDVKGEGLEKILPVKKLPERYQK-------YK----------YEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLS------------------------PSRPGCQTEVSLVEDLSKRKLKTVI----DFTEN----TWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVI--PADSK-LDSGSVVEFRTELAIVGIPYKLRAQHD 2331
            Y+V V T +V  AGT   +Y++I G++      R        K     K   G T  F I   DLG L  I I HD    +  W L  ++I ++ N+  + F C  WL++ ++DG++SREL                               K   T + + + TG   ++GTD+ VFI+L G    TG++  ++  K N+  F+R     F +    +G + K+R+  D +G    W++D V + D  +      F C  WL+K+  D + +R++  A+ +         Y+I+ YT +   AG+ A+I+I I+G     D +  +           K  F+  S     + L  +G  ++KI++G+ N G  P W  + V    ++ D D +    FPC +WL  S+   + + +++P     E+Y K       YK          Y ++I TGN   A T ++ Y+ + G   +  ++ L K E+         KF+ G  D   +E  + L  + +I    +      DW+++ + I+      E  F+CG WLS                         S P    E++L   ++   + TV     D+ +      + VS+ T   K+A+T+S+  + L G D+ ++  I +  P   +    GSV EF      VGI  K+   ++
Sbjct: 1024 YEVQVVTGNVPKAGTDANVYLTIYGEEYGDTGER-----PLKKSDKSNKFEQGQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMT-LLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEV-DAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYG----CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTN------KFERGTADTFIIEAAD-LGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIEVLYE 1699          

HSP 19 Score: 93.9745 bits (232), Expect = 4.536e-18
Identity = 51/131 (38.93%), Postives = 77/131 (58.78%), Query Frame = 1
Query: 7147 DISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKI-WKYPCNEWLSKSKG 7536
            ++ N   + ++  +E    K  V YE++  TG   G GTDANVFITLFGEN  S K  L  K ++ FE+G  D F +   ++G I K++IEHD++   + W+LD V V ++    + + + CN WLSK +G
Sbjct:   22 ELLNYASEDDEGELEHEYYKARV-YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEG 151          

HSP 20 Score: 93.5893 bits (231), Expect = 6.295e-18
Identity = 71/293 (24.23%), Postives = 132/293 (45.05%), Query Frame = 1
Query:  466 DCYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEH----DGLEPKD--SWLLQGVEIMNVENKRIWLFTCNHWLSL-----YKEDGKVSRELFAFKS-----VRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            DC+ S  + +   +R  +          +E  Y++ + T +  G  T   +++ + G K       ++   +            G+T  F      LGD+ S+ + H    D   PK   +W ++ + I  +E   ++ F C+  + L     Y +  +V++   +F S     V  KYE++V TG    +GTD+ VF+++ G  G + + +L ++    F+RG T +F +    +G + K+R+  D SG  S W +++V +T+         F C  WL K  GD  T R++
Sbjct: 1924 DCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRA------FRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGV-ATIFNCGRWLDKKRGDGLTWRDL 2207          

HSP 21 Score: 70.8626 bits (172), Expect = 4.412e-11
Identity = 37/96 (38.54%), Postives = 56/96 (58.33%), Query Frame = 1
Query: 3226 LDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVL 3513
            LD   I KI+  + Y++TV+TGDV+  GTDS +F+ +YG +  T+++ L  K   FER   D F +   D+    K+RI  DG      WFL+++L
Sbjct: 1686 LDVGIIKKIE--VLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERIL 1779          

HSP 22 Score: 58.9214 bits (141), Expect = 1.881e-7
Identity = 37/124 (29.84%), Postives = 59/124 (47.58%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+V VTT    GAGT   ++++I G   +  +  LK+  ++           GST  F +   +LG+L  + +EHD       WL++ VE+ N       +F C  WL   + DG   R+LF
Sbjct: 2092 VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL-------FERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLF 2208          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Human
Match: LOXHD1 (lipoxygenase homology domains 1 [Source:HGNC Symbol;Acc:HGNC:26521])

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 401/1124 (35.68%), Postives = 626/1124 (55.69%), Query Frame = 1
Query: 4096 YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKD--------NKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-----DKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNY-FAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHD-VWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK-KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDL 7392
            Y FPC  WLA  +D G LS+++ P + +      +        N LD     + Q+DK   F+V + T  K  AGTDANV I L+G  +D+G+  LK S T+S+KFE  + + F V+  DLG+L K+R+GHDN+G    W +  VE++A  LG+   FPC  W++K++ DG++ R+L+     T    P + YEIT  TS+   AGT+AN++I +YG +  CT++  L  N    K   +      F V +EDV + IEKIRIGH+N G+   WH   V ++RLL +K+ +    FPC+RWLA  E+D    REL+P     +K ++ GS+  + + +++       L    Y+++++TG     GT+A V++ +YG+ GD+GER L  S+  T+KFE+   D F  EA DLG ++KI +RHDNS +   DW+++K+EI +  + + +LF C RWLS  K+D +++R  Y   Y G+RS+  S  +       ++ +      +  G  A    E        I Y +++ TG  KD  +    ++ L G  + ++  I L        F+ GS E   V   DV  IK++E+ ++G   ES W +  + + +PT+G  Y + C  WL+K  G+  TSR+F + D M+ N+  K+ Y ++V TGDV  GGT+S +F+ L+G  G++    LDK +  FER   D F +E+ D+    K+RI+ DG G RP WFLE++ + N +T +   F Y ++LS+  G KK L  ++  + D    ++ T Y V VKTS++  AGT + V +  +GE GDSG L LK     NK F+ N  D F FPDMLSLG L + +VWH+N G    WHL Y+++K+     ++ F C+ WLS ++ D Q  R+  C N  N       ET+YE+ + TG   N G   + VW +  G KN S +F+MEN+  +++ F + + D  +   +YLG++ ++ +G +  ++      +  W    + +  +     Y F     I +  K +    ++F+++   E    ++V+ L     VKYE++V TG   G GTDANVF+T+FG N ++GKR L QK RNLFE+G  D+F LE ++L
Sbjct:    7 YYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLD--NLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEP------LDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCA-DWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPI-----IPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKG-KKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACAN--NKICDELEETTYEIVIETG---NGGETRENVWLILEGRKNRSKEFLMENS-SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYF--KVFEVTKTTE-SFASKVQSLVP---VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLEL 1102          

HSP 2 Score: 355.91 bits (912), Expect = 3.412e-101
Identity = 310/1167 (26.56%), Postives = 533/1167 (45.67%), Query Frame = 1
Query: 3700 YWFICNRWLASDEDDNMIVRELLPTDEK--------------GNPLSNL------KELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDES--DEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK------FESGNCDEFQVKCCDLGE-LKKIRIGHDNSGPNADWHLAKVEIE---AEKLG-QSFVFPCNEWISKSKVDGNLERELYPQLSLT--------------MTKRPK--IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKS-KLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMN----------ALGESIDQVD------SVANILQKK---AYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERK-TSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDK--NEDNFERGHRDHFKL-EMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIN-----DIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWH--NNSGFSSR----WHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDR--QIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDK 6936
            Y+F C RWLA +EDD  + RELLP DE                NPL NL      K   + V +KTG +  +GTDANVF+T+FG   D+G   LK++  NS +KFE  S++ F ++ +DLG L K+++ HDN+     W++D+V V+  S      FPC  WLA N+D G + +D+F A              + Q ++Y       + + +YT+    AGTDAN+ II+YG       +  +Q    +NK      FE  +   F V+  D+GE ++KIRIGH+N+G N  WH + V+I     +K G ++  FPC+ W++ S+ D    REL P    T                + P   + Y +   T N  GAGT+A VYI +YG    T +  L  + +++ K + G  D F +   D+   I KI++ HDN    + W++EKV +     N      + F C RWL+  +EDG +ER     +     S N          AL   +  VD       +A+ +Q+     Y + V TG   +  T++  F+ + GE+ +  +R  +D       F + +++EF    +D+G + KI++ HD +   +  W ++++ +        Y+ +C  WL+K                  +R +  + R   +      ++  +                       + Y +T+ TG     G+    +M LYG  N  T  ++L K +   F     +   +E  D+    ++ I  +G+     W+L  I ++    G L     G WLS+  G++     + ++ D+    + +  +Y ++V T D+   GT++ +F+ +FG  G+S    L +  N + FER + D F   +M  +G + K+R+ +D  G  P W L  +D+ + S +E++ F+ + +LSK+ G  + +  D A  N     ++++T Y+++++T N     T   V +   G    S +  ++   +  + F+    D F F D + LGD++   V H      F  +    WH++ I + E++    + F C+  + +    +  ++F       +      S     YEV V TG +  AG   +V+   +G    + K  ++  +    LF R S D+
Sbjct:    7 YYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNS-DKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHA--------------ELQTRLYT--PFVPYEITLYTSDVFAAGTDANIFIIIYG----CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADL-GVIYKIKLRHDNSKWCADWYVEKVEI----WNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGAS-PESCWLVEELCLAVPTQGTKYMLNCNCWLAK------------------DRGDGITSRVFDLLDAMVVNIGVK-----------------------VLYEMTVWTGDVVGGGTDSNIFMTLYGI-NGSTEEMQLDKKKAR-FEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDE--EEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVR-DFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSR-QRAFRKGTTDTFEF-DSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDR 1094          

HSP 3 Score: 327.405 bits (838), Expect = 8.086e-92
Identity = 308/1187 (25.95%), Postives = 495/1187 (41.70%), Query Frame = 1
Query: 1216 NPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR-----------------------TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGF-----TDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLD--DIVIFCP-QTGIEQ-SFICGNWLSPSRPGCQTEVSLVE-DLSKRK------LKTVIDFTEN-----TWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI---------------PA-------------------TGP--GIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTF--RCNCWFDSSEGDGLTVR--ELTGTTLLG---KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKIDKT-----IPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSD--TFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG------AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDL 4434
            N E  Y+F C+ WL+ +  D    RE+    E   +                          T + ++  T  K  AG+ A+++I +FG   ++ +  +K    N D F+  SI   T+    LG L K+++G+ N G  P WF++ V ++     +   FPCG+WL+  + +G  +  +   +     Y  +  YE+ + T +   A T +  ++I+ G        D + +  K    N + ++ F          VEL +    + +I  G N  G N  W     DI    P + G E  +F C  WL+ S    +T   LV  D+   K      L+ V    E       + V I+T +I  A T++KV + +YGD G T +  +       +K + G+   F  E A +G+ YK++ +HDNS   + W +EK+ +    N DE+ FLC RWLS   ED    R                 PA                   TGP    V+  PI  Y V + TG    A TD+  FI + GE  +   R           F +G ++EF +  + +G I KI+LGHD     S W V+++ +     P+    +   CNCW     GDG+T R  +L    ++    KV YE+ V TG V G GTDSN+F+ ++G  G T  +QL      K +FE    D F +E  DI     +RI  D  G+   WF+++I +     G   +F+   WL  +  +  L       ID+        Y + V T D++ AGTD+ VFI I+G++  +  L LK  ++   FER N D F   +   +G + K+R+ HD K    GW                                                      LS +  ++ +  + + F C+ WL+  E D   VR+    + K      L+E  Y + ++TGN  G  T  NV+L + G+   S E  ++N+  +    F + + D F   +I LG +  + + H             AW++  + + +    + Y F C   +   +   +            +K ++  K  +S     Q      + V V T  +  AGTDANV + ++G   D+G   LKQ +   N FE G+ D F ++  +L
Sbjct:    2 NNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYG-------CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCL---AVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDK---KKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGW-----------------------------------------------------HLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNK--ICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENS--SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKY------------FKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLEL 1102          

HSP 4 Score: 308.531 bits (789), Expect = 1.251e-85
Identity = 284/1074 (26.44%), Postives = 477/1074 (44.41%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK-------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLF----KENTQCFQRGQTSKFVIPATCVGPI-SKIRIRQDESGSKSSWYLDRVCITDL---KNPEWRYFFQCKNWLSKDHGDHATVREI-----------------RGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKV-IINDLDQSRVFEFPCGQWLSDVKGEG-LEKIL--------------------------------------PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVEL---NEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICK---YKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEF-LIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTT-----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISH---DDTGAGS---AWFVDQICVIVPKLGLKYIF-------------FLNKWLDSKTLEYDLDPSKIDKIDKTIP--YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK-SDTFERGNEDVFKINAADVGVIQ 3450
            + V + T   K AGT   ++I++ G + +     LK  K ++ K         S +IF +   DLGDL  + + HD       W +  VE+      +   F C  WL+  ++DG + R+LF    ++T+       YEI + T D+  +GTD+ +FI + G   +  Q +      +E  Q F+R   S+F++    VG I  KIRI  + +G    W+   V I  L   K+      F C  WL+    D  T+RE+                 +  KE+        Y +  +T N PGAG+ A +YI I+G+    GE  +   +N+ + F+ G+     +    LG + KIK+ + N+     W++ KV I ND ++   F F CG+WLS  K +G LE++                                       P+    +      Y + ++TG    A+T SRA++ L G +         E + +IW++  + K GF+     E       +  + +I  G +       W ++++ +  P  G +    C  WL+  R    T  S V DL    +  +    +  + ++++T D+    T+S + + LYG NG T+++ +    ++ +      F  E+  +    K+R + D  G+   W LE+IL+     GD   F    WLS      + V E+ A    ++    + +   Y V + T + + AGTDANVFI I+GE GD+G   L  S  N NKFE+   D F   + + LG + K+++ HD+K    GW +  V + ++ +   +  F+C+CW   SEGDG TVR+           L + TYE+ ++TG   G  T  NV++ + G+   +    ++ S + +  F  G TD F+ ++  +G+I S+ + H   +D        AW V  I +   + G  Y F             +   +  +KT E     S   K+   +P  Y++ V TG    AGTD+ VF+ I+G +  T +  LK K  + FERG+ D F +   ++ V +
Sbjct:   66 FSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDK-----FERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLF-HAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDE-FLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDD--------ERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGIT--SRVFDLLDAMVVNI--GVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCA----VIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSA-NWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDV-KDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETG--NGGETRENVWLILEGRKNRSKEFLMENS-SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTE-----SFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELVVTR 1106          

HSP 5 Score: 279.256 bits (713), Expect = 5.343e-76
Identity = 249/990 (25.15%), Postives = 447/990 (45.15%), Query Frame = 1
Query:  841 VENKRIWLFTCNHWLSLYKEDGKVSRELFAF----------------------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCGR---TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAK-EIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI------KNKDGFKEGSIFEHTLPLRQLG-TLKKIKVGNKNNGPQPRWFLNKV----IINDLDQSRVFEFPCGQWL--SDVKGEGLEKILPVKKLPERYQK-------YK----------YEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLS------------------------PSRPGCQTEVSLVEDLSKRKLKTVI----DFTEN----TWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVI--PADSK-LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTT----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKI-EAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTL-EYDLDPSKI-DKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKINAADVGVIQKIRIGH 3468
            + N+  + F C  WL++ ++DG++SREL                               K   T + + + TG   ++GTD+ VFI+L G    TG++  ++  K N+  F+R     F +    +G + K+R+  D +G    W++D V + D  +      F C  WL+K+  D + +R++  A+ +         Y+I+ YT +   AG+ A+I+I I+G +              + K  F+  S     + L  +G  ++KI++G+ N G  P W  + V    ++ D D +    FPC +WL  S+   + + +++P     E+Y K       YK          Y ++I TGN   A T ++ Y+ + G   +  ++ L K E+         KF+ G  D   +E  + L  + +I    +      DW+++ + I+      E  F+CG WLS                         S P    E++L   ++   + TV     D+ +      + VS+ T   K+A+T+S+  + L G D+ ++  I +  P   +    GSV EF      VGI  K+   HD +   S W +E++ +     G +Y   CN WL+    D  T R        +V       Y++ ++TG+ +  GTD+N+F+ +YG  G T +  L        +FE+ Q D F++E + +   +K+++  D   +   WF++++++ +  N  +   F    W    +G    V E+        ++   +Y V VKT  + GAGTD+NVFI IFG+ GD+G + LK S  N NKFE   TD F   +   +G +  +R+ HD+ G    W +  + V        + F  + WL     D +T+ ++    +KI D++++T  Y+I + TG+     T   V++ + G+  ++ +  ++  S+   F +G  D F+ ++  +G I  + +GH
Sbjct:    1 MNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMT-LLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEV-DAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTN------KFERGTADTFIIEAAD-LGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKA---RFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILL-KNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQS-ANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEET-TYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGH 973          

HSP 6 Score: 250.366 bits (638), Expect = 1.115e-66
Identity = 275/1086 (25.32%), Postives = 454/1086 (41.80%), Query Frame = 1
Query: 4534 SFVFPCNEWISKSKVDGNLERELYP-----------------------QLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKS-KLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDK--FEKNNMDEFEWEAVDLGKVF-KIDIRHDNSGFFKKDWFLKKIEI----IDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLE--TNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIF----------------------SIQDKM-----------MTNVSKK---ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSL-----YPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVG----QKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNE-TSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVT-CVYLGELKNIKLGAVVNKNELYSDSK----KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRN-LFEQGQEDKFILECVDLGKIEKIKIEH--DDSRF----RSDWFLDRVQVQNLSTNKIWKYPCN 7512
            ++ FPC  W++  + DG L REL P                        L+L   K     + +T  T  +K AGT+ANV+I ++G  D T  T L ++   S K +    ++F V   D+ D + K+R+GHDN G    W ++ V V      K       FPC RWLA++E+DG+I R+L   ++  R     +                  Y I +YT      GT+AN+F+ +YG +    +++ + +     K  FE+ +   F  E  D+G++  KI I H+N+G     W    ++I     DK   ET  F C+RWL+ S+DDKK  R L       E+     G  R +Y      LD                         + Y++ I TG     G+    ++ +YG     T    L K E  TN F  G+ +   +EA D+  I ++++ ++     + WY+  + I   T    +   CG WLS    + +  R+F                      ++  KM           M +  ++   I Y +SV TG      T+S  F+ L G     S      YP  K    F RG  + F +   DVG IKKI + +DG      W +E+L +   +    Y    N +L+K+ G     +    +D   +N   K  Y++ V T +V   GT S + +  YG  G + +++L   ++    F+  Q D FI  ++L +   ++ ++  +  G    W LE I +K + T     F    WLS     R+  + L+CE      +    E TSY V V T D   AG   +V+ + +GE   S    ++ + +  K F R++ D       + LG L  ++         ++ D+K     W  + V VK+ +  +T+ F+   W+       E DG+   + +     NK   +EL++     YEI++ T  GNG  T  NV++ L G  + S +  +    R   F +G  D F  + + LG I  + + H   + RF       W +  + +  +    ++ + C+
Sbjct:    6 TYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQ-KDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGD-LWKVRLGHDNTGKAPGWFVDWVEVDAPSLGK----CMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFV-----------------PYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTG-MNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKY-MKDGSLRQVYKEVEEPLD------------------------IVLYSVQIFTGNIPGAGTDAKVYITIYGDLG-DTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKR--GFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQL---DKKKARFEREQNDTFIM-EILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQ----RKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFPDMLSLGHLCKLR---------VWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKS----EGDGQT--VRDFACANNKI-CDELEE---TTYEIVIET--GNGGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCD 1009          

HSP 7 Score: 246.128 bits (627), Expect = 2.368e-65
Identity = 240/950 (25.26%), Postives = 421/950 (44.32%), Query Frame = 1
Query: 4927 NKSIAYEFPCNRWLARDEEDGAIERELLP---DKVIRRGSMNALGESIDQVDSVANILQKK----AYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRL---QKLETNYFAPGSKEVISVEAPDV-ENIKQVEICNEGVDRESSWYLNSISIE--MPTKGKLYNVT--CGVWLSKFMGERKTSR------IFS---IQDKMMTNVSKKI-------TYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN---FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLA------------------------------IDLA----PINDIKK----TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGD-SGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKL-FSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGR-NLFEQGQEDKF-ILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            N  I Y FPC RWLA +E+DG + RELLP     V+ +      G   + +D++A  L++K     +++ + TG +   GT+ANVF+ ++G   D+G   L  SKT++DKFE+++++ F  E +DLG ++K+ + HDN+G     WF+  +E+      +   F C RWL+K++DD  I R L+ A  Q             +Y                              T ++ Y IT+ T      G+    ++ +YG   + T    L   ++ +  +F   S     VE  DV E I+++ I +        W+ + + I   +P K     +T  C  WL+    ++KT R      IF+   ++D  +  V K++        Y + + TG++   GT++ +++ ++G  G++    L K+E+    FERG  D F +E  D+G I KI++++D +     W++EK++I N++  + + F    +LS  K  G+ ++L                               +D++    P+ D  +      Y V V T   K A T S   +   GE  + S  + L  P +  + F    ++EF +   L +G + + ++ H+ +   S W +E + +        +   CN WL+    D    R     +A       +    YE+TV TGD    G   +++   YG    ++    E  +DK+K  F R   D   +  + +     +++     + +      +WF   + +KN+ T    +F    W+   +  +    E+            A ++E +      Y + V T    G GTDANVFI +FGEN +SG   L Q    N FE+   D F   + + LG + K+++ HD+      W L  V V++ S ++ + + C+ WLSKS+G
Sbjct:    2 NNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLA--LEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGK-APGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQ-----------TRLY------------------------------TPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYP-RGKRGFSRGSVEEF-YVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVK--VLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTE----EMQLDKKKARFEREQNDTFIMEILDIAPFTKMRI-----RIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMC-----------AVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEG 883          

HSP 8 Score: 209.149 bits (531), Expect = 1.265e-53
Identity = 194/788 (24.62%), Postives = 336/788 (42.64%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF---------------------AFKSVRTKYEIVVITGDL---------------------DDSGTDSKVFISLCGRTG-ISPQIQL-FKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR--EIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK---LDSGSVVEFR------TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED-----FSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHD 2724
            D +LY V + T ++ GAGT   +YI+I GD  +     L K +    K        G+   F I  +DLG +  I + HD  +    W ++ VEI N  N+  +LF C  WLSL KEDG++ R  +                     A  S     +I  +TG +                      D+ TDS+ FI L G     S +I L +    + F RG   +F +    VG I KI +  D +  +S W ++ +C+  +     +Y   C  WL+KD GD  T R  ++  A  ++ I  +  Y+++ +T +  G G+ ++I++ ++G NG ++ + + K K  F+        + +  +    K+++     G +P WFL ++++ +++   +  F  G WLS  KG+   + ++  V    E  +   Y + + T +   A T +  ++I+ G       L   +S N  W    KF+   TD         L  L ++    +  G    W L  + +          F C  WLS S    QT    V D +    K   +  E T+ + I T +     T   V L+L G   ++ + ++   S+      G+   F        ++A + + +  R          +W+++ I +T+   G+ Y F C+  +    +      F   +   +    +    P+ KY+V + TG +  AGTDANVF+ I+G  GDTG R L     N   FE+G  D F +E ++L  ++++ L  +
Sbjct:  347 DIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNK-----FERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLA-VPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAM-VVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSAN--W---NKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQT----VRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPV-KYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL--FERGSTDRFFLETLEL-VVTRLGLAAE 1112          

HSP 9 Score: 193.741 bits (491), Expect = 7.667e-49
Identity = 159/544 (29.23%), Postives = 261/544 (47.98%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLK-ELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVN--DESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLE--NFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVK-CCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGH---DNKGLGS---AWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKA---YTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDL 5277
            +Y   CN WLA D  D +  R     D     + N+  ++ Y + V TG+  G GTD+N+F+T++G NG + E  L    D    +FE +  D F+++ +D+    K++IR D       W+L+ +L+   +  D  +F    WL+  K    L  ++                      I +E+ +E  ++ V V T+  + AGTDANV II++GE  DSG + LKQS  + NKFE  N D F       LG L K+R+ HDN G    WHL+ V+++     ++F F C+ W+SKS+ DG   R+     +    +  +  YEI   T N  G  T  NV++ + GR + +++  + N+S +   + G TD F      + D I  + +GH   +++ +     AWH++ + +  +         Y F C+               L+P K  R+     + E     +S A+ +Q      Y + V TG E   GT+ANVF+ ++G NGD+G+R+L   +   + FE+ + D F  E ++L
Sbjct:  611 KYMLNCNCWLAKDRGDGITSRVFDLLDAM---VVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQL----DKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAV-------------------IDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQS-ANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGD-IASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGN----VYFFNCDC--------------LIPLK--RKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKREL--KQKMRNLFERGSTDRFFLETLEL 1102          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Human
Match: LOXHD1 (lipoxygenase homology domains 1 [Source:HGNC Symbol;Acc:HGNC:26521])

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 402/1183 (33.98%), Postives = 625/1183 (52.83%), Query Frame = 1
Query: 4096 YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKD--------NKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-----DKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNY-FAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAG-MPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK-KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTPS 7560
            Y FPC  WLA  +D G LS+++ P + +      +        N LD     + Q+DK   F+V + T  K  AGTDANV I L+G  +D+G+  LK S T+S+KFE  + + F V+  DLG+L K+R+GHDN+G    W +  VE++A  LG+   FPC  W++K++ DG++ R+L+     T    P + YEIT  TS+   AGT+AN++I +YG +  CT++  L  N    K   +      F V +EDV + IEKIRIGH+N G+   WH   V ++RLL +K+ +    FPC+RWLA  E+D    REL+P     +K ++ GS+  + + +++       L    Y+++++TG     GT+A V++ +YG+ GD+GER L  S+  T+KFE+   D F  EA DLG ++KI +RHDNS +   DW+++K+EI +  + + +LF C RWLS  K+D +++R  Y   Y G+RS+  S  +       ++ +      +  G  A    E        I Y +++ TG  KD  +    ++ L G  + ++  I L        F+ GS E   V   DV  IK++E+                         LY +T  VW    +G                                   GGT+S +F+ L+G  G++    LDK +  FER   D F +E+ D+    K+RI+ DG G RP WFLE++ + N +T +   F Y ++LS+  G KK L  ++  + D    ++ T Y V VKTS++  AGT + V +  +GE GDSG L LK     NK F+ N  D F FPDMLSLG L + +VWH+N G    WHL Y+++K+     ++ F C+ WLS ++ D Q  R+  C N  N       ET+YE+ + TG   N G    +VW +  G KN S +F+MEN+  +++ F + + D  +   +YLG++ ++ +G +  ++      +  W    + +  +     Y F     I +  K +    ++F+++   E    ++V+ L     VKYE++V TG   G GTDANVF+T+FG N ++GKR L QK RNLFE+G  D+F LE ++LG++ K+++EHD S + S W +++V+V N ST     + C  WL K +G    W+ L PS
Sbjct:    7 YYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLD--NLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEP------LDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWC-ADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPI-----IPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIEV-------------------------LYEMT--VWTGDVVG-----------------------------------GGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKG-KKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACAN--NKICDELEETTYEIVIETG---NGGETRENVWLILEGRKNRSKEFLMENS-SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYF--KVFEVTKTTE-SFASKVQSLVP---VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPS 1099          

HSP 2 Score: 332.413 bits (851), Expect = 1.498e-93
Identity = 299/1129 (26.48%), Postives = 509/1129 (45.08%), Query Frame = 1
Query: 3700 YWFICNRWLASDEDDNMIVRELLPTDEK--------------GNPLSNL------KELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDES--DEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK------FESGNCDEFQVKCCDLGE-LKKIRIGHDNSGPNADWHLAKVEIE---AEKLG-QSFVFPCNEWISKSKVDGNLERELYPQLSLT--------------MTKRPK--IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKS-KLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMN----------ALGESIDQVD------SVANILQKK---AYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNS--------GFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGER------SNAPSGRSRSIYSGSANSLD----------SQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEIC-------NEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKN--EDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDR------PHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDL--------APINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELI 6732
            Y+F C RWLA +EDD  + RELLP DE                NPL NL      K   + V +KTG +  +GTDANVF+T+FG   D+G   LK++  NS +KFE  S++ F ++ +DLG L K+++ HDN+     W++D+V V+  S      FPC  WLA N+D G + +D+F A              + Q ++Y       + + +YT+    AGTDAN+ II+YG       +  +Q    +NK      FE  +   F V+  D+GE ++KIRIGH+N+G N  WH + V+I     +K G ++  FPC+ W++ S+ D    REL P    T                + P   + Y +   T N  GAGT+A VYI +YG    T +  L  + +++ K + G  D F +   D+   I KI++ HDN    + W++EKV +     N      + F C RWL+  +EDG +ER     +     S N          AL   +  VD       +A+ +Q+     Y + V TG   +  T++  F+ + GE+ +  +R  +D       F + +++EF    +D+G + KI++ ++ +        G    + F+  +  I+    E  L   +    + ++D  I   L IA +   R       + P      I   + N+ D          SQ+ G            ++    E+ +YT+ + T      G+    ++ ++G       +   Q    N F   + +  +   PD+ ++    +C       N+G+     W+L+ + ++  ++ + ++  C  WLSK  G+ +T R F+  +  + +  ++ TY I + TG  + G T   ++L L G +  S  + ++ +  +  F +G  D F+ +   +G I  + + +    DR        W ++ + IT       Y F  +  +     +K     ++        + +  +    Y+VIV T     AGT + V V  +G  GD+G  ELK   +N   F+    D F F + L LG+L + ++ H++SG+ S W +E +E+    T  +  F C +WL     D   +R+L 
Sbjct:    7 YYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNS-DKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHA--------------ELQTRLYT--PFVPYEITLYTSDVFAAGTDANIFIIIYG----CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADL-GVIYKIKLRHDNSKWCADWYVEKVEI----WNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIEVLYEMTVWTGDVVGGGTDSNIFM-TLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNF--PDMLSLGH--LCKLRVWHDNKGI--FPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETG--NGGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRN--LFERGSTDRF-FLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLF 1097          

HSP 3 Score: 306.22 bits (783), Expect = 6.281e-85
Identity = 282/1054 (26.76%), Postives = 471/1054 (44.69%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK-------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLF----KENTQCFQRGQTSKFVIPATCVGPI-SKIRIRQDESGSKSSWYLDRVCITDL---KNPEWRYFFQCKNWLSKDHGDHATVREI-----------------RGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKV-IINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDD-IVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKT-VIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICK---YKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEF-LIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTT-----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISH---DDTGAGS---AWFVDQICVIVPKLGLKYIF-------------FLNKWLDSKTLEYDLDPSKIDKIDKTIP--YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK-SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            + V + T   K AGT   ++I++ G + +     LK  K ++ K         S +IF +   DLGDL  + + HD       W +  VE+      +   F C  WL+  ++DG + R+LF    ++T+       YEI + T D+  +GTD+ +FI + G   +  Q +      +E  Q F+R   S+F++    VG I  KIRI  + +G    W+   V I  L   K+      F C  WL+    D  T+RE+                 +  KE+        Y +  +T N PGAG+ A +YI I+G+    GE  +   +N+ + F+ G+     +    LG + KIK+ + N+     W++ KV I ND ++   F F CG+WLS            +KK   R ++  YE + +    ++ S+ +  + I    ++ D  +  +      +++       +  V                      GK++D   D    IF      E+S     WL   R         VE+     L   +I   E  + ++++T D+    T+S + + LYG NG T+++ +    ++ +      F  E+  +    K+R + D  G+   W LE+IL+     GD   F    WLS      + V E+ A    ++    + +   Y V + T + + AGTDANVFI I+GE GD+G   L  S  N NKFE+   D F   + + LG + K+++ HD+K    GW +  V + ++ +   +  F+C+CW   SEGDG TVR+           L + TYE+ ++TG   G  T  NV++ + G+   +    ++ S + +  F  G TD F+ ++  +G+I S+ + H   +D        AW V  I +   + G  Y F             +   +  +KT E     S   K+   +P  Y++ V TG    AGTD+ VF+ I+G +  T +  LK K  + FERG+ D F +   ++G ++K+R+ HD     SGW ++KV
Sbjct:   66 FSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDK-----FERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFH-AELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDE-FLFLCGRWLS------------LKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTT--------------------GKHKDAATDSRAFIFLIGEDDERSKRI--WLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIEVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCA----VIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSA-NWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDV-KDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETG--NGGETRENVWLILEGRKNRSKEFLMENS-SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTE-----SFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKV 1064          

HSP 4 Score: 268.085 bits (684), Expect = 1.642e-72
Identity = 262/952 (27.52%), Postives = 428/952 (44.96%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDL-ESILIEHDGLEPKDSWLLQGVEIMNV----ENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKY----------------------EIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFK-EN-TQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIY-IQIFGENGESDVIDIKN--KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVF-EFPCGQW------LSDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKG--PEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTE----NTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS---KLDSGSVVEFR-TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSK---------LAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFD-SSEGDGLTVRELTGTT--------LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK 3210
            + Y++ + T+DV  AGT   I+I I G  A   + +     K  +K         S   F +   D+G++ E I I H+       W    V+I  +    +      F C+ WL+  ++D K  REL  +     KY                       + + TG++  +GTD+KV+I++ G  G + +  L K EN T  F+RG    F+I A  +G I KI++R D S   + WY+++V I +  N +  + F C  WLS    D              G   R  Y+  +  +      S AD + I +  +  + D+  +     D  +EG I  + + +    T  K    +K+     R F+  +  +D    R++ ++P G+       + +    GL+ +  +KK+     +  YEM + TG+     T S  ++ L G     ++  LDK         + A+F+    D   +E+ + ++P T++   I+  G   +WFL+ I++    TG    F  G+WLS  R G +T V         ++  VID  E     ++ V++ TSDI  A T++ V ++++G+NG +  + +   +   K +  +   F   ++  +G   KLR  HDN G    W+L  + +      + + F C+ WLS S  D  TVR+       I        Y++ I TGN     T  NV++ + G K  + + FL  +++    F KG  D F  +++ LG I+ + +GH ++         LA   W V K I   E    N   F C+C      +     V E+T TT         L  V YEV V TG   GAGTD+NVF+ IFG  GDTG  +LK  M  +N FE G+TD F +E  ++GE++ +R+ HD +G  S W V+++ V     G+  IF   +WLD K
Sbjct:  195 VPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQF---FERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNED-EFLFLCGRWLSLKKED--------------GRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSV----TTGK----HKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLD-VGIIKKI-----EVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDK---------KKARFEREQNDTFIMEILD-IAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLS-QRKGKKTLVC--------EMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETGNG--GETRENVWLILEGRKNRSKE-FLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELA---WHV-KTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKK 1086          

HSP 5 Score: 231.491 bits (589), Expect = 1.097e-60
Identity = 230/915 (25.14%), Postives = 406/915 (44.37%), Query Frame = 1
Query: 4927 NKSIAYEFPCNRWLARDEEDGAIERELLP---DKVIRRGSMNALGESIDQVDSVANILQKK----AYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRL---QKLETNYFAPGSKEVISVEAPDV-ENIKQVEICNEGVDRESSWYLNSISIE--MPTKGKLYNVT--CGVWLSKFMGERKTSR------IFS---IQDKMMTNVSKK-------ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN---FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSW-KFPCNKWLSMTDDDRQIFRELICE---NAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKL-FSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGR-NLFEQGQEDKF-ILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            N  I Y FPC RWLA +E+DG + RELLP     V+ +      G   + +D++A  L++K     +++ + TG +   GT+ANVF+ ++G   D+G   L  SKT++DKFE+++++ F  E +DLG ++K+ + HDN+G     WF+  +E+      +   F C RWL+K++DD  I R L+ A  Q             +Y                              T ++ Y IT+ T      G+    ++ +YG   + T    L   ++ +  +F   S     VE  DV E I+++ I +        W+ + + I   +P K     +T  C  WL+    ++KT R      IF+   ++D  +  V K+       + Y + + TG++   GT++ +++ ++G  G++    L K+E+    FERG  D F +E  D+G I KI++++D +     W++EK++I N++  + + F    +LS  K  G+ ++L  +     D          ++SN  S      + +          D+++ T      P      +  I P  +S+         H ++   SR  +  I   + +++R W  +P  K        R   R  + E      +     + E  YE+TV TGD    G   +++   YG    ++    E  +DK+K  F R   D   +  + +     +++     + +      +WF   + +KN+ T    +F    W+   +  +    E+            A ++E +      Y + V T    G GTDANVFI +FGEN +SG   L Q    N FE+   D F   + + LG + K+++ HD+      W L  V V++ S ++ + + C+ WLSKS+G
Sbjct:    2 NNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLA--LEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTG-KAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQ-----------TRLY------------------------------TPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGD----------RSSNCSSPADFWEIALS-----SKMADVDISTV---TGPMADYVQEGPIIPYYVSVTTGK-----HKDAATDSRAFIFLIGEDDERSKRIWLDYPRGK--------RGFSRGSVEEFYVAGLDVGIIKKIEVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTE----EMQLDKKKARFEREQNDTFIMEILDIAPFTKMRI-----RIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMC-----------AVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEG 821          

HSP 6 Score: 206.838 bits (525), Expect = 5.338e-53
Identity = 150/433 (34.64%), Postives = 219/433 (50.58%), Query Frame = 1
Query: 2401 YQFLCNRWLSDSHEDFSTVREIPATGPGIVKPA-----------PI-----------CKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPS--NSVTFRCNCWFDSSEGDGLTVRELTGTTLLGK-----VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNK----FEFGATDLFKIEAEDIGEI-KSIRISHDDTGAGSAWFVDQICV--IVP-KLGLKYIFF-LNKWL-----DSKTLE----YDLDPSK-------------IDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            Y F C RWL+   +D    RE+       V P            P+             + V I TG K  AGTDANVFI ++G + DTG   L  S TN++KFE+  ++ F +E + LG + K++LGHD+     GWFVD V   E   PS    +TF C  W   +E DG  +R+L    L  +     V YE+ + T  V  AGTD+N+FI I+G   D    Q K   TNK +    FE  +   F +E ED+GEI + IRI H++TG    W    + +  ++P K G + + F  ++WL     D KT+     YD+   K             +++    + Y + +FTG++  AGTD+KV+I IYG    T +  L   +++++ FERG  D F I AAD+GVI KI++ HD  K  + W+++KV
Sbjct:    7 YYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWV---EVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYG--CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKV 434          

HSP 7 Score: 200.29 bits (508), Expect = 6.745e-51
Identity = 201/795 (25.28%), Postives = 339/795 (42.64%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVF--ISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPE-WRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTR--YKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK---LDSGSVVEFR------TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED-----FSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT--FRCNCWFDSSEGDGLTVREL 2862
            D +LY V + T ++ GAGT   +YI+I GD  +     L K +    K        G+   F I  +DLG +  I + HD  +    W ++ VEI N  N+  +LF C  WLSL KEDG++ R LF  K           TGD   + +    F  I+L  +        +        Q G    + +  T          +  ++ + S  ++  +   D ++   W  + + K   S+      +V E   A   +GI  +    Y+++ +T +  G G+ ++I++ ++G NG ++ + + K K  F+        + +  +    K+++     G +P WFL ++++ +++   +  F  G WLS  KG+   + ++  V    E  +   Y + + T +   A T +  ++I+ G       L   +S N  W    KF+   TD         L  L ++    +  G    W L  + +          F C  WLS S    QT    V D +    K   +  E T+ + I T +     T   V L+L G   ++ + ++   S+      G+   F        ++A + + +  R          +W+++ I +T+   G+ Y F C+  +    +      F   +   +    +    P+ KY+V + TG +  AGTDANVF+ I+G  GDTG R L     N   FE+G  D F +E ++LG + K++L HDS    SGW V+KV   E  N S  V   F C  W D   GDGLT R+L
Sbjct:  347 DIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNK-----FERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLER-LFYEKEY---------TGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTG--------KHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSR-----GSVEEFYVAGLDVGIIKKIEVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSAN--W---NKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQT----VRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPV-KYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL--FERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKV---EVTNTSTGVATIFNCGRWLDKKRGDGLTWRDL 1096          

HSP 8 Score: 199.904 bits (507), Expect = 8.448e-51
Identity = 165/594 (27.78%), Postives = 266/594 (44.78%), Query Frame = 1
Query: 1609 FEFPCGQWLS--DVKGEGLEKILPVKK-----------------------LPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVIPADSK-----LDSGSVVEFRTELAIVG-IPYKLRAQHDNSGTNSSWNLEKI----LMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPA----------------TGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTG--------------------------TTLLGK----------VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDT 3111
            + FPC +WL+  +  G+   ++LPV +                       L ++ +   + + I TG + +A T +  ++ L G +  D  +  ++S+      + KF+    ++  VE  + L  L ++  G +  GK   WF+D + +  P  G   +F CG WL+ +    + + S++ DL   +L+T +      + +++YTSD+  A T++ + +++YG D   T    +  + +      +  S   F  EL  VG I  K+R  H+N+G N  W+   +    L+      +   F C+RWL+ S +D  T+RE+                      + +P  I  Y VQI+TGN   AGTDA V+I IYG+ GDTG+R+L  S   TNKFE+G  D F+IEA  LG I KIKL HD+    + W+V+KV IW + N  +   F C  W    + DG   R     E TG                          +T+ G           + Y V V TGK + A TDS  FI + G+  +            K  F  G+ + F +   D+G IK I + ++ T
Sbjct:    7 YYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQ-DDTGMTLLKSSK---TNSDKFERDSIEIFTVETLD-LGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKN----EDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTN-EDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIEVLYEMT 590          

HSP 9 Score: 198.749 bits (504), Expect = 1.873e-50
Identity = 148/524 (28.24%), Postives = 241/524 (45.99%), Query Frame = 1
Query: 2128 TWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYG-EKGDTGDRFL-THSTTNTNKFEKGQMDEFLIEAVKLGAI-SKIKLGHDSKLAGSGWFVDKVII---WEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTL---------------------LGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLD---------------------------PSKIDKIDKT---------------IPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQ---LPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHD 3471
            T+ V+I T   KNA T++ V + L+G    T   ++ +      K +  S+  F  E   +G  +K+R  HDN+G    W ++ + +     G    F C RWL+ + +D S +R++           P   Y++ +YT +   AGTDAN+FI IYG +   T  ++L T+       FE+     F++E   +G I  KI++GH++     GW    V I     +++ + ++TF C+ W  +SE D  T+REL    +                     L  V Y V++ TG + GAGTD+ V+I I+G  GDTG   L  S    NKFE G  D F IEA D+G I  I++ HD++   + W+V+++ +       +++F   +WL  K  +  L+                            SK+  +D +               IPY ++V TG    A TDS+ FI + G+D +  +   L        F RG+ + F +   DVG+I+KI + ++
Sbjct:   65 TFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIEVLYE 588          

HSP 10 Score: 192.971 bits (489), Expect = 1.270e-48
Identity = 159/593 (26.81%), Postives = 259/593 (43.68%), Query Frame = 1
Query: 2884 KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKIDKT-----IPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSD--TFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG------AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQL 4614
            +V YE+ V TG V G GTDSN+F+ ++G  G T  +QL      K +FE    D F +E  DI     +RI  D  G+   WF+++I +     G   +F+   WL  +  +  L       ID+        Y + V T D++ AGTD+ VFI I+G++  +  L LK  ++   FER N D F   +   +G + K+R+ HD K    GW                                                      LS +  ++ +  + + F C+ WL+  E D   VR+    + K      L+E  Y + ++TGN  G  T  NV+L + G+   S E  ++N+  +    F + + D F   +I LG +  + + H             AW++  + + +    + Y F C   +   +   +            +K ++  K  +S     Q      + V V T  +  AGTDANV + ++G   D+G   LKQ +   N FE G+ D F ++  +LGEL+K+R+ HD+SG  + W + KVE+     G + +F C  W+ K + DG   R+L+P +
Sbjct:  584 EVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDK---KKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGW-----------------------------------------------------HLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNK--ICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENS--SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKY------------FKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPSV 1100          

HSP 11 Score: 172.94 bits (437), Expect = 2.122e-42
Identity = 136/455 (29.89%), Postives = 209/455 (45.93%), Query Frame = 1
Query: 3706 FICNRWLASDEDDNMIVRELLPT-DEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKF-LIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDES--DEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGH----DNSGPNAD--WHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRP---------KIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP 5013
            F    WL+  +    +V E+    DE+      ++   Y V VKT +  G+GTDANVF+ IFG+NGDSG  ALK + +   NKFE  + D F     + LG L K+++ HDN      W+L YV V D S  + + F C  WL+ ++  G   +D   AN         NK+          D+LE    ++         T  NV +IL G  N S    ++ S +    F  G  D F+     LG++  + +GH    D   P  +  WH+  + I   + G  + F C+  I   +     +R+ +    +T T             +KYE+   T    GAGT+ANV++ ++G N  T K  L     ++  + G TD F++   ++ + + K+R+ HD+ G  S W +EKV V     N +  +A  F C RWL +   DG   R+L P
Sbjct:  680 FYYGDWLSQRKGKKTLVCEMCAVIDEE----EMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSAN--WNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACAN---------NKIC---------DELEETTYEIVIETGNGGETRENVWLILEGRKNRSKEFLMENS-SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKR-----KRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM-RNLFERGSTDRFFLETLELGE-LRKVRLEHDSSGYCSGWLVEKVEV----TNTSTGVATIFNCGRWLDKKRGDGLTWRDLFP 1098          

HSP 12 Score: 166.777 bits (421), Expect = 1.530e-40
Identity = 153/594 (25.76%), Postives = 248/594 (41.75%), Query Frame = 1
Query: 1216 NPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR-----------------------TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGF-----TDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLD--DIVIFCP-QTGIEQ-SFICGNWLSPSRPGCQTEVSLVE-DLSKRK------LKTVIDFTEN-----TWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI---------------PA-------------------TGP--GIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHD 2724
            N E  Y+F C+ WL+ +  D    RE+    E   +                          T + ++  T  K  AG+ A+++I +FG   ++ +  +K    N D F+  SI   T+    LG L K+++G+ N G  P WF++ V ++     +   FPCG+WL+  + +G  +  +   +     Y  +  YE+ + T +   A T +  ++I+ G        D + +  K    N + ++ F          VEL +    + +I  G N  G N  W     DI    P + G E  +F C  WL+ S    +T   LV  D+   K      L+ V    E       + V I+T +I  A T++KV + +YGD G T +  +       +K + G+   F  E A +G+ YK++ +HDNS   + W +EK+ +    N DE+ FLC RWLS   ED    R                 PA                   TGP    V+  PI  Y V + TG    A TD+  FI + GE  +   R           F +G ++EF +  + +G I KI++ ++
Sbjct:    2 NNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYG-------CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIEVLYE 588          

HSP 13 Score: 165.622 bits (418), Expect = 4.160e-40
Identity = 167/632 (26.42%), Postives = 259/632 (40.98%), Query Frame = 1
Query: 4534 SFVFPCNEWISKSKVDGNLERELYP-----------------------QLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKS-KLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDK--FEKNNMDEFEWEAVDLGKVF-KIDIRHDNSGFFKKDWFLKKIEI----IDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLE--TNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIF----------------------SIQDKM-----------MTNVSKK---ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSL-----YPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRI 6201
            ++ FPC  W++  + DG L REL P                        L+L   K     + +T  T  +K AGT+ANV+I ++G  D T  T L ++   S K +    ++F V   D+ D + K+R+GHDN G    W ++ V V      K       FPC RWLA++E+DG+I R+L   ++  R     +                  Y I +YT      GT+AN+F+ +YG +    +++ + +     K  FE+ +   F  E  D+G++  KI I H+N+G     W    ++I     DK   ET  F C+RWL+ S+DDKK  R L       E+     G  R +Y      LD                         + Y++ I TG     G+    ++ +YG     T    L K E  TN F  G+ +   +EA D+  I ++++ ++     + WY+  + I   T    +   CG WLS    + +  R+F                      ++  KM           M +  ++   I Y +SV TG      T+S  F+ L G     S      YP  K    F RG  + F +   DVG IKKI +
Sbjct:    6 TYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQ-KDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGD-LWKVRLGHDNTGKAPGWFVDWVEVDAPSLGK----CMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFV-----------------PYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTG-MNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKY-MKDGSLRQVYKEVEEPLD------------------------IVLYSVQIFTGNIPGAGTDAKVYITIYGDLG-DTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKR--GFSRGSVEEFYVAGLDVGIIKKIEV 585          

HSP 14 Score: 92.8189 bits (229), Expect = 7.232e-18
Identity = 71/293 (24.23%), Postives = 132/293 (45.05%), Query Frame = 1
Query:  466 DCYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEH----DGLEPKD--SWLLQGVEIMNVENKRIWLFTCNHWLSL-----YKEDGKVSRELFAFKS-----VRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            DC+ S  + +   +R  +          +E  Y++ + T +  G  T   +++ + G K       ++   +            G+T  F      LGD+ S+ + H    D   PK   +W ++ + I  +E   ++ F C+  + L     Y +  +V++   +F S     V  KYE++V TG    +GTD+ VF+++ G  G + + +L ++    F+RG T +F +    +G + K+R+  D SG  S W +++V +T+         F C  WL K  GD  T R++
Sbjct:  813 DCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRA------FRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGV-ATIFNCGRWLDKKRGDGLTWRDL 1096          

HSP 15 Score: 70.8626 bits (172), Expect = 3.419e-11
Identity = 37/96 (38.54%), Postives = 56/96 (58.33%), Query Frame = 1
Query: 3226 LDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVL 3513
            LD   I KI+  + Y++TV+TGDV+  GTDS +F+ +YG +  T+++ L  K   FER   D F +   D+    K+RI  DG      WFL+++L
Sbjct:  575 LDVGIIKKIE--VLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERIL 668          

HSP 16 Score: 58.9214 bits (141), Expect = 1.766e-7
Identity = 37/124 (29.84%), Postives = 59/124 (47.58%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+V VTT    GAGT   ++++I G   +  +  LK+  ++           GST  F +   +LG+L  + +EHD       WL++ VE+ N       +F C  WL   + DG   R+LF
Sbjct:  981 VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL-------FERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLF 1097          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Celegans
Match: F27C1.11 (pep chromosome:WBcel235:I:5433907:5443026:-1 gene:WBGene00017858.1 transcript:F27C1.11.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F27C1.11)

HSP 1 Score: 56.225 bits (134), Expect = 3.563e-7
Identity = 71/342 (20.76%), Postives = 129/342 (37.72%), Query Frame = 1
Query: 2512 YKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLI----------------EAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT---FRCNCWFDSSEGDGLTVRELTGTTLLGKVT------------------YEVEVKTGKVQGAGTDSNVFIRIFGQ----TGDTGNVQL--KTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKI----DKTIPYQITVFTGDVMHAGT------DSKVFIQIYGKDKKTDQLPLKS 3378
            Y  ++  GN+     D  +F  ++GE G + ++  T            Q D++L                  ++KLG ++ I +GH+ +  G+G F+DK++I E++  +       F+   WFDS + DGL VR +   + L  V+                  +E  + T      GT S++ I  +G       D  N  L    S   + + +FG          +IG ++ +R      G    ++++ +         + +  +N WL  +            +I    +   P  I  F G V           DS + +Q+  + K  D +PL S
Sbjct:  595 YTFEVMLGNRFGLDFDTPLFFVLHGENG-SSEKIYT------------QADDWLFLPSSCYDPESWILSSTRSLKLGVLTSIDVGHEQEGYGAGTFIDKIVITEDEKGAKECRRFYFQVEKWFDSGQVDGLIVRNIKVNSFLYLVSSTERGEGVVERKKETKGRWEFRLHTLNSDLGGTTSHLKIIGYGDENWLADDIPNDSLLRDPSQVPRIQVDFG----------NIGRLQKVRFEIQPAGDQPNYYLEYVEAQDLDTRERCVLMVNNWLLKEATPGYRKFQSFREIAIFSNNYYPASIRTFEGTVTFGDKSLIPPGDSPIILQLISQGKNHDDIPLDS 913          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Fly
Match: pns (gene:FBgn0035229 transcript:FBtr0072735)

HSP 1 Score: 68.5514 bits (166), Expect = 1.082e-10
Identity = 50/154 (32.47%), Postives = 76/154 (49.35%), Query Frame = 1
Query: 4180 MYKDWKDNKLDKSQFK-IYQEDKLENFNVKVYTTKKMYA-GTDANVHIILYGETNDSGIIPL-KQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTK 4632
            +Y     N +D   F  IY   KL  + V ++ ++K  +  T +NV I++ G  N++  +P+ K SL            EF     +LG L  +RIGHDNSGP+  W + +V +  E  G ++ FPC  W+ +   D + ER L  Q  LT  K
Sbjct: 1072 LYHLLTLNTVDYFSFTNIYPTTKLP-YRVVIFPSRKYGSYHTSSNVWIMVSGTMNETQRVPVPKGSL------------EFIFHYKNLGLLTTMRIGHDNSGPSHKWLVEQVVMRNEVTGHTYKFPCGRWLGRGVDDDSTERLLVGQRVLTNAK 1212          

HSP 2 Score: 59.3066 bits (142), Expect = 5.493e-8
Identity = 37/130 (28.46%), Postives = 66/130 (50.77%), Query Frame = 1
Query: 4639 KIKYEITTVTSNRKGA-GTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVI 5025
            K+ Y +    S + G+  T++NV+I V G  + T++  +   S +         +F+     +   +  +RIGHDN G    W +E+V+++    N+     Y+FPC RWL R  +D + ER L+  +V+
Sbjct: 1094 KLPYRVVIFPSRKYGSYHTSSNVWIMVSGTMNETQRVPVPKGSLEF--------IFHYKNLGL---LTTMRIGHDNSGPSHKWLVEQVVMR----NEVTGHTYKFPCGRWLGRGVDDDSTERLLVGQRVL 1208          

HSP 3 Score: 54.6842 bits (130), Expect = 1.606e-6
Identity = 31/96 (32.29%), Postives = 49/96 (51.04%), Query Frame = 1
Query: 2173 TNSKVILVLYGDNGKTDDIVIPADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVR 2460
            T+S V +++ G   +T  + +P  S       +EF      +G+   +R  HDNSG +  W +E+++M   V G  Y+F C RWL    +D ST R
Sbjct: 1112 TSSNVWIMVSGTMNETQRVPVPKGS-------LEFIFHYKNLGLLTTMRIGHDNSGPSHKWLVEQVVMRNEVTGHTYKFPCGRWLGRGVDDDSTER 1200          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Fly
Match: pns (gene:FBgn0035229 transcript:FBtr0072736)

HSP 1 Score: 68.5514 bits (166), Expect = 1.082e-10
Identity = 50/154 (32.47%), Postives = 76/154 (49.35%), Query Frame = 1
Query: 4180 MYKDWKDNKLDKSQFK-IYQEDKLENFNVKVYTTKKMYA-GTDANVHIILYGETNDSGIIPL-KQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTK 4632
            +Y     N +D   F  IY   KL  + V ++ ++K  +  T +NV I++ G  N++  +P+ K SL            EF     +LG L  +RIGHDNSGP+  W + +V +  E  G ++ FPC  W+ +   D + ER L  Q  LT  K
Sbjct: 1072 LYHLLTLNTVDYFSFTNIYPTTKLP-YRVVIFPSRKYGSYHTSSNVWIMVSGTMNETQRVPVPKGSL------------EFIFHYKNLGLLTTMRIGHDNSGPSHKWLVEQVVMRNEVTGHTYKFPCGRWLGRGVDDDSTERLLVGQRVLTNAK 1212          

HSP 2 Score: 59.3066 bits (142), Expect = 5.493e-8
Identity = 37/130 (28.46%), Postives = 66/130 (50.77%), Query Frame = 1
Query: 4639 KIKYEITTVTSNRKGA-GTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVI 5025
            K+ Y +    S + G+  T++NV+I V G  + T++  +   S +         +F+     +   +  +RIGHDN G    W +E+V+++    N+     Y+FPC RWL R  +D + ER L+  +V+
Sbjct: 1094 KLPYRVVIFPSRKYGSYHTSSNVWIMVSGTMNETQRVPVPKGSLEF--------IFHYKNLGL---LTTMRIGHDNSGPSHKWLVEQVVMR----NEVTGHTYKFPCGRWLGRGVDDDSTERLLVGQRVL 1208          

HSP 3 Score: 54.6842 bits (130), Expect = 1.606e-6
Identity = 31/96 (32.29%), Postives = 49/96 (51.04%), Query Frame = 1
Query: 2173 TNSKVILVLYGDNGKTDDIVIPADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVR 2460
            T+S V +++ G   +T  + +P  S       +EF      +G+   +R  HDNSG +  W +E+++M   V G  Y+F C RWL    +D ST R
Sbjct: 1112 TSSNVWIMVSGTMNETQRVPVPKGS-------LEFIFHYKNLGLLTTMRIGHDNSGPSHKWLVEQVVMRNEVTGHTYKFPCGRWLGRGVDDDSTER 1200          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Zebrafish
Match: loxhd1a (lipoxygenase homology domains 1a [Source:ZFIN;Acc:ZDB-GENE-091112-20])

HSP 1 Score: 1411.74 bits (3653), Expect = 0.000e+0
Identity = 817/2188 (37.34%), Postives = 1257/2188 (57.45%), Query Frame = 1
Query: 1147 IRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS-KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELT----GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV-LXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDK--SQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIK----------------------YEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVI-----RRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            I  D +G  +SW+LDRV +TD+  P  R+F+ C NWLS++ GD  TVR + G+   M I  + +Y  S +T +  G+G+ AD+Y+ IFGE    GE  ++  + KD F+ G+  + T+    LG L+KI +G+ N G    W  +KVII+D+    V+EFP   W    +G+G     +L     P       Y +++ TG+   A T S+ ++++ G +         +++ K+++E   F+    D+  VEL E LSPL+ +  G +  G N  W+ + + ++CP TG+EQ F CG W          E  L E +S R+ K      +  W + I+TSDIK A T+++V L +YG+NGK+D   + + S   +     +F  E+  +G   KLR  H+     S W+L ++ + + +  ++Y F+CNRWL  + +D   +RE+PA G  + +P P+ KY+V I TGN   +GTDA+V++NI G+ GDTG+R +  S  N NKFEKG  DEFL+EAV LG I ++++GHD +  G GWF+DKV++ EE  P ++S+ F C  W D +E DG  VREL     G  L   V Y + +KTG + GA +DS VF++++G+ GDT  + L  S  +  N FE G TD+F IE  DIG++  + I H + G  + WF+D + + VP  GL+Y+F  ++WL     D K +E ++ PS+  +I+K I Y++TV TGDV  AGT++ VF+QIYG++ K++ + LKS+S+ FERG  ++F+  A DVG + KIRIGHDG   G+GWFL+KV +   I +  +PE K ++K  +      ++  +    +   + R+ SF     ++  EE                   D  I+ EL   D       +L++  Y V V TG+  G+GTDA+V++ I+G+ GD+GER L+ +  N +NKFE    D+F I  +DLG L+K++IRHDN    A+WYLD V + D  DE  Y FPC  WLA ++D G L +++ P + A  K  +D + +   +Q  + Q+     F ++V T +K YAGTDANV  ILYG  +D+GII LK S  H NKFE G  DEF ++  D+G+LK+IRIGHDN+G +  W L  VEI+A  LGQ   FPC  W+ K K DG + R+LYP    T+   P IK                      YEI   T++    GT+A+V+I +YG+N  CT + +L  N    +   +    D+F V ++D+ D IEKIRIGHDN+G+   WHL++V ++RLL     S    FPC RWLA  EEDG   REL+P  +I     R G++  +   +D      + L+   YT+ V TG     GT+ANVF+ +YG+ GD+GER+L  S+ +++KFE+ ++D F  EAVDLG+VFKI IRHDNS     DW+L+++E++D+   E +LF CERWLS+ ++DK+I R  Y+ G++GER  A     +        +LDS  +           D+ D  +   I Y  ++ TG ++D  +S   ++ + G  + ++  + L     + F PG+ +  +    D        + ++G   ES W ++ +++E+PTK   Y   C  WL+K  G+  T+RI ++QD  M N+S+K+ Y ++V+TGDV   GT++ +++ +FG  G S    L K ED FERG  D F LE+ED+  ++K+R++ D +G RP WFL+K+++ N  T+E   F Y E+LS++ G K+ L  ++  + D    ++ T Y V VKTS+  +AGT + V +  +GE GD+G L LK     NK F+  Q D F FPD+LSLG+LS+ ++WH+NSG +  WHLEY+++ +    + ++F C++WL+  +DD QI REL C N  N       +T YE+ V T D  +A    + W V  G+K  S +F++EN+  K+K F R + D+ + +   LG++ +I LG +    +       WF +EV V        Y+F+  + I +  K  E   + F+ +  +E    + + + +    VKYE +V+TG   G GTDANVFIT+FG N +SG+R L +K  NLFE+GQ ++FILE +D+G + ++++EHD+S     W L R+++ N +      + C +WL K+K 
Sbjct:    2 IEHDNTGMSASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLLGSLNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVS-EGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWACDKVIIDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQP---MAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGN-------KNSGKLFLEGGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELYEMVSLRQKKQ----KKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWLDINEDDQEIIRELPAEGKLVAEPLPLLKYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVRELVPTDDGQRLFSAVGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGK-VEVEIYPSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFR--ALDVGRVYKIRIGHDGSGIGAGWFLEKVDVKRLIMAMVKPEKKEEEKKDKKKKKKKKAKEEEPPGELKEVVRTFSFPCGRWLARDEE-------------------DGEILVELRAED-----YEDLEDNTYEVHVFTGDMMGAGTDASVYINIYGEMGDTGERKLRKS--NHLNKFERGQEDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPSIKLVRVHGLYIIYVLISFEFAVVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVD------DALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKSE-NSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNS-MLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYVKGFEGERETAFCPIKK------VTNLDSNMNKKKK---RLSEDDEDEEEASLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRSERLWLDLDGKSAFLPGALDYFTCYGTD--------LGHDGATPESCWLVDELTVEVPTKAVRYVFRCKCWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLEDRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNK-FERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACAN--NDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSA-KKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEF--QTFECTKFIE----SFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKA 2110          

HSP 2 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 593/2077 (28.55%), Postives = 948/2077 (45.64%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLES-ILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRG-AKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESD----VIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRV--FEFPCGQWL--SDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLV--EDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS-KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNG-----------------------------------DEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVREL-----------------TGTTLLG------KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKIDKT------------------------IPYQITVFTGDVMHAGTDSKVFIQIYGKD-----KKTDQLPLKSKSDTFERGNEDVFKINAADVG-VIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELK--------------YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIF-------------PANPAMYKDWKDNKLDK---SQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGET--GTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEW-EAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSK---EVISVEAPDVENIKQVEICNEG--VDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKK-----ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN-FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKN 6315
            I+Y V V T D++GAGT+  I++ + G K N    +L                     IF +   +L    S + I HD       W  + V +         +F C  W    + DG V REL+   S+R K      + + + T D+  +GTD++VF+ + G  G S Q +L +  +  F++ Q  KF+I    +G I K+RI  ++    S W+L RV +      E +Y F C  WL  +  D   +RE+    K +       +Y+++  T N  G+G+ A +Y+ I G+ G++      +   N + F++G+  E  +    LG ++++++G+   G    WFL+KV++ +  Q      EFPC +WL  ++  G+ + +++P       +    Y + I TG+   AS+ S+ +V L G +     +  + S N +      F+ G TD+  +E  + +  +  ++ G    G    WFLD ++I+ P  G++  F    WL       + EV +   E L   KL          + V++ T D+  A TN+ V L +YG+ GK++ I + + S   + G+   FR     VG  YK+R  HD SG  + W LEK+ + + +                                       + F C RWL+   ED   + E+ A     ++      Y+V ++TG+ M AGTDA+V+INIYGE GDTG+R L  S  + NKFE+GQ DEF I  + LG + K+++ HD+K A + W++D+V I++ ++ +    F C  W    E DG   REL                 +G   LG        T+ + VKTG+ + AGTD+NVF  ++G   DTG + LK S  +KNKFE G  D F IEA DIG++K IRI HD+ GA   WF+D + +  P LG    F   +WL    D   +  DL P+++  +  T                        +PY+I +FT D+   GTD+ VFI +YG++     +K+  +  + +   FER  ED+F +   D+G +I+KIRIGHD +    GW LD+V                                               + L +  +  E  I    F C RWLA  E+D   +REL+P+D     LS    LK              Y V V TG+ +G+GTDANVF+T++G  GD+GER L  + +NS NKFE  S+D F ++A+DLG + KI+IRHDNS   A WYL+ V V D+  E  +LF C  WL+  ++   + +  +             P       D   NK  K      +  +E  L  ++  V T     A T + V++I+ G+ +      L   L   + F  G  D F     DL        GHD + P + W + ++ +E       +VF C  W++K + DG   R L  Q +  +    K+ YE+T +T + + AGT+  +Y+ V+G    +E+  L    D  + + G  D F + +ED+  P+ K+R+  D  G    W L+K+ +  L  ++  +  YE     WL+R                   G    L   +  V     +++   YT+ V T   T  GT+ANV++ ++GENGD+G   L +S  +T+KFE+   D F + + + LG++ K+ I HDNSG     W L+ +++ D    + + F C+RWL+K++DD +I R L  A   G                                   + DE          Y I + T    D  +    W+ L G K      +     +   F  G+    E  S E  D+ +I    I  +G  V  E+SW+++ + +     G  Y   C   +S    +R   + F     + + +SK      + Y   VITGD    GT++ +F+ +FG+ G+S    L K   N FERG  + F LE+ D+G + ++++++D +G  P W L +++ITN +   +  F   ++L KN
Sbjct:  189 IVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKL--------FLEGGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELYEMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKL-ESKSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTRE-KYSFVCNRWLDINEDDQEIIRELPAEGKLVAEPLPLLKYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVRELVPTDDGQRLFSAVGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDL---GNYFETGQTDIFTIETFD-IGKVNRLLIGHTNEGLRAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGKVEVEIYPSETLEIEKLI--------NYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFRA--LDVGRVYKIRIGHDGSGIGAGWFLEKVDVKRLIMAMVKPEKKEEEKKDKKKKKKKKAKEEEPPGELKEVVRTFSFPCGRWLARDEEDGEILVELRAEDYEDLEDNT---YEVHVFTGDMMGAGTDASVYINIYGEMGDTGERKLRKS-NHLNKFERGQEDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYF-FPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPSIKLVRVHGLYIIYVLISFEFAVVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRV---------------------------------------------EIRRLLRKGKGSETAI----FPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKS-ENS-NKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYVKGFEGERETAFCPIKKVTNLDSNMNKKKKRLSEDDEDEEEASLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRS-ERLWLDLDGKSAFLPGALDYFTCYGTDL--------GHDGATPESCWLVDELTVEVPTKAVRYVFRCKCWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLED--RFERGQVDTFNLEIEDI-APLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYE----EWLSRS-----------------YGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES-NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSG-PAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDG----------------------------------VDFDEK-------TKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPIS-LSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKN 2108          

HSP 3 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 606/2231 (27.16%), Postives = 982/2231 (44.02%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF--AFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKF-VIPATCVGPISKIRIRQDESGSKSSWYLDRVCI----TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISF----YTENKPGAGSHADIYIQIFGENGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKI--LPV--KKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQS----FICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDD-IVIPADSKL----DSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI-PATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVII----------------------------------WEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTL--LGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----------------DSKTLEYDLD------PSKIDKIDKTIP--YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK---SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKG---NPLSNLKELK-----------------YMVDVKTGNEFGSGTDANVFLTIFGKNGD-SGERALKNTVDNSVNKFEEKSLDKFLIKAIDLG-TLEKIKIRHDNSNGGAAWYLDYVLV------NDESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQ------------------LSLTMTKRPK--------------IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVEN---IKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKN--EDNFERGHRDHFKLEMEDVGKIKKI---RIQNDGNGDR--PHWFLEKLDITNESTNESYQF-------------EYNEF-LSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFR 6723
            Y  +V T D KG+GT   +Y++I G+  +    +L                 G+   F I   +LG L  I I H+       W    V I ++ NK ++ F  + W  + + DGK+ R++   A + +   Y + V+TGD+  +GT+SK+ + + G  G     +LF E    F+R Q   F V     + P+S++ I  D +G    WY ++V +    T L+       F C  W  +D GD    RE+    E++ +  + + K  +    +T +  GAG+ A +++Q++GENG+SD   +++K D F++    +  + +  +G ++K+++ ++   P   W L +V +        + F C +WL D+  +  E I  LP   K + E     KY + I TGN + + T +  Y+ + G   +  ++++    S N +     KF++G  D   VE    L  +  +  G +  G    WFLD +++   + G  ++    F C  WL  +    Q    LV     ++L     F+   + ++I T  I  AS++SKV + LYG+ G T+  +++ +D+ L    ++G    F  E   +G   +L   H N G  + W L+ +L+   V+G +Y F  +RWL     D     EI P+    I K   +  Y+V + TG+   AGT+ANVF+ IYGE+G +    L    + +N FE+G  + F   A+ +G + KI++GHD    G+GWF++KV +                                   E +    + +F C  W    E DG  + EL       L   TYEV V TG + GAGTD++V+I I+G+ GDTG  +L+ S  + NKFE G  D F I   D+G +K +RI HD+  A ++W++D++ +   K    Y F   +WL                D   ++ D D      P+++    K +   + + V TG+  +AGTD+ VF  +YG    T  + LK+     + FE G  D F I A D+G +++IRIGHD      GWFLD V I+                                        +PS   L +             F C RWL   +DD  IVR+L P + +     P   L  +                  Y + + T + F  GTDA+VF+ ++G+NG  + +++L          FE  + D F+++  D+G  +EKI+I HDN      W+LD V +         S+  +FPC  WLA +++ G   +++ P++  + K  +D  L   + ++    ++  + V V T     AGTDANV I LYG+  D+G   L +S  +SNKFE G+ D F ++  DLG++ KIRI HDNS  +ADW+L +VE+  +   + F+F C  W+S+ + D  ++R  Y +                  L   M K+ K              I Y  +  T + + A T++ VY+ + G+     +    +   KS    G  D F     D         +GHD     S W ++++ V+       K++ Y F C  WLA+D  DG   R L           N       Q   + NI QK  Y + V TG     GT+  +++ V+G  G S E  L   +   D+FE+  +D F  E  D+  + K+ +R D SG  + DWFL KIE+ +   +E   F  E WLS+S                        G  R++       +D                  D    E   YT+++ T      G+    WM ++G       +   +   TN F     +V     PD+ +   + +V I ++       W+L  + +     GK +   C  WL+K   + +  R  +  +    +  +K  Y I V T D+D   T    ++ L G +G S  + L+ +  +  F RG+ D F+   +++G I  I    I  DG   +    WF++++ +T +     Y F             E+  F  +K +      A  L P+       Y+ IV T + K AGT + V +  +G  GDSG  +L     N   F+  Q + FI  ++L +GDL R QV H+NSG S  W L  IE+       +  F C KWL     D +I R
Sbjct:   66 YIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKL-------VSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWACDKVIIDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQPMAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLEGG-TFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQ-----VFPCGRWFDEDEGDGLVERELY---EMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWL-DINEDDQEIIRELPAEGKLVAEPLPLLKYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLM--FMSKNNV----NKFEKGNADEFLVEA-VTLGQIRRVRIGHDGRGGGCGWFLDKVMV--REEGQPEASSIEFPCYRWLDRNEDDGQIVRELVPTDDGQRL-----FSAVGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGKVEVEIYPSETLEIEK---LINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSE---LIRLKSRSNNFERGTTEIF--RALDVGRVYKIRIGHDGSGIGAGWFLEKVDVKRLIMAMVKPEKKEEEKKDKKKKKKKKAKEEEPPGELKEVVRTFSFPCGRWLARDEEDGEILVELRAEDYEDLEDNTYEVHVFTGDMMGAGTDASVYINIYGEMGDTGERKLRKS-NHLNKFERGQEDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEID----------------------------------------APSLGQLLR-------------FPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPSIKLVRVHGLYIIYVLISFEFAVVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKS-ENSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYVKGFEGERETAFCPIKKVTNLDSNMNKKKKRLSEDDEDEEEASLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRSERLWLDLDGKSAFLPGALDYFTCYGTD---------LGHDGATPESCWLVDELTVEV----PTKAVRYVFRCKCWLAKDRGDGLTARIL-----------NV------QDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLE---DRFERGQVDTFNLEIEDIAPLRKMRVRIDASG-SRPDWFLDKIELHNLQTDEVATFTYEEWLSRS-----------------------YGPKRTLICEMPAVID------------------DEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRF--PDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVK------YEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLN--LFERGQTNRFIL-ELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKR 2116          

HSP 4 Score: 408.297 bits (1048), Expect = 2.393e-114
Identity = 339/1284 (26.40%), Postives = 587/1284 (45.72%), Query Frame = 1
Query: 4021 IRHDNSNGGAAWYLDYVLVNDESDEYL---FPCFSWLATNKDGGHLSKDIFPA-NPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK--FESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNAS---DKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGP-KNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISI--EMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQG--NSSLYPLDKNE--DNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDI---KKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEV-----------------------------------KTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSD--KFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIV--------EDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL--VQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSK---GLWKILTPSE*HCNYLTIFYMCLRCF*MRFILYVVILFAFIV 7659
            I HDN+   A+W+LD V+V D +  +L   + C +WL+  +  G   + +  + NP                 I +++K   +   V+T     +GTDA+V++ ++GE  D+G    ++ L    K  FE GN D+F ++  +LG L+KI IGH+N G +A W   KV I+     + + FP + W   S+ DG ++R++    +  M     I Y +  +T + +GAGTN+ +++ ++G      K N N+     +    +    D+F V + ++  P+ ++ IGHDN G+   W+ EKV V        +     FPC RW   DE DG +EREL     +R+                    +K  +++ ++T      GT+A VFL+VYGENG S + +L   ++ +D FE+   D+F  E  D+GK+ K+ I H+    F   W L ++ ++     E Y F C RWL  ++DD++I R L     +G+    P                                         + Y +TI TG     G+    ++ + G   +    ++ + K   N F  G+ +   VEA  +  I++V I ++G      W+L+ + +  E   +       C  WL +   + +  R     D      S  + Y I++ TG ++   ++S +F++L+G +G  N  L  +  N+  + FE G  D F +E  D+GK+ ++ I +   G R  WFL+ + I        Y F  + +L K+    K + +++ P   +   K  +Y+V V T +V +AGT++ V ++ YGE G S  + LK+   N   F+    + F     L +G + + ++ H+ SG  + W LE +++K +                                   +  R++ FPC +WL+  ++D +I  EL  E+  +       + +YEV V TGD   AG    V+   YGE   +   K    N+++K   F R  ED+  +T + LG LK +++     +++    +  W+ + V + +      Y F  Q W+ V E   +   E+  +            E+   A++   +K     + + V TG+    GTDANVF  L+G   ++G   L   +  +N FE G  D+F +E VD+GK+++I+I HD++     WFLD V++   S  ++ ++PC  WL K K    + + L P+E      T     +R   + +I+YV+I F F V
Sbjct:    2 IEHDNTGMSASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLLGSLNP---------------MDIPKQNK---YIASVFTMDAKGSGTDADVYLNIFGEFGDTG----ERKLVSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWACDKVIIDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQPMA----IVYNVQVMTGDIRGAGTNSKIHLVMHGH-----KGNKNSGKLFLEGGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQV----FPCGRWFDEDEGDGLVERELYEMVSLRQKKQ-----------------KKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKL---ESKSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSG-WHLGRVTLMKTLTREKYSFVCNRWLDINEDDQEIIREL---PAEGKLVAEP--------------------------------------LPLLKYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVRELVPTDDGQRLFSA-VGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGK-VEVEIYPSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNN---FERGTTEIF---RALDVGRVYKIRIGHDGSGIGAGWFLEKVDVKRLIMAMVKPEKKEEEKKDKKKKKKKKAKEEEPPGELKEVVRTFSFPCGRWLARDEEDGEILVELRAEDYED-----LEDNTYEVHVFTGDMMGAGTDASVYINIYGEMGDTGERKLRKSNHLNK---FERGQEDEFTITGMDLGPLKKLRI-----RHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPSIKLVRVHGL-YIIYVLISFEFAV 1166          

HSP 5 Score: 338.191 bits (866), Expect = 1.242e-92
Identity = 279/988 (28.24%), Postives = 463/988 (46.86%), Query Frame = 1
Query:  778 IEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFAFKSV-----RTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI-RGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL--EKILPVKKLPERYQ-KYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQD----WFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGL-----------------------------------KYIFFLNKWL--DSKTLEYDLDPSKIDKID-KTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKS--DTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            IEHD      SW L  V + ++    + + + CN+WLS  + DG   R L    +      + KY   V T D   SGTD+ V++++ G  G + + +L  E    F+RG   KF I A  +G + KI I  +  GS + W  D+V I D+ N E  Y F    W     GD    R++  GA + M I     Y +   T +  GAG+++ I++ + G  G  +   +     F EG  FE       +   L  L  L ++ +G+ N G    W+  KV +      L+Q     FPCG+W  + +G+GL   ++  +  L ++ Q K+ + + I T +   A T ++ ++ + G   K     K+ES      ++  F++   D   +E+     P    I  + +  + ++    W L  + +    T  + SF+C  WL  +    + +  ++ +L               + V+I T ++  + T++ V L + GD G T + ++       +K + G+  EF  E   +G   ++R  HD  G    W L+K+++ +         +F C RWL  + +D   VRE+  T  G  +      Y + I TG+   A +D+ VF+ +YGEKGDT    L  S  +  N FE GQ D F IE   +G ++++ +GH ++   +GWF+D V+IW    P + +   F  + W    E DG    E+  +  L     + YEV V TG V  AGT++NVF++I+G+ G +  ++LK   +  N FE G T++F+  A D+G +  IRI HD +G G+ WF++++ V    + +                                    + F   +WL  D +  E  ++    D  D +   Y++ VFTGD+M AGTD+ V+I IYG+   T +  L+  +  + FERG ED F I   D+G ++K+RI HD K+  + W+LD+V
Sbjct:    2 IEHDNTGMSASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLLGSLNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWACDKVIIDDMGNKE-VYEFPVDAWFDISEGDGKIQRDVLAGATQPMAIV----YNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKL-----FLEGGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQV----FPCGRWFDEDEGDGLVERELYEMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQF-KLES------KSDSFEQAQCDKFIIEM-----PDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWLDIN----EDDQEIIRELPAEGKLVAEPLPLLKYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVRELVPTDDG-QRLFSAVGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIWV---PVHGLQYMFPSHRWLCKDEADGKVEVEIYPSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLK---SRSNNFERGTTEIFR--ALDVGRVYKIRIGHDGSGIGAGWFLEKVDVKRLIMAMVKPEKKEEEKKDKKKKKKKKAKEEEPPGELKEVVRTFSFPCGRWLARDEEDGEILVELRAEDYEDLEDNTYEVHVFTGDMMGAGTDASVYINIYGEMGDTGERKLRKSNHLNKFERGQEDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRV 950          

HSP 6 Score: 260.381 bits (664), Expect = 7.555e-69
Identity = 195/596 (32.72%), Postives = 299/596 (50.17%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYV-LVNDESDEYL-FPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVK-CCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKG-----LGSAWHLEKVLV-KRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLY 5451
            RY F C  WLA D  D +  R L   D +   +S  +++ Y V V TG+   +GTD  +++T+FG  G S E  L    D    +FE   +D F ++  D+  L K+++R D S     W+LD + L N ++DE   F    WL+ +       + +    PA+  D              +  +L  + V V T+    AGTDANV +I++GE  D+G + LK+S  ++NKFE    D F+      LGEL K+RI HDNSGP   WHL  V++  + LG+ F F C+ W++K++ DG + REL    +  +    K KYEI   T++   A T  N +I + G+   +++  L N++ K +   G TD F  S +++ D I  I +GH  K      + ++W +++V+V ++ L NK     Y F C         D  I      D+           + I+   S A  L    Y   V TG E   GT+ANVF+ ++G NGDSG RQL   K   + FE+   + F  E +D+G + ++ + HDNSG     W L +IEI +  +  T +F C +WL K+K D +I+R +Y
Sbjct: 1569 RYVFRCKCWLAKDRGDGLTARILNVQDAEMVNIS--QKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLED----RFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGP---KRTLICEMPAVIDD-------------EEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES-NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGD-IASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNK-----YIFRC---------DAPISLSSKRDEF----QTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLC--KKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGL-SPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIY 2119          

HSP 7 Score: 214.157 bits (544), Expect = 8.180e-55
Identity = 172/659 (26.10%), Postives = 300/659 (45.52%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSREL------FAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHAT-VREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK-----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG---LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAG-INVGGK----NQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTD--DIVIPADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI 2466
            I Y  +VTT   + A TS  +Y+ I G      ++  +  +            PG+   F    +DLG        HDG  P+  WL+  + +        ++F C  WL+  + DG  +R L          S +  YE+ V+TGD+  +GTD+++++++ G  G S ++ L K   + F+RGQ   F +    + P+ K+R+R D SGS+  W+LD++ + +L+  E   F   + WLS+ +G   T + E+    +   +   T Y +S  T +   AG+ A++++ IFGENG++  + +K     NK   K+  +F     +  LG L K+++ + N+GP P W L  V ++D    + F F C +WL+  + +G    E         +  +K KYE+ ++T +   A T   A+++L+G + + K      S  K      +F  G TD       E L  +  I  G I   GK       WF+D++++   + G +  F C   +S S    + +        +  +          +   + T D K A T++ V + ++G NG +    +     +  + G    F  EL  +G   +++ +HDNSG +  W L +I +T   NG    F+C +WL  +  D    R I
Sbjct: 1483 IPYHFSVTTGSDRDASTSSRVYVIIIG------KMHKRSERLWLDLDGKSAFLPGALDYFTCYGTDLG--------HDGATPESCWLVDELTVEVPTKAVRYVFRCKCWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLEDR-FERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATF-TYEEWLSRSYGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRFP-DILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKK-----KRFLRGNTDRFEFSSKE-LGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVI 2118          

HSP 8 Score: 180.644 bits (457), Expect = 1.246e-44
Identity = 130/411 (31.63%), Postives = 204/411 (49.64%), Query Frame = 1
Query: 3817 YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAI-DLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGH-----DNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWIS-KSKVDGNLERELYPQLSLTMTKRPK---IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP 5013
            Y V VKT +   +GTDANV++ IFG+NGD+G   LK +  N+ NKFE K  D F    I  LG L K++I HDNS     W+L+YV V+D+    ++ F C  WLA N+D G + +++  AN            D   F     D+   + + V T     A T  N  I+L G+   S    L+ S     +F  GN D F+    +LG++  I +GH           A W + +V +  ++LG  ++F C+  IS  SK D     E    +   ++K      +KYE   +T + KGAGT+ANV+I ++G N  + +  L      +  + G T+ F + + D+ D + ++++ HDN GL   W L ++ +     N    +   F C +WL +++ DG I+R + P
Sbjct: 1735 YTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES--NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANN-----------DGVDF-----DEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENS-AKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKF-LNLFERGQTNRFILELLDMGDLL-RVQVEHDNSGLSPGWLLSRIEI----TNTANGVTTIFICGKWLDKNKADGRIKRVIYP 2120          

HSP 9 Score: 132.494 bits (332), Expect = 6.191e-30
Identity = 89/312 (28.53%), Postives = 158/312 (50.64%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG-----AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQ 4611
            ++ F C+RWLA +EDD  I+REL   +  G      ++ KY + V T +   + T  N ++ + GK G S E  L+N+      +F   + D+F   + +LG +  I + H   +G      A+W++D V+V ++   ++Y+F C + ++              +    ++ ++  K  +S     Q      +   V T  +  AGTDANV I ++G   DSG   L +     N FE G  + F ++  D+G+L ++++ HDNSG +  W L+++EI     G + +F C +W+ K+K DG ++R +YP+
Sbjct: 1828 KFRFQCDRWLAKNEDDGQIMRELACANNDGVDFD--EKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKK--RFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPIS------------LSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFL--NLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIYPK 2121          

HSP 10 Score: 130.183 bits (326), Expect = 2.814e-29
Identity = 131/560 (23.39%), Postives = 237/560 (42.32%), Query Frame = 1
Query:  469 CYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRG-----DKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSL-YKEDGKVSRELFAFKSVR-----TKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKE-NTQCFQRGQTSKFVIP-ATCVGPISKIRIRQDESGSKSSWYLDRVCI-TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGA-KEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN---KDGFKEGSIFEHTLPLRQLGTLKKIKVGN-----KNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERY-------QKYKYEMKISTGNRAHASTTSRAYVIL---KGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRP 2049
            C+ +    + L  R  + +    ++   +++Y+V V T DV+ AGT   IY+++ G     ++  LP++               +   G    F +   D+  L  + +  D    +  W L  +E+ N++   +  FT   WLS  Y     +  E+ A          T Y + V T D   +GTD+ V++ + G  G +  + L +  NT  F+R QT  F  P    +G +SK+RI  D SG    W+L+ V +  D+   ++R  FQC  WL+K+  D   +RE+  A  + +    +T+Y+I   T +   A +  + +I + G+ G S    ++N   K  F  G+        ++LG +  I +G+     K    +  WF+++VI+ + +    + F C   +S        +     K  E +          KYE  + TG+   A T +  ++ +    G   + ++  K  +          F+ G T+   +EL + +  L  +    +  G +  W L  I I     G+   FICG WL  ++ 
Sbjct: 1576 CWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLE-------------DRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFR--FQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNL---------FERGQTNRFILELLD-MGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKA 2110          

HSP 11 Score: 67.781 bits (164), Expect = 2.203e-10
Identity = 43/126 (34.13%), Postives = 61/126 (48.41%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHD--GLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+  V T D KGAGT   ++I+I G   +  R +L K   +           G T  F +   D+GDL  + +EHD  GL P   WLL  +EI N  N    +F C  WL   K DG++ R ++
Sbjct: 2003 VKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNL-------FERGQTNRFILELLDMGDLLRVQVEHDNSGLSP--GWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIY 2119          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Zebrafish
Match: loxhd1a (lipoxygenase homology domains 1a [Source:ZFIN;Acc:ZDB-GENE-091112-20])

HSP 1 Score: 1048.5 bits (2710), Expect = 0.000e+0
Identity = 626/1671 (37.46%), Postives = 945/1671 (56.55%), Query Frame = 1
Query:  922 LFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS-KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEAN-----IDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDK--SQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVI-----RRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYI-AGYQGERSNAPSGRSRS---IYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNE 5826
            + +F SV   YE+V +TGD+  +GTD+ VF++L G  G+SP++ L  ++   F++ +T  F I    VG    IR+        +SW+LDRV +TD+  P  R+F+ C NWLS++ GD  TVR + G+   M I  + +Y  S +T +  G+G+ AD+Y+ IFGE    GE  ++  + KD F+ G+  + T+    LG L+KI +G+ N G    W    VII+D+    V+EFP   W    +G+G     +L     P       Y +++ TG+   A T S+ ++++ G +         +++ K+++E   F+    D+  VEL E LSPL+ +  G +  G N  W+ + + ++CP TG+EQ F CG W          E  L E +S R+ K      +  W + I+TSDIK A T+++V L +YG+NGK+D   + + S   +     +F  E+  +G   KLR  H+     S W+L ++ + + +  ++Y F+CNRWL  + +D   +RE+PA G  +        Y+V I TGN   +GTDA+V++NI G+ GDTG+R +  S  N NKFEKG  DEFL+EAV LG I ++++GHD +  G GWF+DKV++ EE  P ++S+ F C  W D +E DG  VREL  T     V Y + +KTG + GA +DS VF++++G+ GDT  + L  S  +  N FE G TD+F IE  DIG++  + I H + G  + WF+D + + VP  GL+Y+F  ++WL     D K +E ++ PS+  +I+K I Y++TV TGDV  AGT++ VF+QIYG++ K++ + LKS+S+ FERG  ++F+I A DVG + KIRIGHDG   G+GWFL+KV                    +    +        ++     K+     SLSQ  E+E        +  + F C RWLA DE+D  I+ EL   D       +L++  Y V V TG+  G+GTDA+V++ I+G+ GD+GER L+ +  N +NKFE    D+F I  +DLG L+K++IRHDN    A+WYLD V + D  DE  Y FPC  WLA ++D G L +++ P + A  K  +D + +   +Q  + Q+     F ++V T +K YAGTDANV  ILYG  +D+GII LK S  H NKFE G  DEF ++  D+G+LK+IRIGHDN+G +  W L  VEI+A  LGQ   FPC  W+ K K DG + R+LYP    T+   P + YEI   T++    GT+A+V+I +YG+N  CT + +L  N    +   +    D+F V ++D+ D IEKIRIGHDN+G+   WHL++V ++RLL     S    FPC RWLA  EEDG   REL+P  +I     R G++  +   +D      + L+   YT+ V TG     GT+ANVF+ +YG+ GD+GER+L  S+ +++KFE+ ++D F  EAVDLG+VFKI IRHDNS     DW+L+++E++D+   E +LF CERWLS+ ++DK+I R  Y+           P    R    IY  + +         H                + I Y  ++ TG ++D  +S   ++ + G  + ++  + L     + F PG+ +  +    DV  IK+VE+  E
Sbjct:   19 MLSFSSV---YEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHLASKSRTAFEKNKTDVFRIKTHNVG-FCNIRLV---IYIFASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLLGSLNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVS-EGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGW----VIIDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQP---MAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGN-------KNSGKLFLEGGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELYEMVSLRQKKQ----KKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWLDINEDDQEIIRELPAEGKLV--------YRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVRELVPTD--DAVGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGK-VEVEIYPSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFRIEALDVGRVYKIRIGHDGSGIGAGWFLEKV------------------DVKRLIMAMVKPEKKEEEKKDKKKKKKKKASLSQSIEEEPPGELKEVVRTFSFPCGRWLARDEEDGEILVELRAED-----YEDLEDNTYEVHVFTGDMMGAGTDASVYINIYGEMGDTGERKLRKS--NHLNKFERGQEDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVD------DALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKSE-NSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNS-MLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYVKVCLHVCMCCTPGVFWRVAIFIYCKNVSKCFHICQIPH----------------KLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRSERLWLDLDGKSAFLPGALDYFTCYGTDVGEIKKVEVIYE 1603          

HSP 2 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 577/2056 (28.06%), Postives = 923/2056 (44.89%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLES-ILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESD----VIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRV--FEFPCGQWLSDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLV--EDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS-KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKI------------------------------LMTQAVNGD----------EYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVREL-----------------TGTTLLG------KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKIDKT--IPYQITVFTGDVMHAGTDSKVFIQIYGKD-----KKTDQLPLKSKSDTFERGNEDVFKINAADVG-VIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELK--------------YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFP---------ANPAMYKDWKDN-----KLDKSQFKIYQ-EDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGET--GTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEW-EAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSK---EVISVEAPDVENIKQVEICNEG--VDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKK-----ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN-FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKN 6315
            I+Y V V T D++GAGT+  I++ + G K N    +L                     IF +   +L    S + I HD       W  + V +         +F C  W    + DG V REL+   S+R K      + + + T D+  +GTD++VF+ + G  G S Q +L +  +  F++ Q  KF+I    +G I K+RI  ++    S W+L RV +      E +Y F C  WL  +  D   +RE+    +++       Y+++  T N  G+G+ A +Y+ I G+ G++      +   N + F++G+  E  +    LG ++++++G+   G    WFL+KV++ +  Q      EFPC +WL   + +G      V++L        Y + I TG+   AS+ S+ +V L G +     +  + S N +      F+ G TD+  +E  + +  +  ++ G    G    WFLD ++I+ P  G++  F    WL       + EV +   E L   KL          + V++ T D+  A TN+ V L +YG+ GK++ I + + S   + G+   FR E   VG  YK+R  HD SG  + W LEK+                               ++Q++  +           + F C RWL+   ED   + E+ A     ++      Y+V ++TG+ M AGTDA+V+INIYGE GDTG+R L  S  + NKFE+GQ DEF I  + LG + K+++ HD+K A + W++D+V I++ ++ +    F C  W    E DG   REL                 +G   LG        T+ + VKTG+ + AGTD+NVF  ++G   DTG + LK S  +KNKFE G  D F IEA DIG++K IRI HD+ GA   WF+D + +  P LG    F   +WL    D   +  DL P+++  +  T  +PY+I +FT D+   GTD+ VFI +YG++     +K+  +  + +   FER  ED+F +   D+G +I+KIRIGHD +    GW LD+V                                               + L +  +  E  I    F C RWLA  E+D   +REL+P+D     LS    LK              Y V V TG+ +G+GTDANVF+T++G  GD+GER L  + +NS NKFE  S+D F ++A+DLG + KI+IRHDNS   A WYL+ V V D+  E  +LF C  WL+  ++   + +  +            P ++  W+       K     F I Q   KL  ++  V T     A T + V++I+ G+ +      L   L   + F  G  D F     D+GE+KK+ + ++ +    D   A  + +              +++   V G  E  L P+L                                                   + + + G  D F + +ED+  P+ K+R+  D  G    W L+K+ +  L  ++  +  YE     WL+R                   G    L   +  V     +++   YT+ V T   T  GT+ANV++ ++GENGD+G   L +S  +T+KFE+   D F + + + LG++ K+ I HDNSG     W L+ +++ D    + + F C+RWL+K++DD +I R L  A   G                                   + DE          Y I + T    D  +    W+ L G K      +     +   F  G+    E  S E  D+ +I    I  +G  V  E+SW+++ + +     G  Y   C   +S    +R   + F     + + +SK      + Y   VITGD    GT++ +F+ +FG+ G+S    L K   N FERG  + F LE+ D+G + ++++++D +G  P W L +++ITN +   +  F   ++L KN
Sbjct:  270 IVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKL--------FLEGGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELYEMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKL-ESKSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTRE-KYSFVCNRWLDINEDDQEIIRELPAEGKLV-------YRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDG----QIVRELVPTDDAVGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDL---GNYFETGQTDIFTIETFD-IGKVNRLLIGHTNEGLRAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGKVEVEIYPSETLEIEKLI--------NYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFRIEALDVGRVYKIRIGHDGSGIGAGWFLEKVDVKRLIMAMVKPEKKEEEKKDKKKKKKKKASLSQSIEEEPPGELKEVVRTFSFPCGRWLARDEEDGEILVELRAEDYEDLEDNT---YEVHVFTGDMMGAGTDASVYINIYGEMGDTGERKLRKS-NHLNKFERGQEDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYF-FPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRV---------------------------------------------EIRRLLRKGKGSETAI----FPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKS-ENS-NKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYVKVCLHVCMCCTPGVF--WRVAIFIYCKNVSKCFHICQIPHKLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRS-ERLWLDLDGKSAFLPGALDYFTCYGTDVGEIKKVEVIYEVTVLTGDVQHAGTDTQI-------------YMTVFGVYGTSEEMLLPKL---------------------------------------------------EDRFERGQVDTFNLEIEDI-APLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYE----EWLSRS-----------------YGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES-NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSG-PAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDG----------------------------------VDFDEK-------TKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPIS-LSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKN 2103          

HSP 3 Score: 525.013 bits (1351), Expect = 1.709e-151
Identity = 453/1744 (25.97%), Postives = 787/1744 (45.13%), Query Frame = 1
Query: 2512 YKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTT----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLK--YIFFLNKWLD----SKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQ-KIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEI--EAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDK--SKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSG------RSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKL-ETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLS-----------------KFMG------ERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPL--DKNEDN-FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKK------TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGD-SGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGD-LSRCQVWHNNSGFSSRWHLEYIEMKEV----KTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNET---------------SYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREAD-----------------GEIFDISNIVEDPNKARVEELKK--KGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRP-LVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSD 7446
            Y+V   TG+   AGTDANVF+ ++GE G +    L  ++ +   FEK + D F I+   +G    I+L        + WF+D+VI+ +   P     + CN W    EGDGLTVR L G+     +  +  Y   V T   +G+GTD++V++ IFG+ GDTG  +L +    K+ FE G  D F IEA ++G ++ I I H++ G+ + W      VI+  +G K  Y F ++ W D       ++ D+       +   I Y + V TGD+  AGT+SK+ + ++G     +   L  +  TFER   D+F +   ++     ++ IGHD      GW+ +KV +                                            F  L Q+            F C RW   DE D ++ REL             K+  + + + T +  G+GTDA VFL ++G+NG S +  L++  D+    FE+   DKF+I+  D+G + K++I H+  N  + W+L  V +      ++Y F C  WL  N+D   + +++      +Y+                        V + T     +GTDA+V++ + G+  D+G   +  S  + NKFE GN DEF V+   LG+++++RIGHD  G    W L KV +  E +    S  FPC  W+ +++ DG + REL P           + Y I   T +  GA +++ V++++YG    T K  L  + +   +  +TG TD+F +   D+   + ++ IGH N+GL + W L+ VL+   +      + Y FP +RWL +DE DG +E E+ P + +             +++ + N      Y + V TG     GTNANVFL++YGE G S   +L+  K+ ++ FE+   + F  EA+D+G+V+KI I HD SG     WFL+K+++         +   +    + +   K ++    A         P G      R+ S   G   + D +      G    E    D    E   Y + + TG     G+    ++ +YG     T   +L+K    N F  G ++  ++   D+  +K++ I ++     +SWYL+ + I       +Y   C  WL+                  FM       E        ++ K M+      T+ + V TG+    GT++ +F  L+GT+ ++ +  L   KN  N FE G  D F +E  D+GK+K+IRI +D  G  P WFL+ ++I   S  +  +F    +L K       +  DL P N+++         Y++ + T+++ + GT + V +  YG+ G  +    L   ++  + +     ++    ++  +GD + + ++ H+N G +  WHL+ +E++ +    K   +  FPC +WL+ +++D +  REL+  +     K SR+ T               +Y VTV TGD   AG   +V+   YG+   + +  +  + +  K F R S D   +  V LG++  I+   + + N +   S  W+  +V V +  T + ++F  + W+    + +  D                 G  + ++  +   N ++   + +    ++ Y   V TG      T + V++ + G+  +  +R  L   G++ F  G  D F     D+G+I+K+++ ++ +    D
Sbjct:   26 YEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHL--ASKSRTAFEKNKTDVFRIKTHNVG-FCNIRL---VIYIFASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLLGSLNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSE--GKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGW------VIIDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQPM--AIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLEGGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYC-----------------------------------------PFTGLEQV------------FPCGRWFDEDEGDGLVERELYEMVSLRQ--KKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDS----FEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWLDINEDDQEIIRELPAEGKLVYR------------------------VTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVRELVPT-------DDAVGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIG-KVNRLLIGHTNEGLRAGWFLDSVLIWVPV----HGLQYMFPSHRWLCKDEADGKVEVEIYPSETL-------------EIEKLIN------YEVTVVTGDVWAAGTNANVFLQIYGEEGKS---ELIRLKSRSNNFERGTTEIFRIEALDVGRVYKIRIGHDGSG-IGAGWFLEKVDV-----KRLIMAMVKPEKKEEEKKDKKKKKKKKASLSQSIEEEPPGELKEVVRTFSFPCGRWLARDEED-----GEILVELRAEDYEDLEDNTYEVHVFTGDMMGAGTDASVYINIYGEMG-DTGERKLRKSNHLNKFERGQEDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMST-----TFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKG-KDDGAIVRDLYP-NELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWLAHSEEDGETIRELVPSDII-VEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKSENSNK-FERGSVDTFTLEAVDLGQVFKIR---IRHDNSML--SADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYVKVCLHVCMCCTPGVFWRVAIFIYCKNVSKCFHICQIPHKLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRSERLWLDLDGKSAFLPGALDYFTCYGTDVGEIKKVEVIYEVTVLTGD 1610          

HSP 4 Score: 461.07 bits (1185), Expect = 6.702e-131
Identity = 384/1384 (27.75%), Postives = 642/1384 (46.39%), Query Frame = 1
Query: 3685 ANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGD--SGERALKNTVDNSVNKFEEKSLDKF-LIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVND--ESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYG-RNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGETGTNAN--VFLKVYGENGDSGERQLVDSKTHT-DKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSI----------------------------------SIEMPTKGKL------YNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNE--DNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDI-----------------------KKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNE--TSYEVTVITGDKKNAGMPHDVWFVFYGEKNY--SDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKK----WFCNEVHVKNLAT----LKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVK--------------YEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQ-KGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSK 7533
             N + Y F  + W    E D  I R++L    +  P++    + Y V V TG+  G+GT++ + L + G  G+  SG+  L+         FE   +D F +     L  L ++ I HDN+     WY + V V       E +FPC  W   ++  G + ++++       K  K  K   S +              ++T+    AGTDA V + +YGE   S    L+   + S+ FE   CD+F ++  D+G+++K+RI H+   P + WHL +V +      + + F CN W+  ++ D  + REL  +         K+ Y +T  T N  G+GT+A+VY+ + G   D  E+    + ++ +K + G  D F V    +   I ++RIGHD +G G  W L+KV+V+     +  SI  EFPC RWL R+E+DG I REL+P       + +A+G                 Y I + TG   G +++  VF+K+YGE GD+ +  LV S     + FE    D F  E  D+GKV ++ I H N G  +  WFL  + I        Y+F   RWL K + D K++  +Y           PS            +L+ +K                      I Y +T+VTG     G++   ++++YG +  K+ +IRL K  +N F  G+ E+  +EA DV  + ++ I ++G    + W+L  +                                  SIE    G+L      ++  CG WL++   E     +  ++ +   ++    TY + V TGD+   GT++++++ ++G  G++    L K+   + FERG  D F +   D+G +KK+RI++D       W+L++++I +      Y F    +L+ +     +L  +L P+++                          T + + VKT   K AGT + V    YG   D+G + LK  + +   F++  +DEF   + + +G L R ++ H+N+G S  W L+++E+      +  +FPC +WL    DD  I R+L     PN  +T        YE+ + T D    G   DV+ + YG+     S K +  N  ++   F R++ED      +++ EL++I  G ++ K  +  D++     W  + V ++ L       +T +F  + W+  H    E DGE   I  +V  P+   VE+L + G +K              Y + V TG   G GTDANVFITL+G+  ++G+R L + +  N FE+G  D F LE VDLG++ KI+I HD+S   +DW+L++V+V +  T +I+ + C  WLS+ +
Sbjct:  234 GNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQ--PMA----IVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLEG------GTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELYEMVSLRQK--KQKKFPWSLW--------------IFTSDIKGAGTDAQVFLQVYGENGKSDQFKLE---SKSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWLDINEDDQEIIRELPAE--------GKLVYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQ-IRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSI--EFPCYRWLDRNEDDGQIVRELVP-------TDDAVG-----------------YHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGL-RAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGKVEVEIY-----------PS-----------ETLEIEK---------------------LINYEVTVVTGDVWAAGTNANVFLQIYGEEG-KSELIRL-KSRSNNFERGTTEIFRIEALDVGRVYKIRIGHDGSGIGAGWFLEKVDVKRLIMAMVKPEKKEEEKKDKKKKKKKKASLSQSIEEEPPGELKEVVRTFSFPCGRWLAR--DEEDGEILVELRAEDYEDLEDN-TYEVHVFTGDMMGAGTDASVYINIYGEMGDTGERKLRKSNHLNKFERGQEDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVD-EDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTI-EAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLY----PNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAED------MFIVELQDI--GDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWL-AHS---EEDGET--IRELV--PSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKSENSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKR 1480          

HSP 5 Score: 363.614 bits (932), Expect = 1.805e-100
Identity = 193/517 (37.33%), Postives = 307/517 (59.38%), Query Frame = 1
Query: 5998 KITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            ++ Y ++V+TGDV   GT++ +++ +FG  G S    L K ED FERG  D F LE+ED+  ++K+R++ D +G RP WFL+K+++ N  T+E   F Y E+LS++ G K+ L  ++  + D    ++ T Y V VKTS+  +AGT + V +  +GE GD+G L LK     NK F+  Q D F FPD+LSLG+LS+ ++WH+NSG +  WHLEY+++ +    + ++F C++WL+  +DD QI REL C N  N       +T YE+ V T D  +A    + W V  G+K  S +F++EN+  K+K F R + D+ + +   LG++ +I LG +    +       WF +EV V        Y+F+  + I +  K  E   + F+ +  +E    + + + +    VKYE +V+TG   G GTDANVFIT+FG N +SG+R L +K  NLFE+GQ ++FILE +D+G + ++++EHD+S     W L R+++ N +      + C +WL K+K 
Sbjct: 1599 EVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLEDRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNK-FERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACAN--NDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSA-KKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEF--QTFECTKFIE----SFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKA 2105          

HSP 6 Score: 362.459 bits (929), Expect = 4.313e-100
Identity = 310/1108 (27.98%), Postives = 491/1108 (44.31%), Query Frame = 1
Query:  538 LSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIM---NVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQC---FQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIIN---------------------------DLDQS-------------RVFEFPCGQWLSDVKGEGLEKILPVKKLPERYQKYK---YEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLV---EDLSKR-----------KLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKG--DTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLG-AISKIKLGHDSKLAGSGWFVDKVII---WEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLL-------GKV--------------TYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKI-----------------------------------DKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQ---LPLKSKSDTFERGNEDVFKINAADVGVIQKIRI 3462
            L    +++Y+V + T +V G+GT   +Y++I GD  +    RL        K+   K   G+   F +    LG +  + I HDG      W L  V +      E   I  F C  WL   ++DG++ REL         Y I + TG ++ + +DSKVF+ L G  G + ++ L   +      F+ GQT  F I    +G ++++ I     G ++ W+LD V I  +     +Y F    WL KD  D     EI    E + I     Y+++  T +   AG++A++++QI+GE G+S++I +K++ + F+ G+     +    +G + KI++G+  +G    WFL KV +                             L QS             R F FPCG+WL+  + +G  +IL V+   E Y+  +   YE+ + TG+   A T +  Y+ + G E+ D    K+  +N +     KF+ G  D   +     L PL ++    +    N  W+LD + IF  +      F C  WL+      Q    LV   E   KR           +L         T+ + + T + K A T++ V  +LYG    T  I + A     +K + G + EF  E   +G   ++R  HDN+G +  W L+ + +     G   +F C RWL    +D + VR++       V   P   Y+++I+T +    GTDA+VFI +YG+ G   +      +       FE+   D F++E   +G  I KI++GHD++    GW +D+V I     +   S +  F C  W   SE DG T+REL  + ++       G +              TY V V TG V GAGTD+NVFI ++G  GDTG  +L  S  N NKFE G+ D F +EA D+G++  IRI HD++   + W+++Q+ V+       ++F   +WL  K  +  +D     K+                                    K IPY  +V TG    A T S+V++ I GK  K  +   L L  KS  F  G  D F     DVG I+K+ +
Sbjct:  513 LPAEGKLVYRVTICTGNVSGSGTDASVYLNIIGDLGDTGE-RL----MFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSI-EFPCYRWLDRNEDDGQIVRELVPTDDA-VGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIW-VPVHGLQYMFPSHRWLCKDEADGKVEVEIY-PSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFRIEALDVGRVYKIRIGHDGSGIGAGWFLEKVDVKRLIMAMVKPEKKEEEKKDKKKKKKKKASLSQSIEEEPPGELKEVVRTFSFPCGRWLARDEEDG--EIL-VELRAEDYEDLEDNTYEVHVFTGDMMGAGTDASVYINIYG-EMGDTGERKLRKSNHL----NKFERGQEDEFTI-TGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKS-ENSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYVKVCLHVCMCCTPGVFWRVAIFIYCKNVSKCFHICQIPHKLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRSERLWLDLDGKS-AFLPGALDYFTCYGTDVGEIKKVEV 1600          

HSP 7 Score: 298.13 bits (762), Expect = 1.912e-80
Identity = 251/910 (27.58%), Postives = 426/910 (46.81%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFAFKSV-----RTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI-RGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL--EKILPVKKLPERYQK-YKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVEL------------NEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDL-SKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICV 3150
            +Y+V   T DVKGAGT   +++++ G+    P++ L    ++             T +F I+  ++G     L+    +    SW L  V + ++    + + + CN+WLS  + DG   R L    +      + KY   V T D   SGTD+ V++++ G  G + + +L  E    F+RG   KF I A  +G + KI I  +  GS + W    V I D+ N E  Y F    W     GD    R++  GA + M I     Y +   T +  GAG+++ I++ + G  G  +   +     F EG  FE       +   L  L  L ++ +G+ N G    W+  KV +      L+Q     FPCG+W  + +G+GL   ++  +  L ++ QK + + + I T +   A T ++ ++ + G   K     K+ES      ++  F++   D   +E+            +EK +P +              W L  + +    T  + SF+C  WL  +    + +  ++ +L ++ KL          + V+I T ++  + T++ V L + GD G T + ++       +K + G+  EF  E   +G   ++R  HD  G    W L+K+++ +         +F C RWL  + +D   VRE+  T   +        Y + I TG+   A +D+ VF+ +YGEKGDT    L  S  +  N FE GQ D F IE   +G ++++ +GH ++   +GWF+D V+IW    P + +   F  + W    E DG    E+  +  L     + YEV V TG V  AGT++NVF++I+G+ G +  ++LK+     N FE G T++F+IEA D+G +  IRI HD +G G+ WF++++ V
Sbjct:   25 VYEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHLASKSRTA-------FEKNKTDVFRIKTHNVGFCNIRLV----IYIFASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLLGSLNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGW----VIIDDMGNKE-VYEFPVDAWFDISEGDGKIQRDVLAGATQPMAIV----YNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKL-----FLEGGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQV----FPCGRWFDEDEGDGLVERELYEMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQF-KLES------KSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFS-------------GWHLGRVTLMKTLTREKYSFVCNRWLDIN----EDDQEIIRELPAEGKL---------VYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVRELVPTDDAV-------GYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIWV---PVHGLQYMFPSHRWLCKDEADGKVEVEIYPSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKS---RSNNFERGTTEIFRIEALDVGRVYKIRIGHDGSGIGAGWFLEKVDV 859          

HSP 8 Score: 246.514 bits (628), Expect = 1.100e-64
Identity = 183/559 (32.74%), Postives = 282/559 (50.45%), Query Frame = 1
Query: 3808 ELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYV-LVNDESDEYL-FPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVK-CCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKG-----LGSAWHLEKVLV-KRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLY 5451
            E+ Y V V TG+   +GTD  +++T+FG  G S E  L    D    +FE   +D F ++  D+  L K+++R D S     W+LD + L N ++DE   F    WL+ +       + +    PA+  D              +  +L  + V V T+    AGTDANV +I++GE  D+G + LK+S  ++NKFE    D F+      LGEL K+RI HDNSGP   WHL  V++  + LG+ F F C+ W++K++ DG + REL    +  +    K KYEI   T++   A T  N +I + G+   +++  L N++ K +   G TD F  S +++ D I  I +GH  K      + ++W +++V+V ++ L NK     Y F C         D  I      D+           + I+   S A  L    Y   V TG E   GT+ANVF+ ++G NGDSG RQL   K   + FE+   + F  E +D+G + ++ + HDNSG     W L +IEI +  +  T +F C +WL K+K D +I+R +Y
Sbjct: 1599 EVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLED----RFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGP---KRTLICEMPAVIDD-------------EEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES-NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGD-IASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNK-----YIFRC---------DAPISLSSKRDEF----QTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQL--CKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSG-LSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIY 2114          

HSP 9 Score: 199.904 bits (507), Expect = 1.827e-50
Identity = 168/652 (25.77%), Postives = 300/652 (46.01%), Query Frame = 1
Query: 5614 AYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIK--QVEICNEG--VDRESSWYLNSISIEMPTKGKL-YNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPL-DKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNL--FEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKI--WKYPCNEWLSKSK 7533
             Y +  VTG  K  G+    ++ L+G   +   +         + A  S+        DV  IK   V  CN    +   +SW+L+ + +    +  L +   C  WLS+  G+  T R + +      ++ K+  Y+ SV T D    GT++ ++L +FG  G++    L  + +DNFERG+ D F +E  ++G+++KI I ++  G    W +    I +    E Y+F  + +   + G  K     LA         Y V V T +++ AGT+S + +  +G  G  +SG L L+        F+  Q+D F    +  L  LSR  + H+N+G +  W+ E + +    T     FPC +W    + D  + REL      +  +  + +  + + + T D K AG    V+   YGE   SD+F +E+  D    F ++  DK  +    +G+++ +++      +E  +    W    V +    T + Y F    W++++E     D EI              + EL  +G + Y + + TG  +G GTDA+V++ + G+  ++G+R +     N+  FE+G  D+F++E V LG+I +++I HD       WFLD+V V+     +    ++PC  WL +++
Sbjct:   25 VYEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKV---------HLASKSRTAFEKNKTDVFRIKTHNVGFCNIRLVIYIFASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVR-YLLGSLNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWVI----IDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQPMAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLE-----GGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELY--EMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDS---FEQAQCDKFIIEMPDIGKIRKLRIW-----HEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWLDINED----DQEI--------------IRELPAEGKLVYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNE 629          

HSP 10 Score: 187.963 bits (476), Expect = 7.176e-47
Identity = 142/527 (26.94%), Postives = 250/527 (47.44%), Query Frame = 1
Query:  934 KSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHAT-VREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK-----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG---LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAG-INVGGK----NQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTD--DIVIPADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI 2466
            K V   YE+ V+TGD+  +GTD+++++++ G  G S ++ L K   + F+RGQ   F +    + P+ K+R+R D SGS+  W+LD++ + +L+  E   F   + WLS+ +G   T + E+    +   +   T Y +S  T +   AG+ A++++ IFGENG++  + +K     NK   K+  +F     +  LG L K+++ + N+GP P W L  V ++D    + F F C +WL+  + +G    E         +  +K KYE+ ++T +   A T   A+++L+G + + K      S  K      +F  G TD       E L  +  I  G I   GK       WF+D++++   + G +  F C   +S S    + +        +  +          +   + T D K A T++ V + ++G NG +    +     +  + G    F  EL  +G   +++ +HDNSG +  W L +I +T   NG    F+C +WL  +  D    R I
Sbjct: 1596 KKVEVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLEDR-FERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATF-TYEEWLSRSYGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRFP-DILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKK-----KRFLRGNTDRFEFSSKE-LGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVI 2113          

HSP 11 Score: 181.03 bits (458), Expect = 9.113e-45
Identity = 130/411 (31.63%), Postives = 204/411 (49.64%), Query Frame = 1
Query: 3817 YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAI-DLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGH-----DNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWIS-KSKVDGNLERELYPQLSLTMTKRPK---IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP 5013
            Y V VKT +   +GTDANV++ IFG+NGD+G   LK +  N+ NKFE K  D F    I  LG L K++I HDNS     W+L+YV V+D+    ++ F C  WLA N+D G + +++  AN            D   F     D+   + + V T     A T  N  I+L G+   S    L+ S     +F  GN D F+    +LG++  I +GH           A W + +V +  ++LG  ++F C+  IS  SK D     E    +   ++K      +KYE   +T + KGAGT+ANV+I ++G N  + +  L      +  + G T+ F + + D+ D + ++++ HDN GL   W L ++ +     N    +   F C +WL +++ DG I+R + P
Sbjct: 1730 YTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES--NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANN-----------DGVDF-----DEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENS-AKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKF-LNLFERGQTNRFILELLDMGDLL-RVQVEHDNSGLSPGWLLSRIEI----TNTANGVTTIFICGKWLDKNKADGRIKRVIYP 2115          

HSP 12 Score: 154.066 bits (388), Expect = 1.490e-36
Identity = 146/566 (25.80%), Postives = 233/566 (41.17%), Query Frame = 1
Query: 5104 YTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENI---KQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKN--EDNFERGHRDHFKLEMEDVGKIKKI---RIQNDGNGDR--PHWFLEKLDITNESTNESYQF-------------EYNEF-LSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFR 6723
            Y + V TG     GT+  +++ V+G  G S E  L   +   D+FE+  +D F  E  D+  + K+ +R D SG  + DWFL KIE+ +   +E   F  E WLS+S                        G  R++       +D                  D    E   YT+++ T      G+    WM ++G       +   +   TN F     +V     PD+ ++    +V I ++       W+L  + +     GK +   C  WL+K   + +  R  +  +    +  +K  Y I V T D+D   T    ++ L G +G S  + L+ +  +  F RG+ D F+   +++G I  I    I  DG   +    WF++++ +T +     Y F             E+  F  +K +      A  L P+       Y+ IV T + K AGT + V +  +G  GDSG  +L     N   F+  Q + FI  ++L +GDL R QV H+NSG S  W L  IE+       +  F C KWL     D +I R
Sbjct: 1602 YEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLE---DRFERGQVDTFNLEIEDIAPLRKMRVRIDASGS-RPDWFLDKIELHNLQTDEVATFTYEEWLSRS-----------------------YGPKRTLICEMPAVID------------------DEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRF--PDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVK------YEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLN--LFERGQTNRFIL-ELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKR 2111          

HSP 13 Score: 133.65 bits (335), Expect = 2.198e-30
Identity = 114/390 (29.23%), Postives = 190/390 (48.72%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSD---LGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKS------VRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENT---QCFQRGQTSKFVIPATCVGPISKI---RIRQDESGSK--SSWYLDRVCITDLKNPEWRYFFQCKN--WLSKDHGDHATVREIRGAKEIMGIASR---TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNK--DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG 1656
            +Y V+V T+D   AGT   +++ I G+  +   + LK+   +NK           T +F  R  D   LG+L  + I HD   P   W L+ V++ +    + + F C+ WL+  ++DG++ REL    +       +TKYEI+V T D+DD+ T    +I L G+ G S +  L  EN+   + F RG T +F   +  +G I+ I    I +D    K  +SW++D V +T+ K    +Y F+C     LS    +  T    +  +  +  A      +Y+    T ++ GAG+ A+++I IFG NG+S    +  K  + F+ G      L L  +G L +++V + N+G  P W L+++ I +        F CG+WL   K +G
Sbjct: 1729 IYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNK------FERKQTDVF--RFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVL--ENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTE-KELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADG 2107          

HSP 14 Score: 133.65 bits (335), Expect = 2.644e-30
Identity = 124/549 (22.59%), Postives = 250/549 (45.54%), Query Frame = 1
Query: 5569 AFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKT---SRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDK--NEDNFERGHRDHFKL-EMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND-----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWH-----NNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTD--DDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFY------GEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEI 7143
             + TD  +  + E I Y +T++TG  +  G+    +M ++G       ++ L KLE + F  G  +  ++E  D+  ++++ +  +       W+L+ I +      ++   T   WLS+  G ++T        I D+ M  ++    Y +SV T D    GT++ +++ +FG  G++    L +  N + FER   D F+  ++  +G++ K+RI +D +G  P W LE +D+ ++   + ++F+ + +L+KN     ++  +LA  N+      +KT Y+++V T+++  A T     +   G+ G S +  L+   +  +  + N  D F F     LGD++   + H           + W ++ + + E +    + F C+  +S++   D+ Q F       +      S     YE  VITGD+K AG   +V+   +      G +    KF+         LF R   ++  +  + +G+L  +++     +++    S  W  + + + N A   T +F    W++ +    +ADG I
Sbjct: 1587 CYGTDVGEIKKVEVI-YEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEML-LPKLE-DRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGPKRTLICEMPAVIDDEEMVELT---IYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKN-EDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNT-DRFEFSSK-ELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFL--------NLFERGQTNRFILELLDMGDLLRVQV-----EHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKN----KADGRI 2109          

HSP 15 Score: 132.88 bits (333), Expect = 4.061e-30
Identity = 89/312 (28.53%), Postives = 158/312 (50.64%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG-----AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQ 4611
            ++ F C+RWLA +EDD  I+REL   +  G      ++ KY + V T +   + T  N ++ + GK G S E  L+N+      +F   + D+F   + +LG +  I + H   +G      A+W++D V+V ++   ++Y+F C + ++              +    ++ ++  K  +S     Q      +   V T  +  AGTDANV I ++G   DSG   L +     N FE G  + F ++  D+G+L ++++ HDNSG +  W L+++EI     G + +F C +W+ K+K DG ++R +YP+
Sbjct: 1823 KFRFQCDRWLAKNEDDGQIMRELACANNDGVDFD--EKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKK--KRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPIS------------LSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFL--NLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIYPK 2116          

HSP 16 Score: 131.339 bits (329), Expect = 1.153e-29
Identity = 129/532 (24.25%), Postives = 227/532 (42.67%), Query Frame = 1
Query:  553 EILYKVAVTTADVKGAGTSIPIYISIRG-----DKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSL-YKEDGKVSRELFAF-----KSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKE-NTQCFQRGQTSKFVIP-ATCVGPISKIRIRQDESGSKSSWYLDRVCI-TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGA-KEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN---KDGFKEGSIFEHTLPLRQLGTLKKIKVGN-----KNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERY-------QKYKYEMKISTGNRAHASTTSRAYVIL---KGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRP 2049
            E++Y+V V T DV+ AGT   IY+++ G     ++  LP++               +   G    F +   D+  L  + +  D    +  W L  +E+ N++   +  FT   WLS  Y     +  E+ A          T Y + V T D   +GTD+ V++ + G  G +  + L +  NT  F+R QT  F  P    +G +SK+RI  D SG    W+L+ V +  D+   ++R  FQC  WL+K+  D   +RE+  A  + +    +T+Y+I   T +   A +  + +I + G+ G S    ++N   K  F  G+        ++LG +  I +G+     K    +  WF+++VI+ + +    + F C   +S        +     K  E +          KYE  + TG+   A T +  ++ +    G   + ++  K  +          F+ G T+   +EL + +  L  +    +  G +  W L  I I     G+   FICG WL  ++ 
Sbjct: 1599 EVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLE-------------DRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFR--FQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNL---------FERGQTNRFILELLD-MGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKA 2105          

HSP 17 Score: 102.834 bits (255), Expect = 5.353e-21
Identity = 80/260 (30.77%), Postives = 124/260 (47.69%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEH---DG--LEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSR-------ELFAFKS---VRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            Y++ VTTAD+  A T    +I + G K       L+   K  +         G+T  F     +LGD+ SI + H   DG  ++ + SW +  V +   E    ++F C+  +SL  +  +          E F  K+   V  KYE +VITGD   +GTD+ VFI++ G  G S + QL K+    F+RGQT++F++    +G + ++++  D SG    W L R+ IT+  N     F  C  WL K+  D    R I
Sbjct: 1861 YEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKR------FLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFI-CGKWLDKNKADGRIKRVI 2113          

HSP 18 Score: 101.293 bits (251), Expect = 1.722e-20
Identity = 95/389 (24.42%), Postives = 172/389 (44.22%), Query Frame = 1
Query: 6379 YKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEV-KTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGE-KNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKF-ILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            Y+V+  T +VK AGT + V V  +GEFG S  + L +  ++   F+ N+ D F     +   ++  C +      F+S W L+ + + ++ +    + + CN WLS  + D    R L+   + NP    + +  Y  +V T D K +G   DV+   +GE  +  ++ ++    D    F R +EDK  +    LG L+ I +G   + N+    S  W    V + ++   + Y F + +W +    I E DG+I           +  +    +   + Y + V+TG   G GT++ + + + G         L  +G   FE+ Q D F +     L  + ++ I HD++     W+ ++V V    T     +PC  W  + +G
Sbjct:   26 YEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHLAS--KSRTAFEKNKTDVF----RIKTHNVGFCNIRLVIYIFAS-WFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLL--GSLNPMDIPK-QNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDN---FERGNEDKFTIEAPNLGRLRKITIG---HNNK--GSSAGW----VIIDDMGNKEVYEFPVDAWFD----ISEGDGKI----------QRDVLAGATQPMAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLEG-GTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEG 377          

HSP 19 Score: 93.5893 bits (231), Expect = 3.645e-18
Identity = 69/257 (26.85%), Postives = 126/257 (49.03%), Query Frame = 1
Query: 6781 YEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKT-YVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI 7548
            YEV  +TGD K AG   +V+   +GE   S K  + +        SR++ +K K T V+  +  N+    +     +++    WF + V V ++      + +   +W+   E      G+   +  ++   N   + +  K     Y   V T    G GTDA+V++ +FGE  ++G+R LV +G++ FE+G EDKF +E  +LG++ KI I H++    + W    V + ++   +++++P + W   S+G  KI
Sbjct:   26 YEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHLASK-------SRTAFEKNK-TDVFRIKTHNVGFCNIRLVIYIFA---SWFLDRVIVTDMNRPHLRFFYACNNWLSREE------GDGLTVRYLLGSLNPMDIPKQNK-----YIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGW----VIIDDMGNKEVYEFPVDAWFDISEGDGKI 256          

HSP 20 Score: 85.5001 bits (210), Expect = 1.017e-15
Identity = 46/117 (39.32%), Postives = 72/117 (61.54%), Query Frame = 1
Query: 7186 VEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            V E+KK  V+ YE+ V+TG     GTD  +++T+FG    S +  L+ K  + FE+GQ D F LE  D+  + K+++  D S  R DWFLD++++ NL T+++  +   EWLS+S G
Sbjct: 1592 VGEIKKVEVI-YEVTVLTGDVQHAGTDTQIYMTVFGVYGTS-EEMLLPKLEDRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYG 1706          

HSP 21 Score: 67.781 bits (164), Expect = 2.059e-10
Identity = 43/126 (34.13%), Postives = 61/126 (48.41%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHD--GLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+  V T D KGAGT   ++I+I G   +  R +L K   +           G T  F +   D+GDL  + +EHD  GL P   WLL  +EI N  N    +F C  WL   K DG++ R ++
Sbjct: 1998 VKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNL-------FERGQTNRFILELLDMGDLLRVQVEHDNSGLSP--GWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIY 2114          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Zebrafish
Match: loxhd1b (lipoxygenase homology domains 1b [Source:ZFIN;Acc:ZDB-GENE-081104-370])

HSP 1 Score: 908.672 bits (2347), Expect = 0.000e+0
Identity = 521/1310 (39.77%), Postives = 778/1310 (59.39%), Query Frame = 1
Query: 3700 YWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-----DKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLE-TNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVN----KNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTP 7557
            Y F C+RWLASDE+D  +V ELLP D +      L+E  Y V+V TGN  G+GTDANVF+ I+G+NGD+GER L+ +  N +NKFE    D F I A++LGTL+K++IRHDNS G +AWYLD V + D  D+  Y FPC  WLA ++D G +++++ P + A  +  +D +   +   + Q+     + +++ T +K +AGTDANV  IL+GE +D+GII LK S +H NKFE G  D F V+  DLGEL K+RIG      ++ W L  VEI+A   GQ   FPC  W+ + + DG + R+LYP    T    P + YEI+T TS+   AGT+ANV+I +YG+N  CT++  L  N    +   +    D+F V +EDV D +EKIRIGH+N+G    WHL++V ++RLL     S    FPC RWLA+ E+DG   REL+P     +K++R G++       ++++ V + L+   Y + V TG     GT+ANVFL +YGE GD+GER+L  S++  +KFEK  +D+F  EAVDLG VFKI IRHDNS     DW+L ++E+++   +E ++F CERWLSK K+D +I RT Y+ GY+GER+  P    +++ +  A  LDS  +       A   +E        I Y  T+ TG ++D  ++   ++ + GP +L+T  + L   E    FA G  E       DV  IK+VE+ + G   ES W ++ +S+ +PTKG  YN  C  WL+K  G+  T+R+F+I D    ++ +K+ Y ++V+TGD    GT++ +F+ +FG  G++    L+K ED FERG  D F LE++D+  +KK+R++ DG G RP WFL+K+ + N ST+E Y F Y ++LSK  G K+    +L  + D    ++KT Y + VKTS+V   GT + V +  +GE GD+G L L+     NK F+  Q D F F D+LSLG+LS+ +VWH+N   +  WHL+ I++K+    ++++FPC++WL+  +DD QI REL C N  N      ++T YE+ V T   ++A    + W V  G K  S +F+MEN   K+K F R S D  + +   +GE+  I LG +      KNE +     W   EV V        + F   S I +  K  +     F+ +  VE    +   +++    VKYE++++TG     GT+ANVFITL+G N +SGKR L QK RNLFE+G+ D+F+LE +DLG++ ++++EHD++     WFL+ V+V N +      + C +WL K++     +++L P
Sbjct:  950 YSFPCDRWLASDEEDGELVVELLPEDTE-----ELEENTYEVNVFTGNMMGAGTDANVFINIYGENGDTGERRLRKS--NHMNKFERGQEDAFSITAVELGTLKKLRIRHDNS-GQSAWYLDRVEIVDTKDDTTYYFPCNRWLAVDEDDGQIARELVPVDEAFMRKDEDEEDSGATLGLEQKAMSTTYTLRIKTGEKKHAGTDANVFAILFGENDDTGIINLKASKSHKNKFEKGMIDVFTVEAVDLGELLKLRIG-----GSSGWFLDWVEIDAPSQGQRLRFPCGRWLDRGEDDGAIIRDLYPAELQTELYTPFVPYEISTFTSDVFAAGTDANVFITLYGQNGVCTQQKYLCVNKRERRLYFERAADDMFIVELEDVGDILEKIRIGHENQGTNPGWHLDRVEIRRLLRKGKGSETTIFPCERWLAKSEDDGETVRELVPSDIITEKLLRDGTLKH-----NEIE-VEDALETHTYKVSVRTGDMHGAGTDANVFLTIYGELGDTGERKLSKSESSKNKFEKGAVDKFSIEAVDLGPVFKIRIRHDNS-LAGADWYLDQVEVVNVDTDEVFMFLCERWLSKKKEDMRIDRTFYVKGYEGERN--PLNAKKTLQNSKA-GLDSNMNKKKKKKKAVIMEEG-----PMIPYHFTVSTGDDRDGSTTSRVYVIIMGPNDLETERLWLDLPEGKKCFAAGGMEHFMCFGLDVGEIKRVELGHNGATPESCWLVDELSVGVPTKGIQYNFLCKCWLAKDRGDGLTARVFNILDATTISIIRKVVYEVTVVTGDTQSAGTDTNIFITVFGANGSTEEILLEKQEDRFERGQEDTFSLEVDDIAPLKKLRVRIDGTGSRPDWFLDKMILRNLSTDELYVFTYEQWLSKTKGPKRTKVCELPAVVDDEEMVEKTTYVIQVKTSDVTGGGTDANVFLIVFGENGDTGTLALRECSNRNK-FERKQTDIFRFNDILSLGELSKVRVWHDNK--APGWHLDSIDVKDELLDQTFRFPCDRWLAKNEDDGQIMRELACAN--NDILDLSDKTKYEIEVTTAISEDAETKENAWIVLEGRKGRSKEFMMEN--PKKKKFLRGSTDSFEFSSKNVGEIVGICLGHISKEKKVKNEYF-----WHVQEVVVTETELGNKFYFTCDSRIPLAAKKDQF--MTFECTKTVE----SFASKVRSLVPVKYEVIIITGDVQDAGTNANVFITLYGVNGDSGKRALKQKFRNLFERGRTDRFLLEMLDLGELLRVRMEHDNTTMSPGWFLECVEVTNTANWVTTIFVCGKWLDKNRADGQTYRVLYP 2213          

HSP 2 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 592/2060 (28.74%), Postives = 986/2060 (47.86%), Query Frame = 1
Query: 1690 ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIF-CPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD-SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKG--DTGDRFLTHSTTNTNKFEKGQMDEFLIE-AVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVRELTGTTLL-----GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLD---PSKIDKIDKTIP---YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYV--LVNDESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-DKVIRRGSMNALGESIDQVDSVANI-LQKKA----YTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTN--IIRLQKLETN-YFAPGSKEVISVEAPDVENI-KQVEICNEGVDRESSWYLNSISI-EMPTKGKLYNVT---CGVWLSKFMGERKTSRIFS----IQDKMMTNVSKK------------ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNE---DNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLA-----------PINDIKKT------------------------------DYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLE-----LKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQ-KGRNLFEQGQEDKFIL-ECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKIL 7551
            E ++K  YE+   TG+   A T +  +V L G      I  K+  ++K       F++  TDV  V+    + PL +I    +  G N  WFLD +V+    +  +   F C NWLS             + L  R      D  +N ++VS++T+D+K + T++ V L ++G+ G T +  +  D +  + G+  +F  E   +G   K+   H+N G+++ W ++K+++    N   Y+F   RW +   +D    R++   G    +P  I  Y VQ+ TGN   AGT++ + + ++G KG  ++G  FL        +FE+G  D F +E A  L  +S++ +GHD+     GW+ DKV+++    P   +  TF C+ W D  EGDG+  REL     L      K  + + + T  + GAGTD+++ ++I+G+ G +  ++L     N   FE G  D F +E  D+G++  +RI H+     + W + +I ++      K+ F   +WLD+   + ++    P+  + I + +P   Y++TV+TGDV  +GTD+ VF+ + G    T    L   K+  + FERGN D F I A  +G ++++RIGHDG+  G GW+LDKV                                                    I E+ +A      F C+RW   +EDD  IVREL P  + G  L N   + Y + VKTGN  G  +D+ VF+ ++G+ GD+ +  L  + +N  N FE   +D F +  +D+G + ++ I H N    A W+LD V  +V +    Y+FP   WL  ++  G    +I+P+    +                  + L N+ + V T      GT+ANV I +YG+   + ++ L    + SN +E G  + F+V+  D+G++ KIR+ +D++G  A W L +VEI+   +  ++ FPC+ W++  + DG L  EL P+ +  + +     YE+   T N  GAGT+ANV+I +YG N  T +  L  ++  +K + G  D F ++  ++   ++K+RI HDN G  SAW+L++V +     +      Y FPCNRWLA DE+DG I REL+P D+   R       +  D+ DS A + L++KA    YT+R+ TG     GT+ANVF  ++GEN D+G   L  SK+H +KFEK  +D F  EAVDLG++ K+ I   +SG     WFL  +EI      +   F C RWL + +DD  I R LY A  Q E           +Y                              T ++ Y I+  T      G+    ++ LYG   + T    + + K E   YF   + ++  VE  DV +I +++ I +E       W+L+ + I  +  KGK    T   C  WL+K   + +T R       I +K++ + + K             TY +SV TGD+   GT++ +FL ++G  G++    L K+E   + FE+G  D F +E  D+G + KIRI++D +     W+L+++++ N  T+E + F    +LSK   +K+ + ID             P+N  KKT                               Y   V T + +   T+S V V   G      DLE     L  PE   K F    ++ F+    L +G++ R ++ HN +   S W ++ + +        + F C  WL+    D    R     +A   T +   +  YEVTV+TGD ++AG   +++   +G    +++ ++E   D+   F R  ED   +    +  LK +++     + +       WF +++ ++NL+T + YVF  + W+   +  +    ++ ++  +V+D      EE+ +K    Y I V T    G GTDANVF+ +FGEN ++G   L +   RN FE+ Q D F   + + LG++ K+++ HD+      W LD + V++   ++ +++PC+ WL+K++   +I+
Sbjct:   92 EYHKKKVYEVVTITGDVNGAGTDANVFVTLFGDY---GITPKLHLSSK---NRTSFEKNKTDVFRVK-THNVGPLKKIRIEHDNTGLNASWFLDRVVVTDMNRPHLRFYFACNNWLSRDEG---------DGLYVR------DLLDNKYVVSVFTADVKGSGTDADVFLNIFGEFGDTGERRLDNDKNNFERGTEDKFTMEAPNLGKIRKITIGHNNRGSSAGWFVDKVIVDDLGNKAVYEFPIGRWFALDEDDGKIQRDVLVGGS---QPTGIV-YNVQVVTGNVRGAGTNSKIQMVMHGSKGMKNSGKIFL-----EGGQFERGLTDIFNVEIAALLSPLSRVTIGHDNGGVSPGWYCDKVVVF---CPFTGIEQTFPCSKWLDEDEGDGIIERELYEMVSLRQKRQKKHPWSLWIWTTDLAGAGTDASILLQIYGEKGKSDEMKLDNKTDN---FEQGQLDKFMVELPDLGKLTKLRIWHEKRNPFAGWHLSRISIMKTLTKEKFKFPCERWLDTNEDDNEVVRELPATGELIAEPLPVVKYRVTVYTGDVSGSGTDAHVFLCLIGDLGDTGDRSLINCKNNINKFERGNADEFIIEAVSIGPVRRVRIGHDGRGGGCGWYLDKV---------------------------------------------------TIREEGQAESQAVEFPCSRWFDRNEDDGQIVRELQPFAD-GQRLYN---VSYHIAVKTGNVTGGSSDSKVFVKLYGEKGDTSKMMLAVSDNNLRNYFEVGRVDIFTLDTLDIGQINRLLIGHSNEGMRAGWFLDSVQIVVPNHGKHYMFPSHRWLCEDEADGKTEVEIYPSETLDF------------------ELLINYEITVVTGDIFAGGTNANVFIQIYGDQGKTEVLGLS---SRSNNYERGTTEIFKVEAKDVGKIFKIRVSNDDTGIGAGWFLDRVEIK-RLVVLTYSFPCDRWLASDEEDGELVVELLPEDTEELEENT---YEVNVFTGNMMGAGTDANVFINIYGENGDTGERRLRKSNHMNKFERGQEDAFSITAVEL-GTLKKLRIRHDNSG-QSAWYLDRVEI----VDTKDDTTYYFPCNRWLAVDEDDGQIARELVPVDEAFMR-------KDEDEEDSGATLGLEQKAMSTTYTLRIKTGEKKHAGTDANVFAILFGENDDTGIINLKASKSHKNKFEKGMIDVFTVEAVDLGELLKLRI-GGSSG-----WFLDWVEIDAPSQGQRLRFPCGRWLDRGEDDGAIIRDLYPAELQTE-----------LY------------------------------TPFVPYEISTFTSDVFAAGTDANVFITLYGQNGVCTQQKYLCVNKRERRLYFERAADDMFIVELEDVGDILEKIRIGHENQGTNPGWHLDRVEIRRLLRKGKGSETTIFPCERWLAKSEDDGETVRELVPSDIITEKLLRDGTLKHNEIEVEDALETHTYKVSVRTGDMHGAGTDANVFLTIYGELGDTGERKLSKSESSKNKFEKGAVDKFSIEAVDLGPVFKIRIRHDNSLAGADWYLDQVEVVNVDTDEVFMFLCERWLSK---KKEDMRIDRTFYVKGYEGERNPLN-AKKTLQNSKAGLDSNMNKKKKKKKAVIMEEGPMIPYHFTVSTGDDRDGSTTSRVYVIIMG----PNDLETERLWLDLPE-GKKCFAAGGMEHFMCFG-LDVGEIKRVELGHNGATPESCWLVDELSVGVPTKGIQYNFLCKCWLAKDRGDGLTARVFNILDA--TTISIIRKVVYEVTVVTGDTQSAGTDTNIFITVFGANGSTEEILLEKQEDR---FERGQEDTFSLEVDDIAPLKKLRV-----RIDGTGSRPDWFLDKMILRNLSTDELYVFTYEQWLSKTKGPKRT--KVCELPAVVDD------EEMVEK--TTYVIQVKTSDVTGGGTDANVFLIVFGENGDTGTLALRECSNRNKFERKQTDIFRFNDILSLGELSKVRVWHDNK--APGWHLDSIDVKDELLDQTFRFPCDRWLAKNEDDGQIM 1942          

HSP 3 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 335/869 (38.55%), Postives = 522/869 (60.07%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQW--LSDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKLDS---GSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEE-QNPSNSVTFRCNCWFDSSEGDGLTVREL---TGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            YE+V ITGD++ +GTD+ VF++L G  GI+P++ L  +N   F++ +T  F +    VGP+ KIRI  D +G  +SW+LDRV +TD+  P  R++F C NWLS+D GD   VR++   K          Y +S +T +  G+G+ AD+++ IFGE G++    + N K+ F+ G+  + T+    LG ++KI +G+ N G    WF++KVI++DL    V+EFP G+W  L +  G+    +L     P       Y +++ TGN   A T S+  +++ G +        ++++ KI++E  +F+ G TD+  VE+   LSPL+ +  G + GG +  W+ D +V+FCP TGIEQ+F C  WL         E  L E +S R+ +      ++ W + I+T+D+  A T++ ++L +YG+ GK+D++ +  D+K D+   G + +F  EL  +G   KLR  H+     + W+L +I + + +  ++++F C RWL  + +D   VRE+PATG  I +P P+ KY+V +YTG+   +GTDA+VF+ + G+ GDTGDR L +   N NKFE+G  DEF+IEAV +G + ++++GHD +  G GW++DKV I EE Q  S +V F C+ WFD +E DG  VREL        L  V+Y + VKTG V G  +DS VF++++G+ GDT  + L  S  N +N FE G  D+F ++  DIG+I  + I H + G  + WF+D + ++VP  G  Y+F  ++WL     D KT E ++ PS+    +  I Y+ITV TGD+   GT++ VFIQIYG   KT+ L L S+S+ +ERG  ++FK+ A DVG I KIR+ +D    G+GWFLD+V
Sbjct:   99 YEVVTITGDVNGAGTDANVFVTLFGDYGITPKLHLSSKNRTSFEKNKTDVFRVKTHNVGPLKKIRIEHDNTGLNASWFLDRVVVTDMNRPHLRFYFACNNWLSRDEGDGLYVRDLLDNK----------YVVSVFTADVKGSGTDADVFLNIFGEFGDTGERRLDNDKNNFERGTEDKFTMEAPNLGKIRKITIGHNNRGSSAGWFVDKVIVDDLGNKAVYEFPIGRWFALDEDDGKIQRDVLVGGSQP---TGIVYNVQVVTGNVRGAGTNSKIQMVMHGSK-------GMKNSGKIFLEGGQFERGLTDIFNVEIAALLSPLSRVTIGHDNGGVSPGWYCDKVVVFCPFTGIEQTFPCSKWLDEDEGDGIIERELYEMVSLRQKRQ----KKHPWSLWIWTTDLAGAGTDASILLQIYGEKGKSDEMKL--DNKTDNFEQGQLDKFMVELPDLGKLTKLRIWHEKRNPFAGWHLSRISIMKTLTKEKFKFPCERWLDTNEDDNEVVRELPATGELIAEPLPVVKYRVTVYTGDVSGSGTDAHVFLCLIGDLGDTGDRSLINCKNNINKFERGNADEFIIEAVSIGPVRRVRIGHDGRGGGCGWYLDKVTIREEGQAESQAVEFPCSRWFDRNEDDGQIVRELQPFADGQRLYNVSYHIAVKTGNVTGGSSDSKVFVKLYGEKGDTSKMMLAVSDNNLRNYFEVGRVDIFTLDTLDIGQINRLLIGHSNEGMRAGWFLDSVQIVVPNHGKHYMFPSHRWLCEDEADGKT-EVEIYPSETLDFELLINYEITVVTGDIFAGGTNANVFIQIYGDQGKTEVLGLSSRSNNYERGTTEIFKVEAKDVGKIFKIRVSNDDTGIGAGWFLDRV 940          

HSP 4 Score: 592.808 bits (1527), Expect = 1.586e-173
Identity = 438/1476 (29.67%), Postives = 712/1476 (48.24%), Query Frame = 1
Query: 3229 DPSKI----DKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDT-FERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGE--TNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCD-LGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYL--FHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLET--NYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAP--INDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNE--------------TSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLV----QKGRNLFEQGQEDKFILECVDLGKI-EKIKIEHDDSRFRSDWFLDRVQVQNL----STNKIWKYPCNEWLSKSK 7533
            +P K+    D+  K   Y++   TGDV  AGTD+ VF+ ++G    T +L L SK+ T FE+   DVF++   +VG ++KIRI HD     + WFLD+V+                                                   +++    ++  Y+   N WL+ DE D + VR+LL               KY+V V T +  GSGTDA+VFL IFG+ GD+GER L    DN  N FE  + DKF ++A +LG + KI I H+N    A W++D V+V+D  ++  Y FP   W A ++D G + +D+                 +    +Y        NV+V T     AGT++ + ++++G     +SG I L+       +FE G  D F V+    L  L ++ IGHDN G +  W+  KV +     G    FPC++W+ + + DG +ERELY  +SL   ++ K  + +   T++  GAGT+A++ +Q+YG    +++  L+N +D    + G  D F V + D+   + K+RI H+ +   + WHL ++ + + L  +     ++FPC RWL  +E+D  + REL            A GE I      A  L    Y + VYTG    +GT+A+VFL + G+ GD+G+R L++ K + +KFE+ N DEF  EAV +G V ++ I HD        W+L K+ I ++   E+    F C RW  +++DD +I R L            P    + +Y+                                ++Y I + TG      S    +++LYG K   + ++         NYF  G  ++ +++  D+  I ++ I +      + W+L+S+ I +P  GK Y      WL +   + KT     I      +    I Y I+V+TGD+  GGTN+ +F+Q++G QG + +  L    +N+ERG  + FK+E +DVGKI KIR+ ND  G    WFL++++I       +Y F  + +L+ +  +  +L ++L P    ++++  Y+V V T N+  AGT + V +  YGE GD+G+  L+     NK F+  Q D F     + LG L + ++ H+NSG  S W+L+ +E+ + K   ++ FPCN+WL++ +DD QI REL+  +     K    E              T+Y + + TG+KK+AG   +V+ + +GE + +    ++ +   +  F +   D   V  V LGEL  +++G           S  WF + V +   +  +   F    W++  E          D   I+ D   A ++       V YEI   T      GTDANVFITL+G+N    ++  +    ++ R  FE+  +D FI+E  D+G I EKI+I H++      W LDRV+++ L      ++   +PC  WL+KS+
Sbjct:   82 EPEKVENYEDEYHKKKVYEVVTITGDVNGAGTDANVFVTLFGDYGITPKLHLSSKNRTSFEKNKTDVFRVKTHNVGPLKKIRIEHDNTGLNASWFLDRVV---------------------------------------------------VTDMNRPHLRFYFACNN-WLSRDEGDGLYVRDLLDN-------------KYVVSVFTADVKGSGTDADVFLNIFGEFGDTGERRL----DNDKNNFERGTEDKFTMEAPNLGKIRKITIGHNNRGSSAGWFVDKVIVDDLGNKAVYEFPIGRWFALDEDDGKIQRDVLVGGS------------QPTGIVY--------NVQVVTGNVRGAGTNSKIQMVMHGSKGMKNSGKIFLE-----GGQFERGLTDIFNVEIAALLSPLSRVTIGHDNGGVSPGWYCDKVVVFCPFTGIEQTFPCSKWLDEDEGDGIIERELYEMVSLRQKRQKKHPWSLWIWTTDLAGAGTDASILLQIYGEKGKSDEMKLDNKTD--NFEQGQLDKFMVELPDL-GKLTKLRIWHEKRNPFAGWHLSRISIMKTLTKEK----FKFPCERWLDTNEDDNEVVREL-----------PATGELI------AEPLPVVKYRVTVYTGDVSGSGTDAHVFLCLIGDLGDTGDRSLINCKNNINKFERGNADEFIIEAVSIGPVRRVRIGHDGR-GGGCGWYLDKVTIREEGQAESQAVEFPCSRWFDRNEDDGQIVREL-----------QPFADGQRLYN--------------------------------VSYHIAVKTGNVTGGSSDSKVFVKLYGEKGDTSKMMLAVSDNNLRNYFEVGRVDIFTLDTLDIGQINRLLIGHSNEGMRAGWFLDSVQIVVPNHGKHYMFPSHRWLCEDEADGKTE--VEIYPSETLDFELLINYEITVVTGDIFAGGTNANVFIQIYGDQGKTEVLGLSSRSNNYERGTTEIFKVEAKDVGKIFKIRVSNDDTGIGAGWFLDRVEI-KRLVVLTYSFPCDRWLASD-EEDGELVVELLPEDTEELEENTYEVNVFTGNMMGAGTDANVFINIYGENGDTGERRLRKSNHMNK-FERGQEDAFSIT-AVELGTLKKLRIRHDNSG-QSAWYLDRVEIVDTKDDTTYYFPCNRWLAVDEDDGQIARELVPVDEAFMRKDEDEEDSGATLGLEQKAMSTTYTLRIKTGEKKHAGTDANVFAILFGENDDTGIINLKASKSHKNKFEKGMIDVFTVEAVDLGELLKLRIGG----------SSGWFLDWVEIDAPSQGQRLRFPCGRWLDRGE----------DDGAIIRDLYPAELQTELYTPFVPYEISTFTSDVFAAGTDANVFITLYGQNGVCTQQKYLCVNKRERRLYFERAADDMFIVELEDVGDILEKIRIGHENQGTNPGWHLDRVEIRRLLRKGKGSETTIFPCERWLAKSE 1368          

HSP 5 Score: 495.352 bits (1274), Expect = 1.442e-141
Identity = 412/1466 (28.10%), Postives = 656/1466 (44.75%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI----WLFTCNHWLSLYKEDGKVSRELFAFKSVRTK---YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKEN-TQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKE--------------IMGI---ASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPE---IKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVI---FCPQTGIEQS-FICGNWLSPSRPGCQTEVSLV-EDLSKRKLKT----------VIDFTE-NTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIP----ADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATG---------------------------------PGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVR-----ELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLD-------SKTLEYDLDPSKIDK---IDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKIN-AADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAA----WYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQ 4611
            I Y++ V T D+   GT+  ++I I GD+     + L     + ++        G+T+IF +   D+G +  I + +D       W L  VEI     KR+    + F C+ WL+  +EDG++  EL    +   +   YE+ V TG++  +GTD+ VFI++ G  G + + +L K N    F+RGQ   F I A  +G + K+RIR D SG +S+WYLDRV I D K+ +  Y+F C  WL+ D  D    RE+    E               +G+   A  T Y +   T  K  AG+ A+++  +FGEN ++ +I++K    +K+ F++G I   T+    LG L K+++G  +      WFL+ V I+   Q +   FPCG+WL   + +G  +  + P +   E Y  +  YE+   T +   A T +  ++ L G      + K L   +   +++ E A       D+  VEL +    L +I  G    G N  W LD + I        G E + F C  WL+ S    +T   LV  D+   KL            V D  E +T+ VS+ T D+  A T++ V L +YG+ G T +  +     + +K + G+V +F  E   +G  +K+R +HDNS   + W L+++ +      + + FLC RWLS   ED    R     G                                   I++  P+  Y   + TG+     T + V++ I G      +R           F  G M+ F+   + +G I +++LGH+     S W VD++ +     P+  +   F C CW     GDGLT R     + T  +++ KV YEV V TG  Q AGTD+N+FI +FG  G T  + L+     +++FE G  D F +E +DI  +K +R+  D TG+   WF+D++ +        Y+F   +WL        +K  E    P+ +D    ++KT  Y I V T DV   GTD+ VF+ ++G++  T  L L+  S  + FER   D+F+ N    +G + K+R+ HD K P  GW                                                      L  I  ++E     + F C+RWLA +EDD  I+REL   +     LS+  + KY ++V T     + T  N ++ + G+ G S E  ++N       KF   S D F   + ++G +  I + H +          W++  V+V +    +++ F C S +               A    +  ++  K  +S     +      + V + T     AGT+ANV I LYG   DSG   LKQ     N FE G  D F ++  DLGEL ++R+ HDN+  +  W L  VE+       + +F C +W+ K++ DG   R LYP+
Sbjct:  858 INYEITVVTGDIFAGGTNANVFIQIYGDQGKTEVLGLSSRSNNYER--------GTTEIFKVEAKDVGKIFKIRVSNDDTGIGAGWFLDRVEI-----KRLVVLTYSFPCDRWLASDEEDGELVVELLPEDTEELEENTYEVNVFTGNMMGAGTDANVFINIYGENGDTGERRLRKSNHMNKFERGQEDAFSITAVELGTLKKLRIRHDNSG-QSAWYLDRVEIVDTKD-DTTYYFPCNRWLAVDEDDGQIARELVPVDEAFMRKDEDEEDSGATLGLEQKAMSTTYTLRIKTGEKKHAGTDANVFAILFGENDDTGIINLKASKSHKNKFEKGMIDVFTVEAVDLGELLKLRIGGSSG-----WFLDWVEIDAPSQGQRLRFPCGRWLDRGEDDGAIIRDLYPAELQTELYTPFVPYEISTFTSDVFAAGTDANVFITLYGQNGVCTQQKYLCVNKRERRLYFERAA-----DDMFIVELEDVGDILEKIRIGHENQGTNPGWHLDRVEIRRLLRKGKGSETTIFPCERWLAKSEDDGETVRELVPSDIITEKLLRDGTLKHNEIEVEDALETHTYKVSVRTGDMHGAGTDANVFLTIYGELGDTGERKLSKSESSKNKFEKGAVDKFSIEAVDLGPVFKIRIRHDNSLAGADWYLDQVEVVNVDTDEVFMFLCERWLSKKKEDMRIDRTFYVKGYEGERNPLNAKKTLQNSKAGLDSNMNKKKKKKKAVIMEEGPMIPYHFTVSTGDDRDGSTTSRVYVIIMGPNDLETERLWLDLPEGKKCFAAGGMEHFMCFGLDVGEIKRVELGHNGATPESCWLVDELSV---GVPTKGIQYNFLCKCWLAKDRGDGLTARVFNILDATTISIIRKVVYEVTVVTGDTQSAGTDTNIFITVFGANGSTEEILLEKQ---EDRFERGQEDTFSLEVDDIAPLKKLRVRIDGTGSRPDWFLDKMILRNLSTDELYVFTYEQWLSKTKGPKRTKVCEL---PAVVDDEEMVEKT-TYVIQVKTSDVTGGGTDANVFLIVFGENGDTGTLALRECSNRNKFERKQTDIFRFNDILSLGELSKVRVWHDNKAP--GW-----------------------------------------------------HLDSIDVKDELLDQTFRFPCDRWLAKNEDDGQIMRELACANNDILDLSD--KTKYEIEVTTAISEDAETKENAWIVLEGRKGRSKEFMMENP---KKKKFLRGSTDSFEFSSKNVGEIVGICLGHISKEKKVKNEYFWHVQEVVVTETELGNKFYFTCDSRIP------------LAAKKDQFMTFECTKTVESFASKVRSLVPVKYEVIIITGDVQDAGTNANVFITLYGVNGDSGKRALKQKF--RNLFERGRTDRFLLEMLDLGELLRVRMEHDNTTMSPGWFLECVEVTNTANWVTTIFVCGKWLDKNRADGQTYRVLYPK 2214          

HSP 6 Score: 418.698 bits (1075), Expect = 1.922e-117
Identity = 317/1058 (29.96%), Postives = 504/1058 (47.64%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSV------RTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLF--KENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYF-FQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESD-----VIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEK--ILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS---KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI----------------PATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLLGK-----VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNK----FEFGATDLFKIEAEDIGEI-KSIRISHDDTGAGSAWFVDQI----CVIVPKLGLKYIFFLNKWL-----DSKTLEYDLDPSKI-------------DKID-----KTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            + + + T D+ GAGT   I + I G+K     ++L     +           G    F +   DLG L  + I H+   P   W L  + IM    K  + F C  WL   ++D +V REL A   +        KY + V TGD+  SGTD+ VF+ L G  G +    L   K N   F+RG   +F+I A  +GP+ ++RI  D  G    WYLD+V I +    E +   F C  W  ++  D   VRE++   +   + +   Y I+  T N  G  S + ++++++GE G++      V D   ++ F+ G +   TL    +G + ++ +G+ N G +  WFL+ V I   +  + + FP  +WL + + +G  +  I P + L        YE+ + TG+     T +  ++ + G + K ++L     +N        ++ G T++  VE  + +  + +I    +  G    WFLD + I      +  SF C  WL+      +  V L+ + ++       +  ENT+ V+++T ++  A T++ V + +YG+NG T +  +   +   K + G    F      +G   KLR +HDNSG  S+W L+++ +    +   Y F CNRWL+   +D    RE+                     G+ + A    Y ++I TG K  AGTDANVF  ++GE  DTG   L  S ++ NKFEKG +D F +EAV LG + K+++G       SGWF+D V I +  +    + F C  W D  E DG  +R+L    L  +     V YE+   T  V  AGTD+NVFI ++GQ G     Q K    NK +    FE  A D+F +E ED+G+I + IRI H++ G    W +D++     +   K     IF   +WL     D +T+  +L PS I             ++I+     +T  Y+++V TGD+  AGTD+ VF+ IYG+   T +  L   +S  + FE+G  D F I A D+G + KIRI HD    G+ W+LD+V
Sbjct:  471 WSLWIWTTDLAGAGTDASILLQIYGEKGKSDEMKLDNKTDN--------FEQGQLDKFMVELPDLGKLTKLRIWHEKRNPFAGWHLSRISIMKTLTKEKFKFPCERWLDTNEDDNEVVRELPATGELIAEPLPVVKYRVTVYTGDVSGSGTDAHVFLCLIGDLGDTGDRSLINCKNNINKFERGNADEFIIEAVSIGPVRRVRIGHDGRGGGCGWYLDKVTIREEGQAESQAVEFPCSRWFDRNEDDGQIVRELQPFADGQRLYN-VSYHIAVKTGNVTGGSSDSKVFVKLYGEKGDTSKMMLAVSDNNLRNYFEVGRVDIFTLDTLDIGQINRLLIGHSNEGMRAGWFLDSVQIVVPNHGKHYMFPSHRWLCEDEADGKTEVEIYPSETLDFELL-INYEITVVTGDIFAGGTNANVFIQIYGDQGKTEVLGLSSRSNN-------YERGTTEIFKVEAKD-VGKIFKIRVSNDDTGIGAGWFLDRVEI-KRLVVLTYSFPCDRWLASDEEDGELVVELLPEDTE-------ELEENTYEVNVFTGNMMGAGTDANVFINIYGENGDTGERRLRKSNHMNKFERGQEDAFSITAVELGTLKKLRIRHDNSG-QSAWYLDRVEIVDTKDDTTYYFPCNRWLAVDEDDGQIARELVPVDEAFMRKDEDEEDSGATLGLEQKAMSTTYTLRIKTGEKKHAGTDANVFAILFGENDDTGIINLKASKSHKNKFEKGMIDVFTVEAVDLGELLKLRIG-----GSSGWFLDWVEI-DAPSQGQRLRFPCGRWLDRGEDDGAIIRDLYPAELQTELYTPFVPYEISTFTSDVFAAGTDANVFITLYGQNGVC--TQQKYLCVNKRERRLYFERAADDMFIVELEDVGDILEKIRIGHENQGTNPGWHLDRVEIRRLLRKGKGSETTIFPCERWLAKSEDDGETVR-ELVPSDIITEKLLRDGTLKHNEIEVEDALETHTYKVSVRTGDMHGAGTDANVFLTIYGELGDTGERKLSKSESSKNKFEKGAVDKFSIEAVDLGPVFKIRIRHDNSLAGADWYLDQV 1492          

HSP 7 Score: 414.846 bits (1065), Expect = 3.318e-116
Identity = 314/1023 (30.69%), Postives = 502/1023 (49.07%), Query Frame = 1
Query:  547 HDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEI--MNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFEHTLP-------LRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL---EKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQT--EVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI----PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLLG---KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK----TLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKS--DTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            H + +Y+V   T DV GAGT   +++++ GD    P++ L                   T +F ++  ++G L+ I IEHD      SW L  V +  MN  + R + F CN+WLS  + DG   R+L     +  KY + V T D+  SGTD+ VF+++ G  G + + +L  +    F+RG   KF + A  +G I KI I  +  GS + W++D+V + DL N    Y F    W + D  D    R++  G  +  GI     Y +   T N  GAG+++ I + + G  G  +   I     F EG  FE  L           L  L ++ +G+ N G  P W+ +KV++      ++Q+    FPC +WL + +G+G+   E    V    +R +K+ + + I T + A A T +   + + G + K    D+++  NK       F++G  D   VEL + L  LT++            W L  I I    T  +  F C  WL  +    +   E+    +L    L  V       + V++YT D+  + T++ V L L GD G T D  +       +K + G+  EF  E   +G   ++R  HD  G    W L+K+ + +         +F C+RW   + +D   VRE+     G  +      Y + + TGN     +D+ VF+ +YGEKGDT    L  S  N  N FE G++D F ++ + +G I+++ +GH ++   +GWF+D V I    N      F  + W    E DG T  E+  +  L     + YE+ V TG +   GT++NVFI+I+G  G T  + L    +  N +E G T++FK+EA+D+G+I  IR+S+DDTG G+ WF+D++  I   + L Y F  ++WL S      L  +L P   +++++   Y++ VFTG++M AGTD+ VFI IYG++  T +  L+  +  + FERG ED F I A ++G ++K+RI HD     S W+LD+V
Sbjct:   94 HKKKVYEVVTITGDVNGAGTDANVFVTLFGDYGITPKLHL-------SSKNRTSFEKNKTDVFRVKTHNVGPLKKIRIEHDNTGLNASWFLDRVVVTDMNRPHLRFY-FACNNWLSRDEGDGLYVRDL-----LDNKYVVSVFTADVKGSGTDADVFLNIFGEFGDTGERRLDNDKNN-FERGTEDKFTMEAPNLGKIRKITIGHNNRGSSAGWFVDKVIVDDLGNKA-VYEFPIGRWFALDEDDGKIQRDVLVGGSQPTGIV----YNVQVVTGNVRGAGTNSKIQMVMHGSKGMKNSGKI-----FLEGGQFERGLTDIFNVEIAALLSPLSRVTIGHDNGGVSPGWYCDKVVVFCPFTGIEQT----FPCSKWLDEDEGDGIIERELYEMVSLRQKRQKKHPWSLWIWTTDLAGAGTDASILLQIYGEKGKS---DEMKLDNK----TDNFEQGQLDKFMVELPD-LGKLTKLRIWHEKRNPFAGWHLSRISIMKTLTKEKFKFPCERWLDTNEDDNEVVRELPATGELIAEPLPVV------KYRVTVYTGDVSGSGTDAHVFLCLIGDLGDTGDRSLINCKNNINKFERGNADEFIIEAVSIGPVRRVRIGHDGRGGGCGWYLDKVTIREEGQAESQAVEFPCSRWFDRNEDDGQIVRELQPFADG--QRLYNVSYHIAVKTGNVTGGSSDSKVFVKLYGEKGDTSKMMLAVSDNNLRNYFEVGRVDIFTLDTLDIGQINRLLIGHSNEGMRAGWFLDSVQI-VVPNHGKHYMFPSHRWLCEDEADGKTEVEIYPSETLDFELLINYEITVVTGDIFAGGTNANVFIQIYGDQGKTEVLGLS---SRSNNYERGTTEIFKVEAKDVGKIFKIRVSNDDTGIGAGWFLDRV-EIKRLVVLTYSFPCDRWLASDEEDGELVVELLPEDTEELEEN-TYEVNVFTGNMMGAGTDANVFINIYGENGDTGERRLRKSNHMNKFERGQEDAFSITAVELGTLKKLRIRHDNSGQ-SAWYLDRV 1065          

HSP 8 Score: 409.838 bits (1052), Expect = 1.107e-114
Identity = 309/1034 (29.88%), Postives = 515/1034 (49.81%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK--YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIP-ATCVGPISKIRIRQDESGSKSSWYLDRVCI----TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYK----ISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPV--KKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQS--FICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIP-ADSKL----DSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELT--GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSK------------------IDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            Y V+V TADVKG+GT   ++++I G+  +    RL   K +           G+   F +   +LG +  I I H+       W +  V + ++ NK ++ F    W +L ++DGK+ R++    S  T   Y + V+TG++  +GT+SK+ + + G  G+    ++F E  Q F+RG T  F +  A  + P+S++ I  D  G    WY D+V +    T ++       F C  WL +D GD    RE+    E++ +  + + K    +  +T +  GAG+ A I +QI+GE G+SD + + NK D F++G + +  + L  LG L K+++ ++   P   W L+++ I        F+FPC +WL   + +  + + LP   + + E     KY + + TG+ + + T +  ++ L G   +  D+ L  I   N I     KF+ G  D   +E    + P+  +  G +  G    W+LD + I        Q+  F C  W   +    Q    L      ++L  V      ++ +++ T ++   S++SKV + LYG+ G T  +++  +D+ L    + G V  F  +   +G   +L   H N G  + W L+ + +    +G  Y F  +RWL +   D  T  EI  +    +    +  Y++ + TG+    GT+ANVFI IYG++G T    +   ++ +N +E+G  + F +EA  +G I KI++ +D    G+GWF+D+V I  ++    + +F C+ W  S E DG  V EL    T  L + TYEV V TG + GAGTD+NVFI I+G+ GDTG  +L+ S  + NKFE G  D F I A ++G +K +RI HD++G  SAW++D++ ++  K    Y F  N+WL    D   +  +L P                    +++   +  Y + + TG+  HAGTD+ VF  ++G++  T  + L   KS  + FE+G  DVF + A D+G + K+RIG       SGWFLD V
Sbjct:  218 YVVSVFTADVKGSGTDADVFLNIFGEFGDTGERRLDNDKNN--------FERGTEDKFTMEAPNLGKIRKITIGHNNRGSSAGWFVDKVIVDDLGNKAVYEFPIGRWFALDEDDGKIQRDVLVGGSQPTGIVYNVQVVTGNVRGAGTNSKIQMVMHGSKGMKNSGKIFLEGGQ-FERGLTDIFNVEIAALLSPLSRVTIGHDNGGVSPGWYCDKVVVFCPFTGIEQT-----FPCSKWLDEDEGDGIIERELY---EMVSLRQKRQKKHPWSLWIWTTDLAGAGTDASILLQIYGEKGKSDEMKLDNKTDNFEQGQLDKFMVELPDLGKLTKLRIWHEKRNPFAGWHLSRISIMKTLTKEKFKFPCERWLDTNEDDNEVVRELPATGELIAEPLPVVKYRVTVYTGDVSGSGTDAHVFLCLIGDLGDTGDRSL--INCKNNI----NKFERGNADEFIIEA-VSIGPVRRVRIGHDGRGGGCGWYLDKVTIREEGQAESQAVEFPCSRWFDRNEDDGQIVRELQPFADGQRLYNV------SYHIAVKTGNVTGGSSDSKVFVKLYGEKGDTSKMMLAVSDNNLRNYFEVGRVDIFTLDTLDIGQINRLLIGHSNEGMRAGWFLDSVQIVVPNHGKHYMFPSHRWLCEDEADGKTEVEIYPSET--LDFELLINYEITVVTGDIFAGGTNANVFIQIYGDQGKTE---VLGLSSRSNNYERGTTEIFKVEAKDVGKIFKIRVSNDDTGIGAGWFLDRVEI--KRLVVLTYSFPCDRWLASDEEDGELVVELLPEDTEELEENTYEVNVFTGNMMGAGTDANVFINIYGENGDTGERRLRKS-NHMNKFERGQEDAFSITAVELGTLKKLRIRHDNSGQ-SAWYLDRVEIVDTKDDTTYYFPCNRWLAVDEDDGQIARELVPVDEAFMRKDEDEEDSGATLGLEQKAMSTTYTLRIKTGEKKHAGTDANVFAILFGENDDTGIINLKASKSHKNKFEKGMIDVFTVEAVDLGELLKLRIG-----GSSGWFLDWV 1207          

HSP 9 Score: 387.497 bits (994), Expect = 7.764e-108
Identity = 346/1317 (26.27%), Postives = 604/1317 (45.86%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF----AF------------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCGR---TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR-TRYKISFYTENKPGAGSHADIYIQIFGENG---ESDVIDIKNKDG---FKEGSIFEHTLPLRQLG-TLKKIKVGNKNNGPQPRWFLNKVIINDLDQ----SRVFEFPCGQWL--SDVKGEGLEKILPVKKLPERY-----------------QKYKYEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLV--------EDLSKRKL----KTVIDFTENT-----------------WMVSIYTSDIKNASTNSKVILVLYGDNGKTDD---IVIPADSK-LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVRE---IPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLT-VRELTGTT----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKI-EAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKIDKT--IPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKS-KSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRW--LASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESD--EYLFPCFSWLATNKDGGHLSKDIFP 4167
            +E  Y+V V T ++ GAGT   ++I+I G+  +    RL+K    NK         G    F I   +LG L+ + I HD    + +W L  VEI++ ++   + F CN WL++ ++DG+++REL     AF                  K++ T Y + + TG+   +GTD+ VF  L G    TGI   ++  K +   F++G    F + A  +G + K+RI     G  S W+LD V I D  +   R  F C  WL +   D A +R++  A+    + +    Y+IS +T +   AG+ A+++I ++G+NG   +   + +  ++    F+  +     + L  +G  L+KI++G++N G  P W L++V I  L +    S    FPC +WL  S+  GE + +++P   + E+                  + + Y++ + TG+   A T +  ++ + G   +  ++ L K ES+        KF++G  D   +E  + L P+ +I    +      DW+LD + +    T     F+C  WLS  +   + + +            L+ +K     K  +D   N                  +  ++ T D ++ ST S+V +++ G N    +   + +P   K   +G +  F      VG   ++   H+ +   S W ++++ +     G +Y FLC  WL+    D  T R    + AT   I++      Y+V + TG+   AGTD N+FI ++G  G T +  L       ++FE+GQ D F +E   +  + K+++  D   +   WF+DK+I+    +      F    W   ++G   T V EL        ++ K TY ++VKT  V G GTD+NVF+ +FG+ GDTG + L+   +N+NKFE   TD+F+  +   +GE+  +R+ HD+   G  W +D I V    L   + F  ++WL    D   +  +L  +  D +D +    Y+I V T     A T    +I + G+  ++ +  +++ K   F RG+ D F+ ++ +VG I  I +GH  K+                             K  N Y                     F  + ++   E    ++++F C+    LA+ +D  M        +   + + +L  +KY V + TG+   +GT+ANVF+T++G NGDSG+RALK    N    FE    D+FL++ +DLG L ++++ HDN+     W+L+ V V + ++    +F C  WL  N+  G   + ++P
Sbjct:  980 EENTYEVNVFTGNMMGAGTDANVFINIYGENGDTGERRLRKSNHMNK------FERGQEDAFSITAVELGTLKKLRIRHDN-SGQSAWYLDRVEIVDTKDDTTYYFPCNRWLAVDEDDGQIARELVPVDEAFMRKDEDEEDSGATLGLEQKAMSTTYTLRIKTGEKKHAGTDANVFAILFGENDDTGI-INLKASKSHKNKFEKGMIDVFTVEAVDLGELLKLRI-----GGSSGWFLDWVEI-DAPSQGQRLRFPCGRWLDRGEDDGAIIRDLYPAELQTELYTPFVPYEISTFTSDVFAAGTDANVFITLYGQNGVCTQQKYLCVNKRERRLYFERAADDMFIVELEDVGDILEKIRIGHENQGTNPGWHLDRVEIRRLLRKGKGSETTIFPCERWLAKSEDDGETVRELVPSDIITEKLLRDGTLKHNEIEVEDALETHTYKVSVRTGDMHGAGTDANVFLTIYGELGDTGERKLSKSESSKN------KFEKGAVDKFSIEAVD-LGPVFKIRIRHDNSLAGADWYLDQVEVVNVDTDEVFMFLCERWLSKKKEDMRIDRTFYVKGYEGERNPLNAKKTLQNSKAGLDSNMNKKKKKKKAVIMEEGPMIPYHFTVSTGDDRDGSTTSRVYVIIMGPNDLETERLWLDLPEGKKCFAAGGMEHFMCFGLDVGEIKRVELGHNGATPESCWLVDELSVGVPTKGIQYNFLCKCWLAKDRGDGLTARVFNILDATTISIIRKVV---YEVTVVTGDTQSAGTDTNIFITVFGANGSTEEILLEKQE---DRFERGQEDTFSLEVDDIAPLKKLRVRIDGTGSRPDWFLDKMIL-RNLSTDELYVFTYEQWLSKTKGPKRTKVCELPAVVDDEEMVEKTTYVIQVKTSDVTGGGTDANVFLIVFGENGDTGTLALR-ECSNRNKFERKQTDIFRFNDILSLGELSKVRVWHDNKAPG--WHLDSIDVKDELLDQTFRFPCDRWLAKNEDDGQIMRELACANNDILDLSDKTKYEIEVTTAISEDAETKENAWIVLEGRKGRSKEFMMENPKKKKFLRGSTDSFEFSSKNVGEIVGICLGHISKEK----------------------------KVKNEY---------------------FWHVQEVVVTETELGNKFYFTCDSRIPLAAKKDQFMTFECTKTVESFASKVRSLVPVKYEVIIITGDVQDAGTNANVFITLYGVNGDSGKRALKQKFRNL---FERGRTDRFLLEMLDLGELLRVRMEHDNTTMSPGWFLECVEVTNTANWVTTIFVCGKWLDKNRADGQTYRVLYP 2213          

HSP 10 Score: 378.252 bits (970), Expect = 6.097e-105
Identity = 305/1084 (28.14%), Postives = 497/1084 (45.85%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIM---NVENKRIWLFTCNHWLSLYKEDGKVSRELFAF----KSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQC---FQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERYQKYK---YEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLV------------EDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGD-TGDRFL-THSTTNTNKFEKGQMDEFLIEAVKLGAI-SKIKLGHDSKLAGSGWFVDKVII---WEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTL---------------------LGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLD---------------------------------------PSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYG-KDKKTDQ--LPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            + Y+V V T DV G+GT   +++ + GD  +     L   K +  K        G+   F I    +G +  + I HDG      W L  V I      E++ +  F C+ W    ++DG++ REL  F    +     Y I V TG++    +DSKVF+ L G  G + ++ L   +      F+ G+   F +    +G I+++ I     G ++ W+LD V I  + N    Y F    WL +D  D  T  EI    E +       Y+I+  T +    G++A+++IQI+G+ G+++V+ + ++ + ++ G+     +  + +G + KI+V N + G    WFL++V I  L     + FPC +WL+  + +G    L V+ LPE  ++ +   YE+ + TGN   A T +  ++ + G E  D    ++  +N +     KF+ G  D   +   E L  L ++    +  G++  W+LD + I   +      F C  WL+      Q    LV            E+ S   L         T+ + I T + K+A T++ V  +L+G+N  T  I + A     +K + G +  F  E   +G   KLR      G +S W L+ + +     G   +F C RWL    +D + +R++           P   Y++  +T +   AGTDANVFI +YG+ G  T  ++L  +       FE+   D F++E   +G I  KI++GH+++    GW +D+V I     +   S +  F C  W   SE DG TVREL  + +                     L   TY+V V+TG + GAGTD+NVF+ I+G+ GDTG  +L  S ++KNKFE GA D F IEA D+G +  IRI HD++ AG+ W++DQ+ V+       ++F   +WL  K  +  +D                                        + I +    IPY  TV TGD     T S+V++ I G  D +T++  L L      F  G  + F     DVG I+++ +GH+G  P S W +D++
Sbjct:  597 VKYRVTVYTGDVSGSGTDAHVFLCLIGDLGDTGDRSLINCKNNINK-----FERGNADEFIIEAVSIGPVRRVRIGHDGRGGGCGWYLDKVTIREEGQAESQAV-EFPCSRWFDRNEDDGQIVRELQPFADGQRLYNVSYHIAVKTGNVTGGSSDSKVFVKLYGEKGDTSKMMLAVSDNNLRNYFEVGRVDIFTLDTLDIGQINRLLIGHSNEGMRAGWFLDSVQIV-VPNHGKHYMFPSHRWLCEDEADGKTEVEIY-PSETLDFELLINYEITVVTGDIFAGGTNANVFIQIYGDQGKTEVLGLSSRSNNYERGTTEIFKVEAKDVGKIFKIRVSNDDTGIGAGWFLDRVEIKRL-VVLTYSFPCDRWLASDEEDGE---LVVELLPEDTEELEENTYEVNVFTGNMMGAGTDANVFINIYG-ENGDTGERRLRKSNHM----NKFERGQEDAFSITAVE-LGTLKKLRIRHDNSGQSA-WYLDRVEIVDTKDDTTYYFPCNRWLAVDEDDGQIARELVPVDEAFMRKDEDEEDSGATLGLEQKAMSTTYTLRIKTGEKKHAGTDANVFAILFGENDDTGIINLKASKSHKNKFEKGMIDVFTVEAVDLGELLKLRI-----GGSSGWFLDWVEIDAPSQGQRLRFPCGRWLDRGEDDGAIIRDLYPAELQTELYTPFVPYEISTFTSDVFAAGTDANVFITLYGQNGVCTQQKYLCVNKRERRLYFERAADDMFIVELEDVGDILEKIRIGHENQGTNPGWHLDRVEIRRLLRKGKGSETTIFPCERWLAKSEDDGETVRELVPSDIITEKLLRDGTLKHNEIEVEDALETHTYKVSVRTGDMHGAGTDANVFLTIYGELGDTGERKLSKSESSKNKFEKGAVDKFSIEAVDLGPVFKIRIRHDNSLAGADWYLDQVEVVNVDTDEVFMFLCERWLSKKKEDMRIDRTFYVKGYEGERNPLNAKKTLQNSKAGLDSNMNKKKKKKKAVIMEEGPMIPYHFTVSTGDDRDGSTTSRVYVIIMGPNDLETERLWLDLPEGKKCFAAGGMEHFMCFGLDVGEIKRVELGHNGATPESCWLVDEL 1656          

HSP 11 Score: 271.552 bits (693), Expect = 2.862e-72
Identity = 230/866 (26.56%), Postives = 390/866 (45.03%), Query Frame = 1
Query:  460 LRDCYNSSLDAEKL----GLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF------------AFKSVRTK---------------------------YEIVVITGDLDDSGTDSKVFISLCGRTGI-SPQIQL-FKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR--EIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKL---PERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENT-WMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI--PADSKLDSGSVVEF----RTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWL-----SDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT--FRCNCWFDSSEGDGLTVREL 2862
            +R+   S +  EKL     L+ N     + L  H    YKV+V T D+ GAGT   ++++I G+  +    +L K + S  K        G+   F I   DLG +  I I HD       W L  VE++NV+   +++F C  WLS  KED ++ R  +            A K+++                             Y   V TGD  D  T S+V++ + G   + + ++ L   E  +CF  G    F+     VG I ++ +  + +  +S W +D + +  +     +Y F CK WL+KD GD  T R   I  A  I  I  +  Y+++  T +   AG+  +I+I +FG NG ++ I + K +D F+ G     +L +  +  LKK++V     G +P WFL+K+I+ +L    ++ F   QWLS  KG    K+  +  +    E  +K  Y +++ T +     T +  ++I+ G       L   E +N+      KF+   TD+        L  L+++    +   K   W LD I +          F C  WL+ +    Q    ++ +L+      ++D ++ T + + + T+  ++A T     +VL G  G++ + ++  P   K   GS   F    +    IVGI     ++         W+++++++T+   G+++ F C+  +      D    F   + + +    +    P+ KY+V I TG+   AGT+ANVFI +YG  GD+G R L     N   FE+G+ D FL+E + LG + ++++ HD+     GWF++ V   E  N +N VT  F C  W D +  DG T R L
Sbjct: 1374 VRELVPSDIITEKLLRDGTLKHNEIEVEDALETH---TYKVSVRTGDMHGAGTDANVFLTIYGELGDTGERKLSKSESSKNK-----FEKGAVDKFSIEAVDLGPVFKIRIRHDNSLAGADWYLDQVEVVNVDTDEVFMFLCERWLSKKKEDMRIDRTFYVKGYEGERNPLNAKKTLQNSKAGLDSNMNKKKKKKKAVIMEEGPMIPYHFTVSTGDDRDGSTTSRVYVIIMGPNDLETERLWLDLPEGKKCFAAGGMEHFMCFGLDVGEIKRVELGHNGATPESCWLVDELSVG-VPTKGIQYNFLCKCWLAKDRGDGLTARVFNILDATTI-SIIRKVVYEVTVVTGDTQSAGTDTNIFITVFGANGSTEEILLEKQEDRFERGQEDTFSLEVDDIAPLKKLRVRIDGTGSRPDWFLDKMILRNLSTDELYVFTYEQWLSKTKGPKRTKVCELPAVVDDEEMVEKTTYVIQVKTSDVTGGGTDANVFLIVFGENGDTGTLALRECSNR-----NKFERKQTDIFRFNDILSLGELSKVRVWHD--NKAPGWHLDSIDVKDELLDQTFRFPCDRWLAKNEDDGQ----IMRELACAN-NDILDLSDKTKYEIEVTTAISEDAETKENAWIVLEGRKGRSKEFMMENPKKKKFLRGSTDSFEFSSKNVGEIVGICLGHISKEKKVKNEYFWHVQEVVVTETELGNKFYFTCDSRIPLAAKKDQFMTFECTKTVESFASKVRSLVPV-KYEVIIITGDVQDAGTNANVFITLYGVNGDSGKRALKQKFRNL--FERGRTDRFLLEMLDLGELLRVRMEHDNTTMSPGWFLECV---EVTNTANWVTTIFVCGKWLDKNRADGQTYRVL 2211          

HSP 12 Score: 95.1301 bits (235), Expect = 1.098e-18
Identity = 49/117 (41.88%), Postives = 76/117 (64.96%), Query Frame = 1
Query: 7189 EELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKI-WKYPCNEWLSKSKG 7536
            +E  KK V  YE++ +TG  NG GTDANVF+TLFG+   + K  L  K R  FE+ + D F ++  ++G ++KI+IEHD++   + WFLDRV V +++   + + + CN WLS+ +G
Sbjct:   91 DEYHKKKV--YEVVTITGDVNGAGTDANVFVTLFGDYGITPKLHLSSKNRTSFEKNKTDVFRVKTHNVGPLKKIRIEHDNTGLNASWFLDRVVVTDMNRPHLRFYFACNNWLSRDEG 205          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Zebrafish
Match: loxhd1a (lipoxygenase homology domains 1a [Source:ZFIN;Acc:ZDB-GENE-091112-20])

HSP 1 Score: 885.945 bits (2288), Expect = 0.000e+0
Identity = 496/1306 (37.98%), Postives = 755/1306 (57.81%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDN----SVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDK--SQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVI-----RRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYI-AGYQGERSNAPSGRSRS---IYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            +Y F  +RWL  DE D  +  E+ P++     L   K + Y V V TG+ + +GT+ANVFL I+G+ G S    LK+  +N    +   F E   D+F I  +DLG L+K++IRHDN    A+WYLD V + D  DE  Y FPC  WLA ++D G L +++ P + A  K  +D + +   +Q  + Q+     F ++V T +K YAGTDANV  ILYG  +D+GII LK S  H NKFE G  DEF ++  D+G+LK+IRIGHDN+G +  W L  VEI+A  LGQ   FPC  W+ K K DG + R+LYP    T+   P + YEI   T++    GT+A+V+I +YG+N  CT + +L  N    +   +    D+F V ++D+ D IEKIRIGHDN+G+   WHL++V ++RLL     S    FPC RWLA  EEDG   REL+P  +I     R G++  +   +D      + L+   YT+ V TG     GT+ANVF+ +YG+ GD+GER+L  S+ +++KFE+ ++D F  EAVDLG+VFKI IRHDNS     DW+L+++E++D+   E +LF CERWLS+ ++DK+I R  Y+           P    R    IY  + +         H                + I Y  ++ TG ++D  +S   ++ + G  + ++  + L     + F PG+ +  +    DV  IK+VE+ ++G   ES W ++ +++E+PTK   Y   C  WL+K  G+  T+RI ++QD  M N+S+K+ Y ++V+TGDV   GT++ +++ +FG  G S    L K ED FERG  D F LE+ED+  ++K+R++ D +G RP WFL+K+++ N  T+E   F Y E+LS++ G K+ L  ++  + D    ++ T Y V VKTS+  +AGT + V +  +GE GD+G L LK     NK F+  Q D F FPD+LSLG+LS+ ++WH+NSG +  WHLEY+++ +    + ++F C++WL+  +DD QI REL C N  N       +T YE+ V T D  +A    + W V  G+K  S +F++EN+  K+K F R + D+ + +   LG++ +I LG +    +       WF +EV V        Y+F+  + I +  K  E   + F+ +  +E    + + + +    VKYE +V+TG   G GTDANVFIT+FG N +SG+R L +K  NLFE+GQ ++FILE +D+G + ++++EHD+S     W L R+++ N +      + C +WL K+K 
Sbjct:  741 QYMFPSHRWLCKDEADGKVEVEIYPSE----TLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFRE---DEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVD------DALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKSE-NSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNS-MLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYVKVCLHVCMCCTPGVFWRVAIFIYCKNVSKCFHICQIPH----------------KLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRSERLWLDLDGKSAFLPGALDYFTCYGTDVGEIKKVELGHDGATPESCWLVDELTVEVPTKAVRYVFRCKCWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLEDRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNK-FERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACAN--NDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSA-KKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEF--QTFECTKFIE----SFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKA 2005          

HSP 2 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 582/2029 (28.68%), Postives = 953/2029 (46.97%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFA--FKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKF-VIPATCVGPISKIRIRQDESGSKSSWYLDRVCI----TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISF----YTENKPGAGSHADIYIQIFGENGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQS----FICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENT--WMVSIYTSDIKNASTNSKVILVLYGDNGKTDD-IVIPADSKL----DSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI-PATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKG-----QMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVREL-----------------TGTTLLG------KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKIDKT--IPYQITVFTGDVMHAGTDSKVFIQIYGKD-----KKTDQLPLKSKSDTFERGNEDVFKINAADVG-VIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELK--------------YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFP---------ANPAMYKDWKDNKLDKSQ-----FKIYQ-EDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGET--GTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEW-EAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSK---EVISVEAPDVENIKQVEICNEG--VDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKK-----ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN-FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKN 6315
            Y  +V T D KG+GT   +Y++I G+  +    +L    K N          G+   F I   +LG L  I I H+       W++    I ++ NK ++ F  + W  + + DGK+ R++ A   + +   Y + V+TGD+  +GT+SK+ + + G  G     +LF E    F+R Q   F V     + P+S++ I  D +G    WY ++V +    T L+       F C  W  +D GD    RE+    E++ +  + + K  +    +T +  GAG+ A +++Q++GENG+SD   +++K D F++    +  + +  +G ++K+++ ++   P   W L +V +        + F C +WL D+  +  E I   ++LP    K  Y + I TGN + + T +  Y+ + G   +  ++++    S N +     KF++G  D   VE    L  +  +  G +  G    WFLD +++   + G  ++    F C  WL  +    Q    LV              T++   + ++I T  I  AS++SKV + LYG+ G T+  +++ +D+ L    ++G    F  E   +G   +L   H N G  + W L+ +L+   V+G +Y F  +RWL     D     EI P+    I K   +  Y+V + TG+   AGT+ANVF+ IYGE+G +    L    + +N FE+G     + DEF I  + LG + K+++ HD+K A + W++D+V I++ ++ +    F C  W    E DG   REL                 +G   LG        T+ + VKTG+ + AGTD+NVF  ++G   DTG + LK S  +KNKFE G  D F IEA DIG++K IRI HD+ GA   WF+D + +  P LG    F   +WL    D   +  DL P+++  +  T  +PY+I +FT D+   GTD+ VFI +YG++     +K+  +  + +   FER  ED+F +   D+G +I+KIRIGHD +    GW LD+V                                               + L +  +  E  I    F C RWLA  E+D   +REL+P+D     LS    LK              Y V V TG+ +G+GTDANVF+T++G  GD+GER L  + +NS NKFE  S+D F ++A+DLG + KI+IRHDNS   A WYL+ V V D+  E  +LF C  WL+  ++   + +  +            P ++  W+       +     F I Q   KL  ++  V T     A T + V++I+ G+ +      L   L   + F  G  D F     D+GE+KK+ +GHD + P + W + ++ +E       +VF C  W++K + DG   R L  Q +  +    K+ YE+T +T + + AGT+  +Y+ V+G    +E+  L    D  + + G  D F + +ED+  P+ K+R+  D  G    W L+K+ +  L  ++  +  YE     WL+R                   G    L   +  V     +++   YT+ V T   T  GT+ANV++ ++GENGD+G   L +S  +T+KFE+   D F + + + LG++ K+ I HDNSG     W L+ +++ D    + + F C+RWL+K++DD +I R L  A   G   +                                         E   Y I + T    D  +    W+ L G K      +     +   F  G+    E  S E  D+ +I    I  +G  V  E+SW+++ + +     G  Y   C   +S    +R   + F     + + +SK      + Y   VITGD    GT++ +F+ +FG+ G+S    L K   N FERG  + F LE+ D+G + ++++++D +G  P W L +++ITN +   +  F   ++L KN
Sbjct:  151 YIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDN-------FERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWVI----IDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQPMAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLEGGT-FERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQ-----VFPCGRWFDEDEGDGLVERELY---EMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWL-DINEDDQEII---RELPAE-GKLVYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLM--FMSKNNV----NKFEKGNADEFLVEA-VTLGQIRRVRIGHDGRGGGCGWFLDKVMV--REEGQPEASSIEFPCYRWLDRNEDDGQIVRELVP-------------TDDAVGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGKVEVEIYPSETLEIEK---LINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSE---LIRLKSRSNNFERGTTEIFREDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYF-FPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRV---------------------------------------------EIRRLLRKGKGSETAI----FPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKS-ENS-NKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYVKVCLHVCMCCTPGVF--WRVAIFIYCKNVSKCFHICQIPHKLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRS-ERLWLDLDGKSAFLPGALDYFTCYGTDVGEIKKVELGHDGATPESCWLVDELTVEVPTKAVRYVFRCKCWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLED--RFERGQVDTFNLEIEDI-APLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYE----EWLSRS-----------------YGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES-NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSG-PAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFD-----------------------------------------EKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPIS-LSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKN 2003          

HSP 3 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 590/2188 (26.97%), Postives = 970/2188 (44.33%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFAFKSV-----RTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI-RGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL--EKILPVKKLPERYQ-KYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQD----WFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDL-SKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFK-----IEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----------------DSKTLEYDLD------PSKIDKIDKTIP--YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK---SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNG-DSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLG-TLEKIKIRHDNSNGGAAWYLDYVLV------NDESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSL--TMTKRPK---------------------------IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVEN---IKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKN--EDNFERGHRDHFKLEMEDVGKIKKI---RIQNDGNGDR--PHWFLEKLDITNESTNESYQF-------------EYNEF-LSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFR 6723
            +Y+V   T DVKGAGT   +++++ G+    P++ L          +        T +F I+  ++G     L+    +    SW L  V + ++    + + + CN+WLS  + DG   R L    +      + KY   V T D   SGTD+ V++++ G  G + + +L  E    F+RG   KF I A  +G + KI I  +  GS + W    V I D+ N E  Y F    W     GD    R++  GA + M I     Y +   T +  GAG+++ I++ + G  G  +   +     F EG  FE       +   L  L  L ++ +G+ N G    W+  KV +      L+Q     FPCG+W  + +G+GL   ++  +  L ++ Q K+ + + I T +   A T ++ ++ + G   K     K+ES      ++  F++   D   +E+     P    I  + +  + ++    W L  + +    T  + SF+C  WL  +    + +  ++ +L ++ KL          + V+I T ++  + T++ V L + GD G T + ++       +K + G+  EF  E   +G   ++R  HD  G    W L+K+++ +         +F C RWL  + +D   VRE+  T   +        Y + I TG+   A +D+ VF+ +YGEKGDT    L  S  +  N FE GQ D F IE   +G ++++ +GH ++   +GWF+D V+IW    P + +   F  + W    E DG    E+  +  L     + YEV V TG V  AGT++NVF++I+G+ G +  ++LK   +  N FE G T++F+     I   D+G +K +RI HD+  A ++W++D++ +   K    Y F   +WL                D   ++ D D      P+++    K +   + + V TG+  +AGTD+ VF  +YG    T  + LK+     + FE G  D F I A D+G +++IRIGHD      GWFLD V I+                                        +PS   L +             F C RWL   +DD  IVR+L P + +    +    + Y + + T + F  GTDA+VF+ ++G+NG  + +++L          FE  + D F+++  D+G  +EKI+I HDN      W+LD V +         S+  +FPC  WLA +++ G   +++ P++  + K  +D  L   + ++    ++  + V V T     AGTDANV I LYG+  D+G   L +S  +SNKFE G+ D F ++  DLG++ KIRI HDNS  +ADW+L +VE+  +   + F+F C  W+S+ + D  ++R  Y ++ L   M   P                            I Y  +  T + + A T++ VY+ + G+     +    +   KS    G  D F     DV + I+K+ +GHD     S W ++++ V+       K++ Y F C  WLA+D  DG   R L           N       Q   + NI QK  Y + V TG     GT+  +++ V+G  G S E  L   +   D+FE+  +D F  E  D+  + K+ +R D SG  + DWFL KIE+ +   +E   F  E WLS+S                        G  R++       +D                  D    E   YT+++ T      G+    WM ++G       +   +   TN F     +V     PD+ +   + +V I ++       W+L  + +     GK +   C  WL+K   + +  R  +  +    +  +K  Y I V T D+D   T    ++ L G +G S  + L+ +  +  F RG+ D F+   +++G I  I    I  DG   +    WF++++ +T +     Y F             E+  F  +K +      A  L P+       Y+ IV T + K AGT + V +  +G  GDSG  +L     N   F+  Q + FI  ++L +GDL R QV H+NSG S  W L  IE+       +  F C KWL     D +I R
Sbjct:   25 VYEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHL-------ASKSRTAFEKNKTDVFRIKTHNVGFCNIRLV----IYIFASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLLGSLNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGW----VIIDDMGNKE-VYEFPVDAWFDISEGDGKIQRDVLAGATQPMAIV----YNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKL-----FLEGGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQV----FPCGRWFDEDEGDGLVERELYEMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQF-KLES------KSDSFEQAQCDKFIIEM-----PDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWLDIN----EDDQEIIRELPAEGKL---------VYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVRELVPTDDAV-------GYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIWV---PVHGLQYMFPSHRWLCKDEADGKVEVEIYPSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLK---SRSNNFERGTTEIFREDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEID----------------------------------------APSLGQLLR-------------FPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPF--VPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKS-ENSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYVKVCLHVCMCCTPGVFWRVAIFIYCKNVSKCFHICQIPHKLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRSERLWLDLDGKSAFLPGALDYFTCYGTDVGE-IKKVELGHDGATPESCWLVDELTVEV----PTKAVRYVFRCKCWLAKDRGDGLTARIL-----------NV------QDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLE---DRFERGQVDTFNLEIEDIAPLRKMRVRIDASG-SRPDWFLDKIELHNLQTDEVATFTYEEWLSRS-----------------------YGPKRTLICEMPAVID------------------DEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRF--PDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVK------YEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLN--LFERGQTNRFIL-ELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKR 2011          

HSP 4 Score: 581.637 bits (1498), Expect = 8.913e-171
Identity = 522/1924 (27.13%), Postives = 848/1924 (44.07%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLES-ILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESD----VIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRV--FEFPCGQWLSDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLV--EDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK-LDSGSVVEFRT-ELAIVGIPY----KLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVRE-IPA--------------TGP---GIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNK----FEFGATDLFKIEAEDIGEI-KSIRISHDDTGAGSAWFVDQICVIVPKLGLK------YIFFLNKWL-----DSKTLEYDLDPSKI---------------DKIDKTI---PYQITVFTGDVMHAGTDSKVFIQIYGK--DKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMI-----VRELLPTDEKGNP-----------LSNL-----------KELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLD--YVLVNDESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYG--ETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTV---TSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRH---DNSGF-FKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQR---TLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRI 5958
            I+Y V V T D++GAGT+  I++ + G K N    +L     +               IF +   +L    S + I HD       W  + V +         +F C  W    + DG V REL+   S+R K      + + + T D+  +GTD++VF+ + G  G S Q +L +  +  F++ Q  KF+I    +G I K+RI  ++    S W+L RV +      E +Y F C  WL  +  D   +RE+    +++       Y+++  T N  G+G+ A +Y+ I G+ G++      +   N + F++G+  E  +    LG ++++++G+   G    WFL+KV++ +  Q      EFPC +WL   + +G      V++L        Y + I TG+   AS+ S+ +V L G +     +  + S N +      F+ G TD+  +E  + +  +  ++ G    G    WFLD ++I+ P  G++  F    WL       + EV +   E L   KL          + V++ T D+  A TN+ V L +YG+ GK++ I + + S   + G+   FR  E  I G+      KLR +HDN   N+SW L+++ +    +   Y F C RWL+   +D    RE +P               +GP   G+ + A    + +++ TG K  AGTDANVF  +YG K DTG   L  S  + NKFE G +DEF IEAV +G + +I++GHD+  A  GWF+D V I +  +    + F C  W D  + DG  VR     EL        V YE+++ T  +   GTD++VFI ++GQ G       K+   NK +    FE  A D+F +E +DIG+I + IRI HD+ G    W +D+  V + +L  K       IF   +WL     D +T+  +L PS I                ++D  +    Y +TV TGDV  AGTD+ VFI +YG   D    +L     S+ FERG+ D F + A D+G + KIRI HD     + W+L++V                                                   ++ +Q+   I  + F+C RWL+   +D  I     V+  L       P             N+           K + Y   V TG++  + T + V++ I GK     ER   +    S   F   +LD F     D+G ++K+++ HD +   + W +D   V V  ++  Y+F C  WLA ++  G  ++ +   +  M        ++ SQ  IY+        V V T    +AGTD  +++ ++G   T++  ++P  +     ++FE G  D F ++  D+  L+K+R+  D SG   DW L K+E+   +  +   F   EW+S+S      +R L  ++   +     ++  I TV   TS+   AGT+ANV++ ++G N  T    L  +++ +K +   TDVF          + K+RI HDN G    WHLE V V   +  K     + F C+RWLA++E+DG I REL           N  G   D         +K  Y I V T    +  T  N ++ + G+ G S E  L +S     +F + N D FE+ + +LG +  I + H   D      +  WF+ ++ + +K     Y+F C+  +S S    + Q    T +I  +  +                A SL   K                        Y   ++TG EK  G+    ++ ++G  N  +   +L K   N F  G      +E  D+ ++ +V++ ++       W L+ I I     G      CG WL K   + +  R+
Sbjct:  270 IVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLEGGT--------FERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELYEMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKL-ESKSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTRE-KYSFVCNRWLDINEDDQEIIRELPAEGKLV-------YRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQ----IVRELVPTDDAVGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDL---GNYFETGQTDIFTIETFD-IGKVNRLLIGHTNEGLRAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGKVEVEIYPSETLEIEKLIN--------YEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFREDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEI-DAPSLGQLLRFPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVC--TSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDR--VEIRRLLRKGKGSETAIFPCERWLAHSEEDGETIR-ELVPSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKSENSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQV---------------------------------------------------EVLDQDTEEI--FLFLCERWLSRKREDKRIDRVFYVKVCLHVCMCCTPGVFWRVAIFIYCKNVSKCFHICQIPHKLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRSERLWLDLDGKSA--FLPGALDYFTCYGTDVGEIKKVELGHDGATPESCWLVDELTVEVPTKAVRYVFRCKCWLAKDRGDGLTARILNVQDAEM--------VNISQKVIYE--------VTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLE-----DRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSY---GPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKK----FRFQCDRWLAKNEDDGQIMREL--------ACANNDGVDFD---------EKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENS-AKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISK----------------AQSLVPVK------------------------YEAIVITGDEKGAGTDANVFITIFG-SNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRV 2012          

HSP 5 Score: 555.444 bits (1430), Expect = 6.925e-162
Identity = 328/881 (37.23%), Postives = 510/881 (57.89%), Query Frame = 1
Query:  922 LFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS-KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGN-----EDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            + +F SV   YE+V +TGD+  +GTD+ VF++L G  G+SP++ L  ++   F++ +T  F I    VG    IR+        +SW+LDRV +TD+  P  R+F+ C NWLS++ GD  TVR + G+   M I  + +Y  S +T +  G+G+ AD+Y+ IFGE    GE  ++  + KD F+ G+  + T+    LG L+KI +G+ N G    W    VII+D+    V+EFP   W    +G+G     +L     P       Y +++ TG+   A T S+ ++++ G +         +++ K+++E   F+    D+  VEL E LSPL+ +  G +  G N  W+ + + ++CP TG+EQ F CG W          E  L E +S R+ K      +  W + I+TSDIK A T+++V L +YG+NGK+D   + + S   +     +F  E+  +G   KLR  H+     S W+L ++ + + +  ++Y F+CNRWL  + +D   +RE+PA G  +        Y+V I TGN   +GTDA+V++NI G+ GDTG+R +  S  N NKFEKG  DEFL+EAV LG I ++++GHD +  G GWF+DKV++ EE  P ++S+ F C  W D +E DG  VREL  T     V Y + +KTG + GA +DS VF++++G+ GDT  + L  S  +  N FE G TD+F IE  DIG++  + I H + G  + WF+D + + VP  GL+Y+F  ++WL     D K +E ++ PS+  +I+K I Y++TV TGDV  AGT++ VF+QIYG++ K++ + LKS+S+ FERG      ED F I   D+G ++K+RI HD K+  + W+LD+V
Sbjct:   19 MLSFSSV---YEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHLASKSRTAFEKNKTDVFRIKTHNVG-FCNIRLV---IYIFASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLLGSLNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVS-EGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGW----VIIDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQP---MAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGN-------KNSGKLFLEGGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELYEMVSLRQKKQ----KKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWLDINEDDQEIIRELPAEGKLV--------YRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVRELVPTD--DAVGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGK-VEVEIYPSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFREDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRV 862          

HSP 6 Score: 547.74 bits (1410), Expect = 2.102e-159
Identity = 412/1348 (30.56%), Postives = 651/1348 (48.29%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGE--TNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELK-KIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNE--TYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLET---NYFAPGSKEVISVEAPDVENIKQVEI--CNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERG-----HRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDI-----------------------KKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNE--TSYEVTVITGDKKNAGMPHDVWFVFYGEKNY--SDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKK----WFCNEVHVKNLAT----LKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVK--------------YEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQ-KGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSK 7533
            R+++ CN WL+ +E D + VR LL +    NP+   K+ KY+  V T +  GSGTDA+V+L IFG+ GD+GER L   V    + FE  + DKF I+A +LG L KI I H+N    A W    V+++D  ++  Y FP  +W   ++  G + +D+                 +    +Y        NV+V T     AGT++ +H++++G     +SG + L+        FE    D F V+  +L     ++ IGHDN+G N  W+  KV +     G   VFPC  W  + + DG +ERELY  +SL   K+ K  + +   TS+ KGAGT+A V++QVYG N  +++  L + SD  + Q  C D F + M D+   I K+RI H+ +   S WHL +V + + L  +     Y F CNRWL  +E+D  I REL  +                          K  Y + + TG    +GT+A+V+L + G+ GD+GER +  SK + +KFEK N DEF  EAV LG++ ++ I HD  G     WFL K+ + ++   E  +  F C RWL +++DD +I R L            P+                                      + + Y I I TG      S    +++LYG K   TN + L   +    NYF  G  ++ ++E  D+  + ++ I   NEG+   + W+L+S+ I +P  G  Y      WL K   + K      I       + K I Y ++V+TGDV   GTN+ +FLQ++G +G S L  L    +NFERG       D F +   D+G +KK+RI++D       W+L++++I +      Y F    +L+ +     +L  +L P+++                          T + + VKT   K AGT + V    YG   D+G + LK  + +   F++  +DEF   + + +G L R ++ H+N+G S  W L+++E+      +  +FPC +WL    DD  I R+L     PN  +T        YE+ + T D    G   DV+ + YG+     S K +  N  ++   F R++ED      +++ EL++I  G ++ K  +  D++     W  + V ++ L       +T +F  + W+  H    E DGE   I  +V  P+   VE+L + G +K              Y + V TG   G GTDANVFITL+G+  ++G+R L + +  N FE+G  D F LE VDLG++ KI+I HD+S   +DW+L++V+V +  T +I+ + C  WLS+ +
Sbjct:  114 RFFYACNNWLSREEGDGLTVRYLLGS---LNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKL---VSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGW----VIIDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGAT------------QPMAIVY--------NVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLE-----GGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELYEMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDSFE-QAQC-DKFIIEMPDIG-KIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREK----YSFVCNRWLDINEDDQEIIRELPAEG-------------------------KLVYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGG-GCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVREL-----------VPT-------------------------------------DDAVGYHIAIKTGSINGASSDSKVFVKLYGEKG-DTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGL--RAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGKVE--VEIYPSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFREDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVD-EDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTI-EAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLY----PNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAED------MFIVELQDI--GDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWL-AHS---EEDGET--IRELV--PSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKSENSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKR 1318          

HSP 7 Score: 414.075 bits (1063), Expect = 2.520e-116
Identity = 312/1091 (28.60%), Postives = 510/1091 (46.75%), Query Frame = 1
Query:  538 LSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIM---NVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQC---FQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNK-DGFKEGS--IF---EHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS--DVKGEGLEKILPVKK-------------------LPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKLDSGSVVE------FRTELAIVG-IPYKLRAQHDNSGTNSSWNLEKI----LMTQAVNGDEYQFLCNRWLSDSHEDFSTVRE-IPA-------TGPGIVK--------PAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLLGK----------------------------------VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLE-YDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            L    +++Y+V + T +V G+GT   +Y++I GD  +    RL        K+   K   G+   F +    LG +  + I HDG      W L  V +      E   I  F C  WL   ++DG++ REL         Y I + TG ++ + +DSKVF+ L G  G + ++ L   +      F+ GQT  F I    +G ++++ I     G ++ W+LD V I  +     +Y F    WL KD  D     EI    E + I     Y+++  T +   AG++A++++QI+GE G+S++I +K++ + F+ G+  IF   E T+    LG LKK+++ + N      W+L++V I D     ++ FPC +WL+  +  G+   +++PV +                   L ++     + M++ TG + +A T +  + IL G +    I++   S N       KF+ G  D   +E  + +  L  I  G +  G +  WFLD + I  P  G    F CG WL   +     + ++V DL   +L+TV+      + + I+T+DI    T++ V ++LYG NG          +K +     E      F  EL  +G I  K+R  HDN G N  W+L+++    L+ +    +   F C RWL+ S ED  T+RE +P+       +  G +K           I  Y V + TG+   AGTDANVFI +YG+ GDTG+R L+ S  N+NKFE+G +D F +EAV LG + KI++ HD+ +  + W++++V +  +Q+      F C  W      D    R       L                                    + Y   V TG  + A T S V++ I G+       +L   +  K+ F  GA D F     D+GEIK + + HD     S W VD++ V VP   ++Y+F    WL     D  T    ++  +++  I + + Y++TV TGDV HAGTD+++++ ++G    ++++ L    D FERG  D F +   D+  ++K+R+  D       WFLDK+
Sbjct:  513 LPAEGKLVYRVTICTGNVSGSGTDASVYLNIIGDLGDTGE-RL----MFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSI-EFPCYRWLDRNEDDGQIVRELVPTDDA-VGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIW-VPVHGLQYMFPSHRWLCKDEADGKVEVEIY-PSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFREDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKN----HKNKFELGLIDEFTIEAVD-IGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKD----DGAIVRDLYPNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKS-ENSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVL-DQDTEEIFLFLCERWLSRKREDKRIDRVFYVKVCLHVCMCCTPGVFWRVAIFIYCKNVSKCFHICQIPHKLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRSE-RLWLDLDGKSAFLPGALDYFTCYGTDVGEIKKVELGHDGATPESCWLVDELTVEVPTKAVRYVFRCKCWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLEDRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKI 1582          

HSP 8 Score: 261.536 bits (667), Expect = 3.174e-69
Identity = 195/596 (32.72%), Postives = 299/596 (50.17%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYV-LVNDESDEYL-FPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVK-CCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKG-----LGSAWHLEKVLV-KRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLY 5451
            RY F C  WLA D  D +  R L   D +   +S  +++ Y V V TG+   +GTD  +++T+FG  G S E  L    D    +FE   +D F ++  D+  L K+++R D S     W+LD + L N ++DE   F    WL+ +       + +    PA+  D              +  +L  + V V T+    AGTDANV +I++GE  D+G + LK+S  ++NKFE    D F+      LGEL K+RI HDNSGP   WHL  V++  + LG+ F F C+ W++K++ DG + REL    +  +    K KYEI   T++   A T  N +I + G+   +++  L N++ K +   G TD F  S +++ D I  I +GH  K      + ++W +++V+V ++ L NK     Y F C         D  I      D+           + I+   S A  L    Y   V TG E   GT+ANVF+ ++G NGDSG RQL   K   + FE+   + F  E +D+G + ++ + HDNSG     W L +IEI +  +  T +F C +WL K+K D +I+R +Y
Sbjct: 1464 RYVFRCKCWLAKDRGDGLTARILNVQDAEMVNIS--QKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLED----RFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGP---KRTLICEMPAVIDD-------------EEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES-NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGD-IASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNK-----YIFRC---------DAPISLSSKRDEF----QTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQL--CKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGL-SPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIY 2014          

HSP 9 Score: 223.016 bits (567), Expect = 1.526e-57
Identity = 172/662 (25.98%), Postives = 306/662 (46.22%), Query Frame = 1
Query:  547 HDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSREL------FAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHAT-VREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK-----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG---LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAG-INVGGK----NQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTD--DIVIPADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI 2466
            H  I Y  +VTT   + A TS  +Y+ I G      ++  +  +            PG+   F    +D+G+++ + + HDG  P+  WL+  + +        ++F C  WL+  + DG  +R L          S +  YE+ V+TGD+  +GTD+++++++ G  G S ++ L K   + F+RGQ   F +    + P+ K+R+R D SGS+  W+LD++ + +L+  E   F   + WLS+ +G   T + E+    +   +   T Y +S  T +   AG+ A++++ IFGENG++  + +K     NK   K+  +F     +  LG L K+++ + N+GP P W L  V ++D    + F F C +WL+  + +G    E         +  +K KYE+ ++T +   A T   A+++L+G + + K      S  K      +F  G TD       E L  +  I  G I   GK       WF+D++++   + G +  F C   +S S    + +        +  +          +   + T D K A T++ V + ++G NG +    +     +  + G    F  EL  +G   +++ +HDNSG +  W L +I +T   NG    F+C +WL  +  D    R I
Sbjct: 1367 HKLIPYHFSVTTGSDRDASTSSRVYVIIIG------KMHKRSERLWLDLDGKSAFLPGALDYFTCYGTDVGEIKKVELGHDGATPESCWLVDELTVEVPTKAVRYVFRCKCWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLEDR-FERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATF-TYEEWLSRSYGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRFP-DILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKK-----KRFLRGNTDRFEFSSKE-LGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVI 2013          

HSP 10 Score: 199.904 bits (507), Expect = 1.699e-50
Identity = 168/652 (25.77%), Postives = 300/652 (46.01%), Query Frame = 1
Query: 5614 AYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIK--QVEICNEG--VDRESSWYLNSISIEMPTKGKL-YNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPL-DKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNL--FEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKI--WKYPCNEWLSKSK 7533
             Y +  VTG  K  G+    ++ L+G   +   +         + A  S+        DV  IK   V  CN    +   +SW+L+ + +    +  L +   C  WLS+  G+  T R + +      ++ K+  Y+ SV T D    GT++ ++L +FG  G++    L  + +DNFERG+ D F +E  ++G+++KI I ++  G    W +    I +    E Y+F  + +   + G  K     LA         Y V V T +++ AGT+S + +  +G  G  +SG L L+        F+  Q+D F    +  L  LSR  + H+N+G +  W+ E + +    T     FPC +W    + D  + REL      +  +  + +  + + + T D K AG    V+   YGE   SD+F +E+  D    F ++  DK  +    +G+++ +++      +E  +    W    V +    T + Y F    W++++E     D EI              + EL  +G + Y + + TG  +G GTDA+V++ + G+  ++G+R +     N+  FE+G  D+F++E V LG+I +++I HD       WFLD+V V+     +    ++PC  WL +++
Sbjct:   25 VYEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKV---------HLASKSRTAFEKNKTDVFRIKTHNVGFCNIRLVIYIFASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVR-YLLGSLNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWVI----IDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQPMAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLE-----GGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELY--EMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDS---FEQAQCDKFIIEMPDIGKIRKLRIW-----HEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWLDINED----DQEI--------------IRELPAEGKLVYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNE 629          

HSP 11 Score: 181.415 bits (459), Expect = 7.266e-45
Identity = 130/411 (31.63%), Postives = 204/411 (49.64%), Query Frame = 1
Query: 3817 YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAI-DLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGH-----DNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWIS-KSKVDGNLERELYPQLSLTMTKRPK---IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP 5013
            Y V VKT +   +GTDANV++ IFG+NGD+G   LK +  N+ NKFE K  D F    I  LG L K++I HDNS     W+L+YV V+D+    ++ F C  WLA N+D G + +++  AN            D   F     D+   + + V T     A T  N  I+L G+   S    L+ S     +F  GN D F+    +LG++  I +GH           A W + +V +  ++LG  ++F C+  IS  SK D     E    +   ++K      +KYE   +T + KGAGT+ANV+I ++G N  + +  L      +  + G T+ F + + D+ D + ++++ HDN GL   W L ++ +     N    +   F C +WL +++ DG I+R + P
Sbjct: 1630 YTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES--NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANN-----------DGVDF-----DEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENS-AKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKF-LNLFERGQTNRFILELLDMGDLL-RVQVEHDNSGLSPGWLLSRIEI----TNTANGVTTIFICGKWLDKNKADGRIKRVIYP 2015          

HSP 12 Score: 132.88 bits (333), Expect = 3.850e-30
Identity = 89/312 (28.53%), Postives = 158/312 (50.64%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG-----AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQ 4611
            ++ F C+RWLA +EDD  I+REL   +  G      ++ KY + V T +   + T  N ++ + GK G S E  L+N+      +F   + D+F   + +LG +  I + H   +G      A+W++D V+V ++   ++Y+F C + ++              +    ++ ++  K  +S     Q      +   V T  +  AGTDANV I ++G   DSG   L +     N FE G  + F ++  D+G+L ++++ HDNSG +  W L+++EI     G + +F C +W+ K+K DG ++R +YP+
Sbjct: 1723 KFRFQCDRWLAKNEDDGQIMRELACANNDGVDFD--EKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKK--KRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPIS------------LSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFL--NLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIYPK 2016          

HSP 13 Score: 130.568 bits (327), Expect = 2.235e-29
Identity = 131/560 (23.39%), Postives = 237/560 (42.32%), Query Frame = 1
Query:  469 CYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRG-----DKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSL-YKEDGKVSRELFAF-----KSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKE-NTQCFQRGQTSKFVIP-ATCVGPISKIRIRQDESGSKSSWYLDRVCI-TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGA-KEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN---KDGFKEGSIFEHTLPLRQLGTLKKIKVGN-----KNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERY-------QKYKYEMKISTGNRAHASTTSRAYVIL---KGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRP 2049
            C+ +    + L  R  + +    ++   +++Y+V V T DV+ AGT   IY+++ G     ++  LP++               +   G    F +   D+  L  + +  D    +  W L  +E+ N++   +  FT   WLS  Y     +  E+ A          T Y + V T D   +GTD+ V++ + G  G +  + L +  NT  F+R QT  F  P    +G +SK+RI  D SG    W+L+ V +  D+   ++R  FQC  WL+K+  D   +RE+  A  + +    +T+Y+I   T +   A +  + +I + G+ G S    ++N   K  F  G+        ++LG +  I +G+     K    +  WF+++VI+ + +    + F C   +S        +     K  E +          KYE  + TG+   A T +  ++ +    G   + ++  K  +          F+ G T+   +EL + +  L  +    +  G +  W L  I I     G+   FICG WL  ++ 
Sbjct: 1471 CWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLE-------------DRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFR--FQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNL---------FERGQTNRFILELLD-MGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKA 2005          

HSP 14 Score: 100.908 bits (250), Expect = 1.880e-20
Identity = 95/389 (24.42%), Postives = 172/389 (44.22%), Query Frame = 1
Query: 6379 YKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEV-KTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGE-KNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKF-ILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            Y+V+  T +VK AGT + V V  +GEFG S  + L +  ++   F+ N+ D F     +   ++  C +      F+S W L+ + + ++ +    + + CN WLS  + D    R L+   + NP    + +  Y  +V T D K +G   DV+   +GE  +  ++ ++    D    F R +EDK  +    LG L+ I +G   + N+    S  W    V + ++   + Y F + +W +    I E DG+I           +  +    +   + Y + V+TG   G GT++ + + + G         L  +G   FE+ Q D F +     L  + ++ I HD++     W+ ++V V    T     +PC  W  + +G
Sbjct:   26 YEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHLAS--KSRTAFEKNKTDVF----RIKTHNVGFCNIRLVIYIFAS-WFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLL--GSLNPMDIPK-QNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDN---FERGNEDKFTIEAPNLGRLRKITIG---HNNK--GSSAGW----VIIDDMGNKEVYEFPVDAWFD----ISEGDGKI----------QRDVLAGATQPMAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLEG-GTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEG 377          

HSP 15 Score: 93.5893 bits (231), Expect = 3.725e-18
Identity = 69/257 (26.85%), Postives = 126/257 (49.03%), Query Frame = 1
Query: 6781 YEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKT-YVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI 7548
            YEV  +TGD K AG   +V+   +GE   S K  + +        SR++ +K K T V+  +  N+    +     +++    WF + V V ++      + +   +W+   E      G+   +  ++   N   + +  K     Y   V T    G GTDA+V++ +FGE  ++G+R LV +G++ FE+G EDKF +E  +LG++ KI I H++    + W    V + ++   +++++P + W   S+G  KI
Sbjct:   26 YEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHLASK-------SRTAFEKNK-TDVFRIKTHNVGFCNIRLVIYIFA---SWFLDRVIVTDMNRPHLRFFYACNNWLSREE------GDGLTVRYLLGSLNPMDIPKQNK-----YIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGW----VIIDDMGNKEVYEFPVDAWFDISEGDGKI 256          

HSP 16 Score: 67.781 bits (164), Expect = 2.167e-10
Identity = 43/126 (34.13%), Postives = 61/126 (48.41%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHD--GLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+  V T D KGAGT   ++I+I G   +  R +L K   +           G T  F +   D+GDL  + +EHD  GL P   WLL  +EI N  N    +F C  WL   K DG++ R ++
Sbjct: 1898 VKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNL-------FERGQTNRFILELLDMGDLLRVQVEHDNSGLSP--GWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIY 2014          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Zebrafish
Match: loxhd1a (lipoxygenase homology domains 1a [Source:ZFIN;Acc:ZDB-GENE-091112-20])

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 493/1302 (37.86%), Postives = 749/1302 (57.53%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDN----SVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDK--SQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVI-----RRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            +Y F  +RWL  DE D  +  E+ P++     L   K + Y V V TG+ + +GT+ANVFL I+G+ G S    LK+  +N    +   F E   D+F I  +DLG L+K++IRHDN    A+WYLD V + D  DE  Y FPC  WLA ++D G L +++ P + A  K  +D + +   +Q  + Q+     F ++V T +K YAGTDANV  ILYG  +D+GII LK S  H NKFE G  DEF ++  D+G+LK+IRIGHDN+G +  W L  VEI+A  LGQ   FPC  W+ K K DG + R+LYP    T+   P + YEI   T++    GT+A+V+I +YG+N  CT + +L  N    +   +    D+F V ++D+ D IEKIRIGHDN+G+   WHL++V ++RLL     S    FPC RWLA  EEDG   REL+P  +I     R G++  +   +D      + L+   YT+ V TG     GT+ANVF+ +YG+ GD+GER+L  S+ +++KFE+ ++D F  EAVDLG+VFKI IRHDNS     DW+L+++E++D+   E +LF CERWLS+ ++DK+I R  Y+                             K   H                  I Y  ++ TG ++D  +S   ++ + G  + ++  + L     + F PG+ +  +    DV  IK+VE+ ++G   ES W ++ +++E+PTK   Y   C  WL+K  G+  T+RI ++QD  M N+S+K+ Y ++V+TGDV   GT++ +++ +FG  G S    L K ED FERG  D F LE+ED+  ++K+R++ D +G RP WFL+K+++ N  T+E   F Y E+LS++ G K+ L  ++  + D    ++ T Y V VKTS+  +AGT + V +  +GE GD+G L LK     NK F+  Q D F FPD+LSLG+LS+ ++WH+NSG +  WHLEY+++ +    + ++F C++WL+  +DD QI REL C N  N       +T YE+ V T D  +A    + W V  G+K  S +F++EN+  K+K F R + D+ + +   LG++ +I LG +    +       WF +EV V        Y+F+  + I +  K  E   + F+ +  +E    + + + +    VKYE +V+TG   G GTDANVFIT+FG N +SG+R L +K  NLFE+GQ ++FILE +D+G + ++++EHD+S     W L R+++ N +      + C +WL K+K 
Sbjct:  748 QYMFPSHRWLCKDEADGKVEVEIYPSE----TLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFRE---DEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVD------DALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKSE-NSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNS-MLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYV-----------------------------KVCLH--------------VCMLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRSERLWLDLDGKSAFLPGALDYFTCYGTDVGEIKKVELGHDGATPESCWLVDELTVEVPTKAVRYVFRCKCWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLEDRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNK-FERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACAN--NDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSA-KKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEF--QTFECTKFIE----SFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKA 1981          

HSP 2 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 578/2014 (28.70%), Postives = 945/2014 (46.92%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFA--FKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKF-VIPATCVGPISKIRIRQDESGSKSSWYLDRVCI----TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISF----YTENKPGAGSHADIYIQIFGENGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQS----FICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENT--WMVSIYTSDIKNASTNSKVILVLYGDNGKTDD-IVIPADSKL----DSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI-PATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKG-----QMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVREL-----------------TGTTLLG------KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKIDKT--IPYQITVFTGDVMHAGTDSKVFIQIYGKD-----KKTDQLPLKSKSDTFERGNEDVFKINAADVG-VIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELK--------------YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGET--GTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEW-EAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSK---EVISVEAPDVENIKQVEICNEG--VDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKK-----ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN-FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKN 6315
            Y  +V T D KG+GT   +Y++I G+  +    +L    K N          G+   F I   +LG L  I I H+       W    V I ++ NK ++ F  + W  + + DGK+ R++ A   + +   Y + V+TGD+  +GT+SK+ + + G  G     +LF E    F+R Q   F V     + P+S++ I  D +G    WY ++V +    T L+       F C  W  +D GD    RE+    E++ +  + + K  +    +T +  GAG+ A +++Q++GENG+SD   +++K D F++    +  + +  +G ++K+++ ++   P   W L +V +        + F C +WL D+  +  E I   ++LP    K  Y + I TGN + + T +  Y+ + G   +  ++++    S N +     KF++G  D   VE    L  +  +  G +  G    WFLD +++   + G  ++    F C  WL  +    Q    LV              T++   + ++I T  I  AS++SKV + LYG+ G T+  +++ +D+ L    ++G    F  E   +G   +L   H N G  + W L+ +L+   V+G +Y F  +RWL     D     EI P+    I K   +  Y+V + TG+   AGT+ANVF+ IYGE+G +    L    + +N FE+G     + DEF I  + LG + K+++ HD+K A + W++D+V I++ ++ +    F C  W    E DG   REL                 +G   LG        T+ + VKTG+ + AGTD+NVF  ++G   DTG + LK S  +KNKFE G  D F IEA DIG++K IRI HD+ GA   WF+D + +  P LG    F   +WL    D   +  DL P+++  +  T  +PY+I +FT D+   GTD+ VFI +YG++     +K+  +  + +   FER  ED+F +   D+G +I+KIRIGHD +    GW LD+V                                               + L +  +  E  I    F C RWLA  E+D   +REL+P+D     LS    LK              Y V V TG+ +G+GTDANVF+T++G  GD+GER L  + +NS NKFE  S+D F ++A+DLG + KI+IRHDNS   A WYL+ V V D+  E  +LF C  WL+  ++   + + +F     ++                    L  ++  V T     A T + V++I+ G+ +      L   L   + F  G  D F     D+GE+KK+ +GHD + P + W + ++ +E       +VF C  W++K + DG   R L  Q +  +    K+ YE+T +T + + AGT+  +Y+ V+G    +E+  L    D  + + G  D F + +ED+  P+ K+R+  D  G    W L+K+ +  L  ++  +  YE     WL+R                   G    L   +  V     +++   YT+ V T   T  GT+ANV++ ++GENGD+G   L +S  +T+KFE+   D F + + + LG++ K+ I HDNSG     W L+ +++ D    + + F C+RWL+K++DD +I R L  A   G   +                                         E   Y I + T    D  +    W+ L G K      +     +   F  G+    E  S E  D+ +I    I  +G  V  E+SW+++ + +     G  Y   C   +S    +R   + F     + + +SK      + Y   VITGD    GT++ +F+ +FG+ G+S    L K   N FERG  + F LE+ D+G + ++++++D +G  P W L +++ITN +   +  F   ++L KN
Sbjct:  154 YIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDN-------FERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWACDKVIIDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQPMAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLEGG-TFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQ-----VFPCGRWFDEDEGDGLVERELY---EMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDSFEQAQCDKFIIEMPDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWL-DINEDDQEII---RELPAE-GKLVYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLM--FMSKNNV----NKFEKGNADEFLVEA-VTLGQIRRVRIGHDGRGGGCGWFLDKVMV--REEGQPEASSIEFPCYRWLDRNEDDGQIVRELVP-------------TDDAVGYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGKVEVEIYPSETLEIEK---LINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSE---LIRLKSRSNNFERGTTEIFREDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYF-FPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRV---------------------------------------------EIRRLLRKGKGSETAI----FPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKS-ENS-NKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDR-VFYVKVCLHV-----------------CMLIPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRS-ERLWLDLDGKSAFLPGALDYFTCYGTDVGEIKKVELGHDGATPESCWLVDELTVEVPTKAVRYVFRCKCWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLED--RFERGQVDTFNLEIEDI-APLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYE----EWLSRS-----------------YGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES-NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSG-PAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFD-----------------------------------------EKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPIS-LSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKN 1979          

HSP 3 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 591/2169 (27.25%), Postives = 976/2169 (45.00%), Query Frame = 1
Query:  529 TNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFAFKSV-----RTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI-RGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL--EKILPVKKLPERYQ-KYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQD----WFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDL-SKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFK-----IEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----------------DSKTLEYDLD------PSKIDKIDKTIP--YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK---SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGD-SGERALKNTVDNSVNKFEEKSLDKFLIKAIDLG-TLEKIKIRHDNSNGGAAWYLDYVLV------NDESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVEN---IKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKN--EDNFERGHRDHFKLEMEDVGKIKKI---RIQNDGNGDR--PHWFLEKLDITNESTNESYQF-------------EYNEF-LSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFR 6723
            TN++ +   + Y+V   T DVKGAGT   +++++ G+    P++ L          +        T +F I+  ++G     L+    +    SW L  V + ++    + + + CN+WLS  + DG   R L    +      + KY   V T D   SGTD+ V++++ G  G + + +L  E    F+RG   KF I A  +G + KI I  +  GS + W  D+V I D+ N E  Y F    W     GD    R++  GA + M I     Y +   T +  GAG+++ I++ + G  G  +   +     F EG  FE       +   L  L  L ++ +G+ N G    W+  KV +      L+Q     FPCG+W  + +G+GL   ++  +  L ++ Q K+ + + I T +   A T ++ ++ + G   K     K+ES      ++  F++   D   +E+     P    I  + +  + ++    W L  + +    T  + SF+C  WL  +    + +  ++ +L ++ KL          + V+I T ++  + T++ V L + GD G T + ++       +K + G+  EF  E   +G   ++R  HD  G    W L+K+++ +         +F C RWL  + +D   VRE+  T   +        Y + I TG+   A +D+ VF+ +YGEKGDT    L  S  +  N FE GQ D F IE   +G ++++ +GH ++   +GWF+D V+IW    P + +   F  + W    E DG    E+  +  L     + YEV V TG V  AGT++NVF++I+G+ G +  ++LK   +  N FE G T++F+     I   D+G +K +RI HD+  A ++W++D++ +   K    Y F   +WL                D   ++ D D      P+++    K +   + + V TG+  +AGTD+ VF  +YG    T  + LK+     + FE G  D F I A D+G +++IRIGHD      GWFLD V I+                                        +PS   L +             F C RWL   +DD  IVR+L P + +    +    + Y + + T + F  GTDA+VF+ ++G+NG  + +++L          FE  + D F+++  D+G  +EKI+I HDN      W+LD V +         S+  +FPC  WLA +++ G   +++ P++  + K  +D  L   + ++    ++  + V V T     AGTDANV I LYG+  D+G   L +S  +SNKFE G+ D F ++  DLG++ KIRI HDNS  +ADW+L +VE+  +   + F+F C  W+S+ + D  ++R  Y ++ L +     I Y  +  T + + A T++ VY+ + G+     +    +   KS    G  D F     DV + I+K+ +GHD     S W ++++ V+       K++ Y F C  WLA+D  DG   R L           N       Q   + NI QK  Y + V TG     GT+  +++ V+G  G S E  L   +   D+FE+  +D F  E  D+  + K+ +R D SG  + DWFL KIE+ +   +E   F  E WLS+S                        G  R++       +D                  D    E   YT+++ T      G+    WM ++G       +   +   TN F     +V     PD+ +   + +V I ++       W+L  + +     GK +   C  WL+K   + +  R  +  +    +  +K  Y I V T D+D   T    ++ L G +G S  + L+ +  +  F RG+ D F+   +++G I  I    I  DG   +    WF++++ +T +     Y F             E+  F  +K +      A  L P+       Y+ IV T + K AGT + V +  +G  GDSG  +L     N   F+  Q + FI  ++L +GDL R QV H+NSG S  W L  IE+       +  F C KWL     D +I R
Sbjct:   19 TNHMLSFSSV-YEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHL-------ASKSRTAFEKNKTDVFRIKTHNVGFCNIRLV----IYIFASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLLGSLNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWACDKVIIDDMGNKE-VYEFPVDAWFDISEGDGKIQRDVLAGATQPMAIV----YNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKL-----FLEGGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQV----FPCGRWFDEDEGDGLVERELYEMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQF-KLES------KSDSFEQAQCDKFIIEM-----PDIGKIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWLDIN----EDDQEIIRELPAEGKL---------VYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVRELVPTDDAV-------GYHIAIKTGSINGASSDSKVFVKLYGEKGDTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGLRAGWFLDSVLIWV---PVHGLQYMFPSHRWLCKDEADGKVEVEIYPSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLK---SRSNNFERGTTEIFREDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVDEDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTIEAVDIGKLKRIRIGHDNAGASPGWFLDWVEID----------------------------------------APSLGQLLR-------------FPCGRWLDKGKDDGAIVRDLYPNELQTVLYTPF--VPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAEDMFIVELQDIGDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWLAHSEEDGETIRELVPSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKS-ENSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKREDKRIDRVFYVKVCLHVCML--IPYHFSVTTGSDRDASTSSRVYVIIIGKMHKRSERLWLDLDGKSAFLPGALDYFTCYGTDVGE-IKKVELGHDGATPESCWLVDELTVEV----PTKAVRYVFRCKCWLAKDRGDGLTARIL-----------NV------QDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLE---DRFERGQVDTFNLEIEDIAPLRKMRVRIDASG-SRPDWFLDKIELHNLQTDEVATFTYEEWLSRS-----------------------YGPKRTLICEMPAVID------------------DEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRF--PDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVK------YEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLN--LFERGQTNRFIL-ELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKR 1987          

HSP 4 Score: 553.903 bits (1426), Expect = 1.444e-161
Identity = 413/1348 (30.64%), Postives = 652/1348 (48.37%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGE--TNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELK-KIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNE--TYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLET---NYFAPGSKEVISVEAPDVENIKQVEI--CNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERG-----HRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDI-----------------------KKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNE--TSYEVTVITGDKKNAGMPHDVWFVFYGEKNY--SDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKK----WFCNEVHVKNLAT----LKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVK--------------YEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQ-KGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSK 7533
            R+++ CN WL+ +E D + VR LL +    NP+   K+ KY+  V T +  GSGTDA+V+L IFG+ GD+GER L   V    + FE  + DKF I+A +LG L KI I H+N    A W  D V+++D  ++  Y FP  +W   ++  G + +D+                 +    +Y        NV+V T     AGT++ +H++++G     +SG + L+        FE    D F V+  +L     ++ IGHDN+G N  W+  KV +     G   VFPC  W  + + DG +ERELY  +SL   K+ K  + +   TS+ KGAGT+A V++QVYG N  +++  L + SD  + Q  C D F + M D+   I K+RI H+ +   S WHL +V + + L  +     Y F CNRWL  +E+D  I REL  +                          K  Y + + TG    +GT+A+V+L + G+ GD+GER +  SK + +KFEK N DEF  EAV LG++ ++ I HD  G     WFL K+ + ++   E  +  F C RWL +++DD +I R L            P+                                      + + Y I I TG      S    +++LYG K   TN + L   +    NYF  G  ++ ++E  D+  + ++ I   NEG+   + W+L+S+ I +P  G  Y      WL K   + K      I       + K I Y ++V+TGDV   GTN+ +FLQ++G +G S L  L    +NFERG       D F +   D+G +KK+RI++D       W+L++++I +      Y F    +L+ +     +L  +L P+++                          T + + VKT   K AGT + V    YG   D+G + LK  + +   F++  +DEF   + + +G L R ++ H+N+G S  W L+++E+      +  +FPC +WL    DD  I R+L     PN  +T        YE+ + T D    G   DV+ + YG+     S K +  N  ++   F R++ED      +++ EL++I  G ++ K  +  D++     W  + V ++ L       +T +F  + W+  H    E DGE   I  +V  P+   VE+L + G +K              Y + V TG   G GTDANVFITL+G+  ++G+R L + +  N FE+G  D F LE VDLG++ KI+I HD+S   +DW+L++V+V +  T +I+ + C  WLS+ +
Sbjct:  117 RFFYACNNWLSREEGDGLTVRYLLGS---LNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKL---VSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWACDKVIIDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGAT------------QPMAIVY--------NVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLE-----GGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELYEMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDSFE-QAQC-DKFIIEMPDIG-KIRKLRIWHEKRNPFSGWHLGRVTLMKTLTREK----YSFVCNRWLDINEDDQEIIRELPAEG-------------------------KLVYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGG-GCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNEDDGQIVREL-----------VPT-------------------------------------DDAVGYHIAIKTGSINGASSDSKVFVKLYGEKG-DTNKMLLVVSDNDLGNYFETGQTDIFTIETFDIGKVNRLLIGHTNEGL--RAGWFLDSVLIWVPVHGLQYMFPSHRWLCKDEADGKVE--VEIYPSETLEIEKLINYEVTVVTGDVWAAGTNANVFLQIYGEEGKSELIRLKSRSNNFERGTTEIFREDEFTITGMDLGPLKKLRIRHDNKQANASWYLDRVEIFDTKDETMYFFPCQRWLAVD-EDDGQLGRELVPVDEAFMKRDEDEEEESGPAQLGLEQKAMSTTFTMRVKTGEKKYAGTDANVFAILYGTKDDTGIINLKASKNHKNKFELGLIDEFTI-EAVDIGKLKRIRIGHDNAGASPGWFLDWVEIDAPSLGQLLRFPCGRWLDKGKDDGAIVRDLY----PNELQTVLYTPFVPYEIKIFTTDIFAGGTDADVFIILYGQNGVCTSQKSLCINKRERRMYFERAAED------MFIVELQDI--GDIIEKIRIGHDNRGVNPGWHLDRVEIRRLLRKGKGSETAIFPCERWL-AHS---EEDGET--IRELV--PSDIIVEKLSRDGTLKIIETEVDDALEIHTYTVTVSTGDVYGAGTDANVFITLYGDMGDTGERKLSKSENSNKFERGSVDTFTLEAVDLGQVFKIRIRHDNSMLSADWYLEQVEVLDQDTEEIFLFLCERWLSRKR 1325          

HSP 5 Score: 260.766 bits (665), Expect = 4.334e-69
Identity = 195/596 (32.72%), Postives = 299/596 (50.17%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYV-LVNDESDEYL-FPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVK-CCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKG-----LGSAWHLEKVLV-KRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLY 5451
            RY F C  WLA D  D +  R L   D +   +S  +++ Y V V TG+   +GTD  +++T+FG  G S E  L    D    +FE   +D F ++  D+  L K+++R D S     W+LD + L N ++DE   F    WL+ +       + +    PA+  D              +  +L  + V V T+    AGTDANV +I++GE  D+G + LK+S  ++NKFE    D F+      LGEL K+RI HDNSGP   WHL  V++  + LG+ F F C+ W++K++ DG + REL    +  +    K KYEI   T++   A T  N +I + G+   +++  L N++ K +   G TD F  S +++ D I  I +GH  K      + ++W +++V+V ++ L NK     Y F C         D  I      D+           + I+   S A  L    Y   V TG E   GT+ANVF+ ++G NGDSG RQL   K   + FE+   + F  E +D+G + ++ + HDNSG     W L +IEI +  +  T +F C +WL K+K D +I+R +Y
Sbjct: 1440 RYVFRCKCWLAKDRGDGLTARILNVQDAEMVNIS--QKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLED----RFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGP---KRTLICEMPAVIDD-------------EEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES-NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGD-IASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNK-----YIFRC---------DAPISLSSKRDEF----QTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQL--CKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSG-LSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIY 1990          

HSP 6 Score: 205.297 bits (521), Expect = 3.907e-52
Identity = 169/652 (25.92%), Postives = 302/652 (46.32%), Query Frame = 1
Query: 5614 AYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIK--QVEICNEG--VDRESSWYLNSISIEMPTKGKL-YNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPL-DKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNL--FEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKI--WKYPCNEWLSKSK 7533
             Y +  VTG  K  G+    ++ L+G   +   +         + A  S+        DV  IK   V  CN    +   +SW+L+ + +    +  L +   C  WLS+  G+  T R + +      ++ K+  Y+ SV T D    GT++ ++L +FG  G++    L  + +DNFERG+ D F +E  ++G+++KI I ++  G    W  +K+ I +    E Y+F  + +   + G  K     LA         Y V V T +++ AGT+S + +  +G  G  +SG L L+        F+  Q+D F    +  L  LSR  + H+N+G +  W+ E + +    T     FPC +W    + D  + REL      +  +  + +  + + + T D K AG    V+   YGE   SD+F +E+  D    F ++  DK  +    +G+++ +++      +E  +    W    V +    T + Y F    W++++E     D EI              + EL  +G + Y + + TG  +G GTDA+V++ + G+  ++G+R +     N+  FE+G  D+F++E V LG+I +++I HD       WFLD+V V+     +    ++PC  WL +++
Sbjct:   28 VYEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKV---------HLASKSRTAFEKNKTDVFRIKTHNVGFCNIRLVIYIFASWFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVR-YLLGSLNPMDIPKQNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWACDKVIIDDMGNKEVYEFPVDAWFDISEGDGKIQRDVLAGATQPMAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLE-----GGTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEGDGLVERELY--EMVSLRQKKQKKFPWSLWIFTSDIKGAGTDAQVFLQVYGENGKSDQFKLESKSDS---FEQAQCDKFIIEMPDIGKIRKLRIW-----HEKRNPFSGWHLGRVTLMKTLTREKYSFVCNRWLDINED----DQEI--------------IRELPAEGKLVYRVTICTGNVSGSGTDASVYLNIIGDLGDTGERLMFMSKNNVNKFEKGNADEFLVEAVTLGQIRRVRIGHDGRGGGCGWFLDKVMVREEGQPEASSIEFPCYRWLDRNE 636          

HSP 7 Score: 181.03 bits (458), Expect = 9.045e-45
Identity = 130/411 (31.63%), Postives = 204/411 (49.64%), Query Frame = 1
Query: 3817 YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAI-DLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGH-----DNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWIS-KSKVDGNLERELYPQLSLTMTKRPK---IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP 5013
            Y V VKT +   +GTDANV++ IFG+NGD+G   LK +  N+ NKFE K  D F    I  LG L K++I HDNS     W+L+YV V+D+    ++ F C  WLA N+D G + +++  AN            D   F     D+   + + V T     A T  N  I+L G+   S    L+ S     +F  GN D F+    +LG++  I +GH           A W + +V +  ++LG  ++F C+  IS  SK D     E    +   ++K      +KYE   +T + KGAGT+ANV+I ++G N  + +  L      +  + G T+ F + + D+ D + ++++ HDN GL   W L ++ +     N    +   F C +WL +++ DG I+R + P
Sbjct: 1606 YTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKES--NNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFRFQCDRWLAKNEDDGQIMRELACANN-----------DGVDF-----DEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENS-AKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKF-LNLFERGQTNRFILELLDMGDLL-RVQVEHDNSGLSPGWLLSRIEI----TNTANGVTTIFICGKWLDKNKADGRIKRVIYP 1991          

HSP 8 Score: 132.494 bits (332), Expect = 4.930e-30
Identity = 89/312 (28.53%), Postives = 158/312 (50.64%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG-----AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQ 4611
            ++ F C+RWLA +EDD  I+REL   +  G      ++ KY + V T +   + T  N ++ + GK G S E  L+N+      +F   + D+F   + +LG +  I + H   +G      A+W++D V+V ++   ++Y+F C + ++              +    ++ ++  K  +S     Q      +   V T  +  AGTDANV I ++G   DSG   L +     N FE G  + F ++  D+G+L ++++ HDNSG +  W L+++EI     G + +F C +W+ K+K DG ++R +YP+
Sbjct: 1699 KFRFQCDRWLAKNEDDGQIMRELACANNDGVDFD--EKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKK--KRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPIS------------LSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFL--NLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIYPK 1992          

HSP 9 Score: 130.568 bits (327), Expect = 1.848e-29
Identity = 131/560 (23.39%), Postives = 237/560 (42.32%), Query Frame = 1
Query:  469 CYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRG-----DKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSL-YKEDGKVSRELFAFKSVR-----TKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKE-NTQCFQRGQTSKFVIP-ATCVGPISKIRIRQDESGSKSSWYLDRVCI-TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGA-KEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN---KDGFKEGSIFEHTLPLRQLGTLKKIKVGN-----KNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERY-------QKYKYEMKISTGNRAHASTTSRAYVIL---KGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRP 2049
            C+ +    + L  R  + +    ++   +++Y+V V T DV+ AGT   IY+++ G     ++  LP++               +   G    F +   D+  L  + +  D    +  W L  +E+ N++   +  FT   WLS  Y     +  E+ A          T Y + V T D   +GTD+ V++ + G  G +  + L +  NT  F+R QT  F  P    +G +SK+RI  D SG    W+L+ V +  D+   ++R  FQC  WL+K+  D   +RE+  A  + +    +T+Y+I   T +   A +  + +I + G+ G S    ++N   K  F  G+        ++LG +  I +G+     K    +  WF+++VI+ + +    + F C   +S        +     K  E +          KYE  + TG+   A T +  ++ +    G   + ++  K  +          F+ G T+   +EL + +  L  +    +  G +  W L  I I     G+   FICG WL  ++ 
Sbjct: 1447 CWLAKDRGDGLTARILNVQDAEMVNISQKVIYEVTVLTGDVQHAGTDTQIYMTVFGVYGTSEEMLLPKLE-------------DRFERGQVDTFNLEIEDIAPLRKMRVRIDASGSRPDWFLDKIELHNLQTDEVATFTYEEWLSRSYGPKRTLICEMPAVIDDEEMVELTIYTVSVKTSDATAAGTDANVWMIIFGENGDTGTLTLKESNNTNKFERKQTDVFRFPDILSLGELSKVRIWHDNSGPAPGWHLEYVDVHDDILGKKFR--FQCDRWLAKNEDDGQIMRELACANNDGVDFDEKTKYEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKRFLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNL---------FERGQTNRFILELLD-MGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFICGKWLDKNKA 1981          

HSP 10 Score: 110.153 bits (274), Expect = 2.934e-23
Identity = 96/389 (24.68%), Postives = 175/389 (44.99%), Query Frame = 1
Query: 6379 YKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEV-KTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGE-KNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKF-ILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            Y+V+  T +VK AGT + V V  +GEFG S  + L +  ++   F+ N+ D F     +   ++  C +      F+S W L+ + + ++ +    + + CN WLS  + D    R L+   + NP    + +  Y  +V T D K +G   DV+   +GE  +  ++ ++    D    F R +EDK  +    LG L+ I +G   + N+    S  W C++V + ++   + Y F + +W +    I E DG+I           +  +    +   + Y + V+TG   G GT++ + + + G         L  +G   FE+ Q D F +     L  + ++ I HD++     W+ ++V V    T     +PC  W  + +G
Sbjct:   29 YEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHLAS--KSRTAFEKNKTDVF----RIKTHNVGFCNIRLVIYIFAS-WFLDRVIVTDMNRPHLRFFYACNNWLSREEGDGLTVRYLL--GSLNPMDIPK-QNKYIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDN---FERGNEDKFTIEAPNLGRLRKITIG---HNNK--GSSAGWACDKVIIDDMGNKEVYEFPVDAWFD----ISEGDGKI----------QRDVLAGATQPMAIVYNVQVMTGDIRGAGTNSKIHLVMHGHKGNKNSGKLFLEG-GTFERAQIDIFNVELLELLSPLSRVTIGHDNAGINCGWYCEKVTVYCPFTGLEQVFPCGRWFDEDEG 384          

HSP 11 Score: 102.834 bits (255), Expect = 5.397e-21
Identity = 80/260 (30.77%), Postives = 124/260 (47.69%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEH---DG--LEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSR-------ELFAFKS---VRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            Y++ VTTAD+  A T    +I + G K       L+   K  +         G+T  F     +LGD+ SI + H   DG  ++ + SW +  V +   E    ++F C+  +SL  +  +          E F  K+   V  KYE +VITGD   +GTD+ VFI++ G  G S + QL K+    F+RGQT++F++    +G + ++++  D SG    W L R+ IT+  N     F  C  WL K+  D    R I
Sbjct: 1737 YEILVTTADMDDAETKENAWIVLEGKKGRSKEFVLENSAKKKR------FLRGNTDRFEFSSKELGDIASICLGHIPKDGKKVKVEASWFVDEVIVTEKELGNKYIFRCDAPISLSSKRDEFQTFECTKFIESFISKAQSLVPVKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNLFERGQTNRFILELLDMGDLLRVQVEHDNSGLSPGWLLSRIEITNTANGVTTIFI-CGKWLDKNKADGRIKRVI 1989          

HSP 12 Score: 100.908 bits (250), Expect = 1.971e-20
Identity = 70/257 (27.24%), Postives = 128/257 (49.81%), Query Frame = 1
Query: 6781 YEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKT-YVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI 7548
            YEV  +TGD K AG   +V+   +GE   S K  + +        SR++ +K K T V+  +  N+    +     +++    WF + V V ++      + +   +W+   E      G+   +  ++   N   + +  K     Y   V T    G GTDA+V++ +FGE  ++G+R LV +G++ FE+G EDKF +E  +LG++ KI I H++    + W  D+V + ++   +++++P + W   S+G  KI
Sbjct:   29 YEVVTVTGDVKGAGTDANVFVTLFGEFGVSPKVHLASK-------SRTAFEKNK-TDVFRIKTHNVGFCNIRLVIYIFA---SWFLDRVIVTDMNRPHLRFFYACNNWLSREE------GDGLTVRYLLGSLNPMDIPKQNK-----YIASVFTMDAKGSGTDADVYLNIFGEFGDTGERKLVSEGKDNFERGNEDKFTIEAPNLGRLRKITIGHNNKGSSAGWACDKVIIDDMGNKEVYEFPVDAWFDISEGDGKI 263          

HSP 13 Score: 67.781 bits (164), Expect = 2.022e-10
Identity = 43/126 (34.13%), Postives = 61/126 (48.41%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHD--GLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+  V T D KGAGT   ++I+I G   +  R +L K   +           G T  F +   D+GDL  + +EHD  GL P   WLL  +EI N  N    +F C  WL   K DG++ R ++
Sbjct: 1874 VKYEAIVITGDEKGAGTDANVFITIFGSNGDSGRRQLCKKFLNL-------FERGQTNRFILELLDMGDLLRVQVEHDNSGLSP--GWLLSRIEITNTANGVTTIFICGKWLDKNKADGRIKRVIY 1990          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Xenopus
Match: LOXHD1 (lipoxygenase homology domains 1 [Source:HGNC Symbol;Acc:HGNC:26521])

HSP 1 Score: 931.013 bits (2405), Expect = 0.000e+0
Identity = 518/1267 (40.88%), Postives = 758/1267 (59.83%), Query Frame = 1
Query: 3817 YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQ--FKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVD-SVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQ-KLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKK--WFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTP 7557
            Y V V TG  +G+GTDANV+  I+G+ GD+GER LK    N +NKFE    D F IKA+DLG L+K+KIRHDN    A W+LD V + DE D+  Y FPC  WLA ++D G +++ + P + A  K  +D   D+SQ    + Q+ K   + V + T  K  +GTDANV +ILYGE +D+G + LK S T+ NKFE G  D F V+  D+G L K++IGHDN G +A W L  VEI+A  LGQ   FPC  W+ KS+ DG +ER L+P    T    P + YEIT  TS+   AGT+A+V+I +YGR+  CT++ +L  N    +   +    D F V +EDV D IEKIRIGH +KG+ + WHL++V ++RLL N   S    FPC RWLA+ E+DG   REL+P  +     M     ++ Q++  V + L+   Y+I V+TG    +GT+ANVF+ +YG+ GD+GER+L  S+T+++KFE+  +D+F  EAVDLG ++KI IRHDNS     DW+L+++EI+++   ETYLF CERWLS  K+DKKI+R LY   Y GER +   G S   + GS+ SL SQ + ++                  I Y ITI TG ++  G+    ++ + GP+ ++T  + L    +   FAPGS E  SV   DV  IK++E+ ++GV  ES W ++ I + +P KG +Y   C  W +K  G+  T+R+F++ D     +  KI Y ++V+TGDV  GGT++ +++  FG  G+S    L K +D FERG RD F +E+ D+  +KK+R++ DG G RP W+ E++ + N +T E   F Y +++SK  G++K L+ ++A   D    ++ T Y + VKTS+V  AGT + V +  +GE GD+G L LK    +NK F+ NQ D F FPDMLSLGDL + +VWH+NSG    WHLE+I++K+    +S++F C++WL+   DD QI REL C N  N     + +TSYE+  +T D+ +A    +VW V  G+K  S +F+ME N  K++ F+R + D  K +   LG++  I +G        +S      W   E+ V        YVF   + + +  K    D  +F+ +  +E    +R   L     VKYE++VVTG   G GTDANV + ++G N +SGK  L QK RNLFE+G+ ++F +E +DLG+++K+++EHD+S     W L+RV+V N +T     +PC +WL K +G    W+ L P
Sbjct:  606 YEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKA--NHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKK-EDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKD--GTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIRIRHDNS-MLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSL--GSSSKSFWGSSLSLRSQDNNAN------------VKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEIQLTVPNKGVMYTFVCKCWFAKDRGDGLTARVFNMLDATAITIGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKGDDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMYGDWMSKTKGERKSLSCEMAATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQSNNSNK-FERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACAN--NDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLME-NTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNAKVPLRSK--RDDYRVFECAKAIE-SFASRARSLVP---VKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNLFERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWRELYP 1842          

HSP 2 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 583/1877 (31.06%), Postives = 935/1877 (49.81%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS-KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNG--DEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELT----------------GTTLLG------KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK----TLEYDLDPSKI--DKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKD-----KKTDQLPLKSKSDTFERGNEDVFKINAADVG-VIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKR-SPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTD---EKGNPLSNLKELK-----------YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLD---------KSQFKIYQEDKLEN--------FNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEW-EAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVD-RESS------WYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKK-----ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN-FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVG 6321
            YE+V +TGD+  +GTD+ VF++L G  GI+P+I L  ++   F+R +T  F +    VGP+ KIRI  D +G  + WYLDR  ITD+  P  R++F C NWLSK+ GD   VR++ G+   M +    +Y    +T    G+G+ AD+++ IFGENG++    + N K+ F++GS  + T+    LG ++KI +G+ N G    WFL KVII D+    V+EFPC +WL+  + +G +++ L V           Y + I TG+   A T S+ +VIL G +        ++++ K+++E  +F+ G  D+  +E+   LSPL+ +  G +  G    W+ + ++++CP TGIEQ+F CG+WL         E  L E LS R+ +      ++ W + I+TSD+K+A T++ ++L +YG+ GK+D+I +  +S   ++G V  F   + + G+   +R                  +  AV G  D+  F         + D  T++                 Y+V ++TG    AGTDANV+  IYGE GDTG+R L  +  + NKFE+GQ D F I+AV LG + K+K+ HD+K A +GWF+D+V I +E++ +    F C  W    E DG   R+L                     LG        TY V +KTG  + +GTD+NVF+ ++G+  DTG + LK S TNKNKFE G TD+F +EA DIG +  ++I HD+ G  + WF+D + +  P LG +  F   +WLD      T+E  L PS++  ++    +PY+ITV+T D+  AGTD+ VFI +YG+D     +K+  +  + +   FER + D F +   DVG +I+KIRIGH  K   +GW LD+V                                        I+R  P+ K    ++           F C RWLA  EDD   VREL+P+D   EK      LK+++           Y + V TG+ +GSGTDANVF+TI+G  GD+GER L  +  NS NKFE   +DKF I+A+DLGT+ KI+IRHDNS     WYL+ V + +E  E  YLF C  WL+T K+   + + ++       K++   +L           S   +  +D   N        +++ + T      GT++  ++I+ G                   F  G+ ++F V   D+GE+KK+ +GHD   P + W + ++++     G  + F C  W +K + DG   R      +  +T   KI YE+T VT +    GT+AN+YI  +G +  +E+  L    D  + + G  D F + + D+  P++K+R+  D KG    W+ E++ +K L   +     Y      W+++ +     ER+ L         M A  +  + V++   I+Q K   +        GT+ANVFL ++GENGD+G   L  S  +++KFE+N  D F + + + LG + K+ + HDNSG     W L+ I+I D+  ++++ F C+RWL+K+ DD +I R L  A                    + + LD +                     E  +Y I  VT    D  +    W+ L G K      +     +   FA  + +     + ++ +I  + + +   D R+ S      W++  I +     G  Y   C   +     +R   R+F     + +  S+      + Y + V+TG     GT++ + L ++G+ G+S  + L +   N FERG  + F +E  D+G++KK+R+++D +G  P W LE++++TN +T  +  F   ++L K  G
Sbjct:  138 YEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHLTSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLLGSLNPMDVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNNFEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVG--GSEATGIVYNVAIMTGDIRGAGTDSKIHVILHGEK-------GVKNSGKLFLEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQ----KKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSDNFEAGQVDRF---MHLYGLAVNMR------------------LCLAVQGILDKGSF--------RNLDLHTLKN---------------SYEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKA-NHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYF-FPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRV---------------------------------------EIRRLLPNGKGSQTVT-----------FPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNS-NKFERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYE------KEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEIQLTVPNKGVMYTFVCKCWFAKDRGDGLTARVFNMLDATAITIGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKGDD--RFERGQRDTFVMEIADI-APLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMY----GDWMSKTKG----ERKSLS------CEMAATVDGEEMVETTTYIIQVKTSDV-----SGAGTDANVFLIIFGENGDTGTLALKQS-NNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSG-IGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACA--------------------NNDILDLK---------------------EKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNAKVP-LRSKRDDYRVFECAKAIESFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNLFERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRG 1832          

HSP 3 Score: 556.984 bits (1434), Expect = 2.205e-163
Identity = 425/1491 (28.50%), Postives = 688/1491 (46.14%), Query Frame = 1
Query: 3268 YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDT-FERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCD-LGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLET--NYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQG---NSSLYPLDKNEDN--FERGHRDHFKLEMEDVGK-IKKIRIQNDGNGDRPHWFLEKLDI----TNESTNESYQFEYNEFLSKNVGQKKKL--------------------AIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFREL-------------------------ICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYG-EKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKILT 7554
            Y++   TGDV  AGTD+ VF+ ++G+   T ++ L SKS T FER   DVF++   +VG ++KIRI HD     +GW+LD+ +                                                   I++    ++  Y F CN WL+ ++ D + VR+LL +    NP+   K  KY+  V TG   GSGTDA+VFL IFG+NGD+GER L    DN  N FE+ S DKF I A +LG + KI I H+N  G A W+L+ V++ D  ++  Y FPC  WLA ++D G + +D+                         E     +NV + T     AGTD+ +H+IL+GE    G+    +      +FE G  D F ++    L  L ++ IGHD +G  A W+  KV +     G    FPC  W+   + DG +ERELY  LSL   ++ K  + +   TS+ K AGT+AN+ +QVYG    +++  L+N SD    + G  D F                           HL  + V   L                             L    ++ +GS   L      + ++ N  +   +T  V+     GT+ANV+  +YGE GD+GERQL  +  H +KFE+   D F  +AVDLG++ K+ IRHDN G     WFL ++EI+D+ D+  Y F C+RWL+  +DD +I R L                   +        D  +D S   T   E     T       YT+TI TG +K+ G+    ++ LYG K+  T  + L+  +T  N F  G  +V +VEA D+  + +++I ++     + W+L+ + I+ P+ G+     CG WL K   +    R     +         + Y I+V T D+   GT++ +F+ L+G  G         ++K E    FER   D F +E+EDVG  I+KIRI +   G    W L++++I     N   +++  F    +L+K+    + +                     I++   + ++   Y + V T ++  +GT + V +  YG+ GD+G+ +L   E N+  F+  Q+D+F   + + LG + + ++ H+NS  +  W+LE +E+    T  ++ F C +WLS   +D++I R L                         +     N    SRN   Y +T+ TG  +  G     + +  G +K  +++  ++   DK K F+  S +K  V  + +GE+K ++LG     ++  +    W  +E+ +        Y F  + W          DG    + N+++    A    +  K  + YE+ VVTG     GTDAN++IT FG +  S +  L  KG + FE+GQ D F++E  D+  ++K+++  D    R +W+ +++ ++NL+T +   +   +W+SK+KG  K L+
Sbjct:  138 YEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHLTSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAI---------------------------------------------------ITDMNRPHLRFY-FPCNNWLSKEDGDGLYVRDLLGS---LNPMDVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKL----DNDKNNFEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVGG--------------------SEATGIVYNVAIMTGDIRGAGTDSKIHVILHGE---KGVKNSGKLFLEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSD--NFEAGQVDRFM--------------------------HLYGLAVNMRLC----------------------------LAVQGILDKGSFRNL-----DLHTLKNSYEVHVFTGTVWG---AGTDANVYAAIYGELGDTGERQLKKA-NHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKG-ANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLV-----------------PVDEAFMKKEDEGQDQSQ-ATLGLEQKAKST------TYTVTIKTGDKKNSGTDANVFLILYGEKD-DTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNI-EAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDK-KGFAPGSVEKFSVVGLDVGEIKKMELG-----HDGVTPESCWLVDEIQLTVPNKGVMYTFVCKCWFAKD----RGDGLTARVFNMLD----ATAITIGHK--ILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQL-PKGDDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMYGDWMSKTKGERKSLS 1437          

HSP 4 Score: 537.339 bits (1383), Expect = 9.293e-157
Identity = 449/1603 (28.01%), Postives = 727/1603 (45.35%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKA--NLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSD-LGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKV-IINDLDQSRVFEFPCGQWLS--DVKGEGLEKILPVKK------------------LPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILD-KIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNG---KTDDIVIPADSK---LDSGSVVEFRTELAIVG-IPYKLRAQHDNSGTNSSWNLEKILMTQAV-NGDEYQ---FLCNRWLSDSHEDFSTVREIPATG--------PGIVK--------PAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDG-----LTVRELTGTTL-LGK--------------------------VTYEVEVKTGKVQGAGTDSNVFIRIFG-QTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKW--------LDSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLI-KAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHD-------NSGPNADWHLAKVEIEAEKLGQSFVFPCNEWIS-KSKVDGNLERELYPQLSLTMTKRPK----IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP 5013
            I+Y VA+ T D++GAGT   I++ + G+K   N  ++ L             +   G   IF I  +  L  L  + I HDG      W  + V +          F C HWL + + DG + REL+   S+R K      + + + T D+  +GTD+ + + + G  G S +I+L   N+  F+ GQ  +F+      G    +R+     G         + +  LKN                                        Y++  +T    GAG+ A++Y  I+GE    GE  +    + + F+ G     T+    LG LKK+K+ + N G    WFL++V I+++ D ++ F FPC +WL+  +  G+   +++PV +                  L ++ +   Y + I TG++ ++ T +  ++IL G +     ++ K   TNK      KF+ G TDV  VE  + +  L ++  G +  G +  WFLD + I  P  G    F CG WL  S      E  L    S+ + +  + F    + +++YTSDI  A T++ V +VLYG +G   +   + +    +    +  SV +F  EL  VG I  K+R  H + G ++ W+L+++ + + + NG   Q   F C RWL+ S +D  TVRE+  +          G +K        P     Y + ++TG+   +GTDANVFI IYG+ GDTG+R L+ S TN+NKFE+GQ+D+F IEAV LG I KI++ HD+ +    W++++V I  E     +  F C  W  + + D      L  +E  G  L LG                           + Y + + TG  +  GT+S  ++ I G Q   T  + L     +K  F  G+ + F +   D+GEIK + + HD     S W VD+I + VP  G+ Y F    W        L ++     LD + I  I   I Y++TV TGDV + GTD+ ++I  +G    ++++ L    D FERG  D F +  AD+  ++K+R+  DGK     W+ +++                                                SL  ++ +EE       F+   W++  + +   +   +     G  +  ++   Y++ VKT +  G+GTDANVFL IFG+NGD+G  ALK +  N+ NKFE    D F     + LG L K+++ HDNS  G  W+L+++ + DE  S  + F C  WLA N D   + +++  AN        ++ LD  +   Y+        +   T+ +  A T  NV I+L G+   S    L ++ +   +F     D F+    +LG++  I +GH        +  P+  WH+ ++ +   +LG  +VF CN  +  +SK D     E    +  +   R +    +KYE+  VT   KGAGT+ANV + +YG N  + K  L     ++  + G T+ FY+   D+ + ++K+R+ HDN GL   W LE+V V     N    +   FPC +WL +   DG   REL P
Sbjct:  389 IVYNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFL----------EGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKL-DNNSDNFEAGQVDRFM---HLYGLAVNMRLCLAVQGILDKGSFRNLDLHTLKNS---------------------------------------YEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKANHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYF-FPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNK-----NKFERGQTDVFTVEAVD-IGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFP--SELQTEQYVPFV--PYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVT-EETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLP-KDKKGFAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEIQLTVPNKGVMYTFVCKCWFAKDRGDGLTARVFNM-LDATAI-TIGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKGDDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQI------------------------------------------------SLKNLTTEEETV-----FMYGDWMSKTKGERKSLSCEMAATVDGEEM--VETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQS--NNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACAN--------NDILDLKEKTSYE--------IVTVTSDRDDAETKDNVWIVLEGKKGRSKEF-LMENTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNAKVPLRSKRDDYRVFECAKAIE-SFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKM-RNLFERGKTNRFYIETLDLGE-MKKVRVEHDNSGLSPGWLLERVEV----TNSATGVTTIFPCGKWLDKKRGDGETWRELYP 1842          

HSP 5 Score: 481.871 bits (1239), Expect = 1.966e-138
Identity = 375/1330 (28.20%), Postives = 616/1330 (46.32%), Query Frame = 1
Query:  931 FKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKEN-TQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKE---------------IMGI---ASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKIL-PVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAK-----FKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVI--FCPQTGIEQS--FICGNWLSPSRPGCQTEVSLV----------EDLSKRKLKTVID--FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVR---EIPATGPGI------------------------VKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLEYDLDPSKID--KIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKE-LKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNG-------GAAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQ 4611
              +++  YE+ V TG +  +GTD+ V+ ++ G  G + + QL K N    F+RGQ   F I A  +G + K++IR D  G+ + W+LDRV I D K+ + +YFF C+ WL+ D  D    R++    E                +G+   A  T Y ++  T +K  +G+ A++++ ++GE  ++  +++K    NK+ F+ G     T+    +GTL K+K+G+ N G    WFL+ V I+     +  +FPCG+WL   + +G +E+ L P +   E+Y  +  YE+ + T +   A T +  +++L G        D + +  K    N +     F+    D   VEL +    + +I  G    G +  W LD + I    P     Q+  F C  WL+ S    +T   LV          +D + ++++  ++     +T+ +S++T DI  + T++ V + +YGD G T +  +       +K + G V +F  E   +G  YK+R +HDNS  N  W LE++ +   V  + Y F+C RWLS   ED    R   E    G  +                        VK   I  Y + I TG   + GT++  ++ I G +    +R       +   F  G +++F +  + +G I K++LGHD     S W VD++ +    N     TF C CWF    GDGLT R     + T  T+  K+ YEV V TG V   GTD+N++I  FG +G +  +QL       ++FE G  D F +E  DI  +K +R+  D  G+   W+ +QI +       + +F    W+     + K+L  ++  + +D  ++ +T  Y I V T DV  AGTD+ VF+ I+G++  T  L LK  + S+ FER   DVF+  +   +G + K+R+ HD    G GW                                                      L  I  ++E     + F C+RWLA + DD+ I+REL   +   N + +LKE   Y +   T +   + T  NV++ + GK G S E  ++NT  +   +F   + D F   + +LG +  I + H   +G          W++  ++V +    ++Y+F C +            K    +    Y+ ++  K  +S     +      + V V T  +  AGTDANV +++YG   DSG   LKQ +   N FE G  + F ++  DLGE+KK+R+ HDNSG +  W L +VE+     G + +FPC +W+ K + DG   RELYP+
Sbjct:  599 LHTLKNSYEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKANHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKD-DTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGR-------DGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEIQL-TVPNKGVMYTFVCKCWFAKDRGDGLTARVFNMLDATAITIGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKG---DDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMYGDWMSKTKGERKSLSCEM-AATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQSNNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGW-----------------------------------------------------HLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACAN---NDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENT--SKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNA------------KVPLRSKRDDYRVFECAKAIESFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKM--RNLFERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWRELYPK 1843          

HSP 6 Score: 396.741 bits (1018), Expect = 4.274e-111
Identity = 358/1366 (26.21%), Postives = 604/1366 (44.22%), Query Frame = 1
Query:  403 NLEDYFIRKFSRVLSPHLPLRDCYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF----AF-------------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCGR---TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAK-EIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENG---ESDVIDIKNKDG---FKEGSIFEHTLPLRQLG-TLKKIKVGNKNNGPQPRWFLNKVIINDL----DQSRVFEFPCGQWL--SDVKGEGLEKILPVKKLPERYQK-----------------YKYEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVE--------------------DLSKRKLKTVIDFTENT---WMVSIYTSDIKNASTNSKVILVLYGDNGKTDD---IVIPADSK-LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKI-EAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKID--KTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKINAADVGVIQKIRIGH---DGK----KPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRW--LASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESD--EYLFPCFSWLATNKDGGHLSKDIFP 4167
            N E   + +F  +    + +R C      A +  L   SFR  +  +  +   Y+V V T  V GAGT   +Y +I G+  +    +LKK    NK         G   IF I+  DLG+L+ + I HD       W L  VEI++ ++   + F C  WL++ ++DG+++R+L     AF                   K+  T Y + + TGD  +SGTD+ VF+ L G    TG    ++  K N   F+RGQT  F + A  +G ++K++I  D  G+ + W+LD V I D  +   R  F C  WL K   D    R +  ++ +         Y+I+ YT +   AG+ AD++I ++G +G   +   + +  ++    F+  S+ +  + L  +G  ++KI++G+ + G    W L++V I  L      S+   FPC +WL  S+  GE + +++P     E+  K                 + Y + + TG+   + T +  ++ + G   +  ++ L K E+ +       KF+ G  D   +E  + L  + +I    +    N DW+L+ + I    T     FIC  WLS  +   + E  L E                     LS R      +        + ++I T   +   T S+  +++ G      +   + +P D K    GSV +F      VG   K+   HD     S W +++I +T    G  Y F+C  W +    D  T R         +       Y+V + TG+    GTDAN++I  +G  G + +  L       ++FE+GQ D F++E   +  + K++L  D K +   W+ +++ +        +V F    W   ++G+  ++       + G  ++   TY ++VKT  V GAGTD+NVF+ IFG+ GDTG + LK S  N NKFE   +D+F+  +   +G++  +R+ HD++G G  W ++ I +    +   + F  ++WL    D   +  +L  +  D +D  +   Y+I   T D   A T   V+I + GK  ++ +  ++  SK   F R   D FK ++ ++G I  I +GH   DG+    KP   W + +++                                                   ++E E  N  +Y F CN    L S  DD  +       +   +   +L  +KY V V TG E G+GTDANV L ++G NGDSG+ ALK  + N    FE    ++F I+ +DLG ++K+++ HDNS     W L+ V V + +     +FPC  WL   +  G   ++++P
Sbjct:  560 NFEAGQVDRFMHLYGLAVNMRLCL-----AVQGILDKGSFRNLDLHTLKNS--YEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKANHLNK------FERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFM-NLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEI-DAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSN------KFERGQVDKFNIEAVD-LGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEIQLTVPNKGVMYTFVCKCWFAKDRGDGLTARVFNMLDATAITIGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKG---DDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETV-FMYGDWMSKTKGERKSLSCEMAATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQS-NNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACANNDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEII---------------------------------------------------VTETELGN--KYVFNCNAKVPLRSKRDDYRVFECAKAIESFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNL---FERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWRELYP 1842          

HSP 7 Score: 384.03 bits (985), Expect = 4.296e-107
Identity = 303/1075 (28.19%), Postives = 486/1075 (45.21%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK--YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIP-ATCVGPISKIRIRQDESGSKSSWYLDRVCI----TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYK----ISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLV-------------EDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDR--FLTHSTTNTNKFEKGQMDEFLIEAVKLG-AISKIKLGHDSKLAGSGWFVDKVII---WEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTL---------------------LGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK---------TLEYDLDPSKID------------------------KIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDK-KTDQLPLKSKSDT--FERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            Y   V T    G+GT   ++++I G+  +    +L   K +           GS   F I   +LG +  I I H+       W L+ V I ++ NK ++ F C+ WL++ ++DGK+ R+L    S  T   Y + ++TGD+  +GTDSK+ + L G  G+    +LF E  + F+RG+   F I  A  + P+S++ I  D +G  + WY ++V +    T ++       F C +WL  D GD    RE+    E++ +  + + K    +  +T +   AG+ A+I +Q++GE G+SD I +  N D F+ G + +  + L  L    ++ +  +         L+K    +LD   +                               K  YE+ + TG    A T +  Y  + G E+ D    +++  N +     KF+ G  D+  ++  + L  L ++    +  G N  WFLD + I   +   +  F C  WL+      Q    LV             +D S+  L         T+ V+I T D KN+ T++ V L+LYG+   T  + + A     +K + G    F  E   +G   KL+  HDN GT++ W L+ + +     G   +F C RWL  S +D +  R +  +     +  P   Y++ +YT +   AGTDA+VFI +YG  G    +     +       FE+  +D+F++E   +G  I KI++GH  K   +GW +D+V I         S +VTF C  W   SE DG TVREL  + +                     L   TY + V TG + G+GTD+NVFI I+G  GDTG  +L  S TN NKFE G  D F IEA D+G I  IRI HD++     W+++++ ++       Y+F   +WL +K           E + D  ++                         K    IPY IT+ TG     GT+S+ ++ I G  K +T++L L    D   F  G+ + F +   DVG I+K+ +GHDG  P S W +D++
Sbjct:  267 YVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNN--------FEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVGGSEATGIVYNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFLEGGE-FERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQT-----FPCGHWLDVDEGDGLIERELY---EMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSDNFEAGQV-DRFMHLYGLAVNMRLCLAVQG-------ILDKGSFRNLDLHTL-------------------------------KNSYEVHVFTGTVWGAGTDANVYAAIYG-ELGDTGERQLKKANHL----NKFERGQEDIFTIKAVD-LGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEI 1279          

HSP 8 Score: 236.884 bits (603), Expect = 1.149e-61
Identity = 149/441 (33.79%), Postives = 236/441 (53.51%), Query Frame = 1
Query: 2128 TWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK--LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGD-EYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVREL-TGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIE-AEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLD----SKTLEYDLDP--SKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVF 3417
             + V   T D++ A T++ V + L+G+ G T  I + + S+   +      FR +   VG   K+R +HDN+G N+ W L++ ++T        + F CN WLS    D   VR++  +   +  P  + KY  +++TG    +GTDA+VF+NI+GE GDTG+R L +   + N FEKG  D+F I+A  LG I KI +GH++K   +GWF++KVII E+        F C+ W    E DG   R+L  G +    + Y V + TG ++GAGTDS + + + G+ G   + +L        +FE G  D+F IE A  +  +  + I HD  G G+ W+ +++ V  P  G++  F    WLD       +E +L    S   K  K  P+ + ++T D+  AGTD+ + +Q+YG+  K+D++ L + SD FE G  D F
Sbjct:  137 VYEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHLTSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLLGSLNPMDVP-KMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDN---DKNNFEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVII-EDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVGGSEATGIVYNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKL---FLEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSDNFEAGQVDRF 569          

HSP 9 Score: 191.045 bits (484), Expect = 1.132e-47
Identity = 144/412 (34.95%), Postives = 208/412 (50.49%), Query Frame = 1
Query: 4270 YTTKKMY-----------AGTDANVHIILYGETNDSGIIPLKQSLTHSNK--FESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEI-EAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKI-KYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWE-AVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLY 5451
            Y  KK+Y           AGTDANV + L+GE    GI P K  LT  ++  FE    D F+VK  ++G LKKIRI HDN+G NA W+L +  I +  +    F FPCN W+SK   DG   R+L    SL     PK+ KY     T    G+GT+A+V++ ++G N  T +  L+N  DK+  + G  D F +   ++   I KI IGH+NKG  + W LEKV+++ +    NK++ YEFPC+RWLA DE+DG I+R+LL       G   A G                 Y + + TG     GT++ + + ++GE G     +L        +FE+  +D F  E A  L  + ++ I HD +G     W+ +K+ +   F      F C  WL   + D  I+R LY
Sbjct:  132 YNKKKVYEVVTVTGDVRGAGTDANVFVTLFGEF---GITP-KIHLTSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLLG--SLNPMDVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDN--DKNNFEKGSEDKFTIDAPNLG-KIRKITIGHNNKGGSAGWFLEKVIIEDI---GNKTV-YEFPCSRWLAIDEDDGKIQRDLLV------GGSEATG---------------IVYNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLF---LEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGV-GAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELY 505          

HSP 10 Score: 165.622 bits (418), Expect = 6.440e-40
Identity = 126/468 (26.92%), Postives = 222/468 (47.44%), Query Frame = 1
Query: 5992 SKKITYLISVITGDVDQGGTNSTLFLQLFGTQG-NSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITN-ESTNESYQFEYNEFLSKNVGQK---KKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNI--KLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFI 7374
            +KK  Y +  +TGDV   GT++ +F+ LFG  G    ++   K+   FER   D F+++  +VG +KKIRI++D  G    W+L++  IT+    +  + F  N +LSK  G     + L   L P++  K   Y   V T     +GT + V +  +GE GD+G+ +L   + N   F+    D+F   D  +LG + +  + HNN G S+ W LE + ++++  +  ++FPC++WL++ +DD +I R+L+   +            Y V ++TGD + AG    +  + +GEK   +           KLF    E +R    ++  E+  +   L  V   ++       W+C +V V    T     F    W++V E     + E++++ ++ +   K             + + + T      GTDAN+ + ++GE  +S +  L     N FE GQ D+F+
Sbjct:  133 NKKKVYEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHLTSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLLGSLNPMDVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNN---FEKGSEDKFTI-DAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVGGS------EATGIVYNVAIMTGDIRGAGTDSKIHVILHGEKGVKNS---------GKLFLEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQKKH----------PWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSDN-FEAGQVDRFM 570          

HSP 11 Score: 159.073 bits (401), Expect = 6.477e-38
Identity = 123/432 (28.47%), Postives = 207/432 (47.92%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEI--MNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSV-----RTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG-FKEGSIFEHTLPLRQ-LGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEG-----LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIK 1797
            +Y+V   T DV+GAGT   +++++ G+    P+I L          +        T +F ++ +++G L+ I IEHD       W L    I  MN  + R + F CN+WLS    DG   R+L    +        KY   V TG  + SGTD+ VF+++ G  G + + +L  +    F++G   KF I A  +G I KI I  +  G  + W+L++V I D+ N    Y F C  WL+ D  D    R++  G  E  GI     Y ++  T +  GAG+ + I++ + GE G  +   +  + G F+ G I    + +   L  L ++ +G+  NG    W+  KVI+      ++Q+    FPCG WL   +G+G     L ++L +++  +R +K+ + + I T +   A T +   + + G + K
Sbjct:  137 VYEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHL-------TSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFY-FPCNNWLSKEDGDGLYVRDLLGSLNPMDVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNN-FEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKT-VYEFPCSRWLAIDEDDGKIQRDLLVGGSEATGIV----YNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFLEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQT----FPCGHWLDVDEGDGLIERELYEMLSLRQ--KRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGK 548          

HSP 12 Score: 157.147 bits (396), Expect = 2.495e-37
Identity = 120/433 (27.71%), Postives = 205/433 (47.34%), Query Frame = 1
Query: 5614 AYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLN-SISIEMPTKGKLYNVTCGVWLSKFMGERKTSR-IFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVD 6900
             Y +  VTG  +  G+    ++ L+G   + T  I L       F     +V  V+  +V  +K++ I ++     + WYL+ +I  +M      +   C  WLSK  G+    R +    + M  +V K   Y+  V TG  +  GT++ +FL +FG  G++    LD +++NFE+G  D F ++  ++GKI+KI I ++  G    WFLEK+ I +      Y+F  + +L+ +    K     L   ++     Y V + T +++ AGT S + V  +GE G  +SG L L+  E     F+  ++D F       L  LSR  + H+ +G  + W+ E + +    T     FPC  WL + + D  I REL      +  +  + +  + + + T D K+AG   ++    YGEK  SD+  ++NN D
Sbjct:  137 VYEVVTVTGDVRGAGTDANVFVTLFGEFGI-TPKIHLTSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLLGSLNPM--DVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNNFEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVGGSEATGIVYNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFLEGGE-----FERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELY--EMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSD 559          

HSP 13 Score: 150.984 bits (380), Expect = 1.774e-35
Identity = 82/219 (37.44%), Postives = 132/219 (60.27%), Query Frame = 1
Query: 2884 KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVI-VPKLGLKYIFFLNKWLDS--------KTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVL 3513
            K  YEV   TG V+GAGTD+NVF+ +FG+ G T  + L +   ++  FE   TD+F+++  ++G +K IRI HD+TG  + W++D+  +  + +  L++ F  N WL          + L   L+P  + K++K   Y   VFTG    +GTD+ VF+ I+G++  T +  L +  + FE+G+ED F I+A ++G I+KI IGH+ K   +GWFL+KV+
Sbjct:  135 KKVYEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHLTSK--SRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLLGSLNPMDVPKMNK---YVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNNFEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVI 348          

HSP 14 Score: 131.724 bits (330), Expect = 1.411e-29
Identity = 105/392 (26.79%), Postives = 185/392 (47.19%), Query Frame = 1
Query: 6367 KKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEV-KTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDL-GKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            KK  Y+V+  T +V+ AGT + V V  +GEFG +  + L +  ++   F+ ++ D F      ++G L + ++ H+N+G ++ W+L+   + ++ +    + FPCN WLS  D D    R+L+   + NP    +    Y   V TG    +G   DV+   +GE   + +  ++N+ +    F + SEDK  +    LG+++ I +G   + N+    S  WF  +V ++++     Y F    W+     I E DG+I              V   +  G+V Y + ++TG   G GTD+ + + L GE        L  +G   FE+G+ D F +E   L   + ++ I HD +   + W+ ++V V    T     +PC  WL   +G
Sbjct:  134 KKKVYEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHLTS--KSRTAFERSKTDVFRVKTN-NVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLL--GSLNPMDVPKM-NKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNN---FEKGSEDKFTIDAPNLGKIRKITIG---HNNK--GGSAGWFLEKVIIEDIGNKTVYEFPCSRWL----AIDEDDGKI---------QRDLLVGGSEATGIV-YNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFLEGGE-FERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEG 496          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Xenopus
Match: LOXHD1 (lipoxygenase homology domains 1 [Source:HGNC Symbol;Acc:HGNC:26521])

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 522/1325 (39.40%), Postives = 763/1325 (57.58%), Query Frame = 1
Query: 3817 YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSL--------------------------------------------DKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQ--FKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVD-SVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGER-----------SNAPSGRSRSIYSG--SANSLD-SQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQ-KLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKK--WFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTP 7557
            Y V V TG  +G+GTDANV+  I+G+ GD+GER LK    N +NKFE   +                                            D F IKA+DLG L+K+KIRHDN    A W+LD V + DE D+  Y FPC  WLA ++D G +++ + P + A  K  +D   D+SQ    + Q+ K   + V + T  K  +GTDANV +ILYGE +D+G + LK S T+ NKFE G  D F V+  D+G L K++IGHDN G +A W L  VEI+A  LGQ   FPC  W+ KS+ DG +ER L+P    T    P + YEIT  TS+   AGT+A+V+I +YGR+  CT++ +L  N    +   +    D F V +EDV D IEKIRIGH +KG+ + WHL++V ++RLL N   S    FPC RWLA+ E+DG   REL+P  +     M     ++ Q++  V + L+   Y+I V+TG    +GT+ANVF+ +YG+ GD+GER+L  S+T+++KFE+  +D+F  EAVDLG ++KI IRHDNS     DW+L+++EI+++   ETYLF CERWLS  K+DKKI+R LY   Y GER            ++ S RS+   +   S NSLD SQ+DG+                   I Y ITI TG ++  G+    ++ + GP+ ++T  + L    +   FAPGS E  SV   DV  IK++E+ ++GV  ES W ++ I + +P KG +Y   C  W +K  G+  T+R+F++ D     +  KI Y ++V+TGDV  GGT++ +++  FG  G+S    L K +D FERG RD F +E+ D+  +KK+R++ DG G RP W+ E++ + N +T E   F Y +++SK  G++K L+ ++A   D    ++ T Y + VKTS+V  AGT + V +  +GE GD+G L LK    +NK F+ NQ D F FPDMLSLGDL + +VWH+NSG    WHLE+I++K+    +S++F C++WL+   DD QI REL C N  N     + +TSYE+  +T D+ +A    +VW V  G+K  S +F+ME N  K++ F+R + D  K +   LG++  I +G        +S      W   E+ V        YVF   + + +  K    D  +F+ +  +E    +R   L     VKYE++VVTG   G GTDANV + ++G N +SGK  L QK RNLFE+G+ ++F +E +DLG+++K+++EHD+S     W L+RV+V N +T     +PC +WL K +G    W+ L P
Sbjct:  478 YEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKA--NHLNKFERGQVCPRCGCIRCNRAACWRPLSYPLTWASVTFPGLLTLLLNSIFLQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKK-EDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKD--GTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIRIRHDNS-MLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNSLDGSQQDGT------------------LIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEIQLTVPNKGVMYTFVCKCWFAKDRGDGLTARVFNMLDATAITIGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKGDDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMYGDWMSKTKGERKSLSCEMAATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQSNNSNK-FERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACAN--NDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLME-NTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNAKVPLRSK--RDDYRVFECAKAIE-SFASRARSLVP---VKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNLFERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWRELYP 1768          

HSP 2 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 587/1930 (30.41%), Postives = 936/1930 (48.50%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS-KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATG-PGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQM--------------------------------------------DEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELT----------------GTTLLG------KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK----TLEYDLDPSKI--DKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKD-----KKTDQLPLKSKSDTFERGNEDVFKINAADVG-VIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKR-SPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTD---EKGNPLSNLKELK-----------YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPA---------------------------NPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEW-EAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVD-RESS------WYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKK-----ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN-FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVG 6321
            YE+V +TGD+  +GTD+ VF++L G  GI+P+I L  ++   F+R +T  F +    VGP+ KIRI  D +G  + WYLDR  ITD+  P  R++F C NWLSK+ GD   VR++ G+   M +    +Y    +T    G+G+ AD+++ IFGENG++    + N K+ F++GS  + T+    LG ++KI +G+ N G    WFL KVII D+    V+EFPC +WL+  + +G +++ L V           Y + I TG+   A T S+ +VIL G +        ++++ K+++E  +F+ G  D+  +E+   LSPL+ +  G +  G    W+ + ++++CP TGIEQ+F CG+WL         E  L E LS R+ +      ++ W + I+TSD+K+A T++ ++L +YG+ GK+D+I +  +S   ++G V  F                    G+ + +N E+                       H+D  +   +P  G  G+     +  Y+V ++TG    AGTDANV+  IYGE GDTG+R L  +  + NKFE+GQ+                                            D F I+AV LG + K+K+ HD+K A +GWF+D+V I +E++ +    F C  W    E DG   R+L                     LG        TY V +KTG  + +GTD+NVF+ ++G+  DTG + LK S TNKNKFE G TD+F +EA DIG +  ++I HD+ G  + WF+D + +  P LG +  F   +WLD      T+E  L PS++  ++    +PY+ITV+T D+  AGTD+ VFI +YG+D     +K+  +  + +   FER + D F +   DVG +I+KIRIGH  K   +GW LD+V                                        I+R  P+ K    ++           F C RWLA  EDD   VREL+P+D   EK      LK+++           Y + V TG+ +GSGTDANVF+TI+G  GD+GER L  +  NS NKFE   +DKF I+A+DLGT+ KI+IRHDNS     WYL+ V + +E  E  YLF C  WL+T K+   + + ++                             N A  K    N LD SQ    Q+  L  +++ + T      GT++  ++I+ G                   F  G+ ++F V   D+GE+KK+ +GHD   P + W + ++++     G  + F C  W +K + DG   R      +  +T   KI YE+T VT +    GT+AN+YI  +G +  +E+  L    D  + + G  D F + + D+  P++K+R+  D KG    W+ E++ +K L   +     Y      W+++ +     ER+ L         M A  +  + V++   I+Q K   +        GT+ANVFL ++GENGD+G   L  S  +++KFE+N  D F + + + LG + K+ + HDNSG     W L+ I+I D+  ++++ F C+RWL+K+ DD +I R L  A                    + + LD +                     E  +Y I  VT    D  +    W+ L G K      +     +   FA  + +     + ++ +I  + + +   D R+ S      W++  I +     G  Y   C   +     +R   R+F     + +  S+      + Y + V+TG     GT++ + L ++G+ G+S  + L +   N FERG  + F +E  D+G++KK+R+++D +G  P W LE++++TN +T  +  F   ++L K  G
Sbjct:   10 YEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHLTSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLLGSLNPMDVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNNFEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVGG--SEATGIVYNVAIMTGDIRGAGTDSKIHVILHGEK-------GVKNSGKLFLEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQ----KKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSDNFEAGQVDRFM-------------------GSPTFFNHEQ-----------------------HKDKKSPV-VPNKGYGGLFGSTCMDCYEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKA-NHLNKFERGQVCPRCGCIRCNRAACWRPLSYPLTWASVTFPGLLTLLLNSIFLQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYF-FPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRV---------------------------------------EIRRLLPNGKGSQTVT-----------FPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNS-NKFERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVK--SRNSLDGSQ----QDGTLIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEIQLTVPNKGVMYTFVCKCWFAKDRGDGLTARVFNMLDATAITIGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKGDD--RFERGQRDTFVMEIADI-APLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMY----GDWMSKTKG----ERKSLS------CEMAATVDGEEMVETTTYIIQVKTSDV-----SGAGTDANVFLIIFGENGDTGTLALKQS-NNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSG-IGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACA--------------------NNDILDLK---------------------EKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNAKVP-LRSKRDDYRVFECAKAIESFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNLFERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRG 1758          

HSP 3 Score: 453.366 bits (1165), Expect = 2.153e-129
Identity = 373/1377 (27.09%), Postives = 613/1377 (44.52%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKEN-TQCFQRGQTSK--------------------------------------------FVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKE---------------IMGI---ASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKIL-PVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAK-----FKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVI--FCPQTGIEQS--FICGNWLSPSRPGCQTEVSLV----------EDLSKRKLKTVID--FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVR---------EIPATGP----------------------------GIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLEYDLDPSKID--KIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKE-LKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNG-------GAAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQ 4611
            YE+ V TG +  +GTD+ V+ ++ G  G + + QL K N    F+RGQ                                               F I A  +G + K++IR D  G+ + W+LDRV I D K+ + +YFF C+ WL+ D  D    R++    E                +G+   A  T Y ++  T +K  +G+ A++++ ++GE  ++  +++K    NK+ F+ G     T+    +GTL K+K+G+ N G    WFL+ V I+     +  +FPCG+WL   + +G +E+ L P +   E+Y  +  YE+ + T +   A T +  +++L G        D + +  K    N +     F+    D   VEL +    + +I  G    G +  W LD + I    P     Q+  F C  WL+ S    +T   LV          +D + ++++  ++     +T+ +S++T DI  + T++ V + +YGD G T +  +       +K + G V +F  E   +G  YK+R +HDNS  N  W LE++ +   V  + Y F+C RWLS   ED    R         E  + G                             G  +   +  Y + I TG   + GT++  ++ I G +    +R       +   F  G +++F +  + +G I K++LGHD     S W VD++ +    N     TF C CWF    GDGLT R     + T  T+  K+ YEV V TG V   GTD+N++I  FG +G +  +QL       ++FE G  D F +E  DI  +K +R+  D  G+   W+ +QI +       + +F    W+     + K+L  ++  + +D  ++ +T  Y I V T DV  AGTD+ VF+ I+G++  T  L LK  + S+ FER   DVF+  +   +G + K+R+ HD    G GW                                                      L  I  ++E     + F C+RWLA + DD+ I+REL   +   N + +LKE   Y +   T +   + T  NV++ + GK G S E  ++NT  +   +F   + D F   + +LG +  I + H   +G          W++  ++V +    ++Y+F C +            K    +    Y+ ++  K  +S     +      + V V T  +  AGTDANV +++YG   DSG   LKQ +   N FE G  + F ++  DLGE+KK+R+ HDNSG +  W L +VE+     G + +FPC +W+ K + DG   RELYP+
Sbjct:  478 YEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKANHLNKFERGQVCPRCGCIRCNRAACWRPLSYPLTWASVTFPGLLTLLLNSIFLQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKD-DTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGR-------DGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNSLDGSQQDGTLIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEIQL-TVPNKGVMYTFVCKCWFAKDRGDGLTARVFNMLDATAITIGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKG---DDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMYGDWMSKTKGERKSLSCEM-AATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQSNNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGW-----------------------------------------------------HLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACAN---NDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENT--SKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNA------------KVPLRSKRDDYRVFECAKAIESFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKM--RNLFERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWRELYPK 1769          

HSP 4 Score: 382.104 bits (980), Expect = 1.198e-106
Identity = 332/1267 (26.20%), Postives = 566/1267 (44.67%), Query Frame = 1
Query:  730 IFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF----AF-------------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCGR---TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAK-EIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENG---ESDVIDIKNKDG---FKEGSIFEHTLPLRQLG-TLKKIKVGNKNNGPQPRWFLNKVIINDL----DQSRVFEFPCGQWL--SDVKGEGLEKILPVKKLPERYQK-----------------YKYEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVE--------------------DLSKR--------KLKTVIDFTEN-----TWMVSIYTSDIKNASTNSKVILVLYGDNGKTDD---IVIPADSK-LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKI-EAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKID--KTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKINAADVGVIQKIRIGH---DGK----KPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRW--LASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESD--EYLFPCFSWLATNKDGGHLSKDIFP 4167
            IF I+  DLG+L+ + I HD       W L  VEI++ ++   + F C  WL++ ++DG+++R+L     AF                   K+  T Y + + TGD  +SGTD+ VF+ L G    TG    ++  K N   F+RGQT  F + A  +G ++K++I  D  G+ + W+LD V I D  +   R  F C  WL K   D    R +  ++ +         Y+I+ YT +   AG+ AD++I ++G +G   +   + +  ++    F+  S+ +  + L  +G  ++KI++G+ + G    W L++V I  L      S+   FPC +WL  S+  GE + +++P     E+  K                 + Y + + TG+   + T +  ++ + G   +  ++ L K E+ +       KF+ G  D   +E  + L  + +I    +    N DW+L+ + I    T     FIC  WLS  +   + E  L E                     LS R        K +  +D ++       + ++I T   +   T S+  +++ G      +   + +P D K    GSV +F      VG   K+   HD     S W +++I +T    G  Y F+C  W +    D  T R         +       Y+V + TG+    GTDAN++I  +G  G + +  L       ++FE+GQ D F++E   +  + K++L  D K +   W+ +++ +        +V F    W   ++G+  ++       + G  ++   TY ++VKT  V GAGTD+NVF+ IFG+ GDTG + LK S  N NKFE   +D+F+  +   +G++  +R+ HD++G G  W ++ I +    +   + F  ++WL    D   +  +L  +  D +D  +   Y+I   T D   A T   V+I + GK  ++ +  ++  SK   F R   D FK ++ ++G I  I +GH   DG+    KP   W + +++                                                   ++E E  N  +Y F CN    L S  DD  +       +   +   +L  +KY V V TG E G+GTDANV L ++G NGDSG+ ALK  + N    FE    ++F I+ +DLG ++K+++ HDNS     W L+ V V + +     +FPC  WL   +  G   ++++P
Sbjct:  572 IFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFM-NLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEI-DAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSN------KFERGQVDKFNIEAVD-LGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNSLDGSQQDGTLIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEIQLTVPNKGVMYTFVCKCWFAKDRGDGLTARVFNMLDATAITIGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKG---DDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETV-FMYGDWMSKTKGERKSLSCEMAATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQS-NNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACANNDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEII---------------------------------------------------VTETELGN--KYVFNCNAKVPLRSKRDDYRVFECAKAIESFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNL---FERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWRELYP 1768          

HSP 5 Score: 351.288 bits (900), Expect = 5.422e-97
Identity = 307/1093 (28.09%), Postives = 499/1093 (45.65%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK-------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLF----KENTQCFQRGQTSKFVIPATCVGP-ISKIRIRQDESGSKSSWYLDRVCITDL---KNPEWRYFFQCKNWLSKDHGDHATVREIRGAK-----------------EIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGE-GLEKILPVKK-------------------LPERYQK--------------------YKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFT-------DVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSR-PGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIP-ADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSH-EDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEF-LIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTT-----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISH--DDTGAGSA-----WFVDQICVIVPKLGLKYIFFLNKW--LDSKTLEYDL------DPSKIDKIDKTIP--YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK-SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            Y V + T D K +GT   +++ + G+K +   + LK  K +  K        G T +F +   D+G L  + I HD       W L  VEI      +   F C  WL   ++DG + R LF    ++T+       YEI V T D+  +GTD+ VFI L GR G+  Q +      +E    F+R    +F++    VG  I KIRI   + G  + W+LDRV I  L           F C+ WL+K   D  TVRE+  +                  E+        Y IS +T +  G+G+ A+++I I+G+ G++    +     N + F+ G + +  +    LGT+ KI++ + N+   P W+L +V I +      + F C +WLS  K +  +E+IL  K+                   L  R Q                       Y + I+TG      T SRAYVI+ GP+       KI  T ++W++  K K+GF         VV +++ E    + ++  G +       W +D+I +  P  G+  +F+C  W +  R  G    V  + D +   +   I      + V++ T D+ N  T++ + +  +G +G ++++ +P  D + + G    F  E+A +    K+R + D  G+   W  E+I +      +E  F+   W+S +  E  S   E+ AT  G  +      Y +Q+ T +   AGTDANVF+ I+GE GDTG   L  S  N+NKFE+ Q D F   + + LG + K+++ HD+   G GW ++ + I +++  S S  F+C+ W   +  D   +REL         L  K +YE+   T     A T  NV+I + G+ G +    ++ + + K +F   ATD FK  ++++G+I +I + H   D    S      W V +I V   +LG KY+F  N    L SK  +Y +        S   +    +P  Y++ V TG    AGTD+ V + +YG +  + +  LK K  + FERG  + F I   D+G ++K+R+ HD      GW L++V
Sbjct:  669 YTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNK-----FERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFP-SELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNSLDGSQQDGTLIPYHITITTGLDRVGGTESRAYVIIMGPQ-------KIR-TERLWLDLPKDKKGFAPGSVEKFSVVGLDVGE----IKKMELGHDGVTPESCWLVDEIQLTVPNKGVMYTFVCKCWFAKDRGDGLTARVFNMLDATAITIGHKI-----LYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKGDDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMYGDWMSKTKGERKSLSCEMAATVDG-EEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQS-NNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDI-KDETMSKSFRFQCDRWLAKNADDHQIIRELACANNDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENT-SKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNAKVPLRSKRDDYRVFECAKAIESFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNLFERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERV 1734          

HSP 6 Score: 245.358 bits (625), Expect = 3.059e-64
Identity = 220/838 (26.25%), Postives = 370/838 (44.15%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFK--------------------SVRTK-----------------------YEIVVITGDLDDSGTDSKVFISLCGRTGI-SPQIQL-FKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR--EIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLP-----ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENT-WMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK-----LDSGSVVEFRT----ELAIVGIPYKLR-AQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCN-----RWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT--FRCNCWFDSSEGDGLTVREL 2862
            Y ++V T D+ G+GT   ++I+I GD  +    +L K + ++ K        G    F I   DLG +  I I HD       W L+ VEI+N   +  +LF C  WLS  KED K+ R L+  +                    S+R++                       Y I + TG     GT+S+ ++ + G   I + ++ L   ++ + F  G   KF +    VG I K+ +  D    +S W +D + +T + N    Y F CK W +KD GD  T R   +  A  I  I  +  Y+++  T + P  G+ A+IYI  FG +G S+ + + K  D F+ G      + +  +  LKK+++     G +P W+  ++ + +L       F  G W+S  KGE   K L  +        E  +   Y +++ T + + A T +  ++I+ G       L   +S N     + KF+   +DV        L  L ++    +  G    W L+ I I          F C  WL+ +    Q    ++ +L+      ++D  E T + +   TSD  +A T   V +VL G  G++ + ++   SK      D+    +F +    ++A + + +  +  +  +   +  W++++I++T+   G++Y F CN     R   D +  F   + I +         P+ KY+V + TG +  AGTDANV + +YG  GD+G   L     N   FE+G+ + F IE + LG + K+++ HD+     GW +++V   E  N +  VT  F C  W D   GDG T REL
Sbjct:  954 YSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNK-----FERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNSLDGSQQDGTLIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEIQLT-VPNKGVMYTFVCKCWFAKDRGDGLTARVFNMLDATAIT-IGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKGDDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMYGDWMSKTKGE--RKSLSCEMAATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQSNN-----SNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQ----IIRELACAN-NDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNAKVPLRSKRDDYRVFECAKAIESFASRARSLVPV-KYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNL--FERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERV---EVTNSATGVTTIFPCGKWLDKKRGDGETWREL 1766          

HSP 7 Score: 218.009 bits (554), Expect = 6.003e-56
Identity = 179/673 (26.60%), Postives = 303/673 (45.02%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRG-DKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSV------RTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR-EIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK---NKDGFKEGSIFEHTLP-LRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG---LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQD-----------WFLDDIVIFCPQTGIEQSFICGNWLSPSRPG--------CQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK--LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI 2466
            I Y + +TT   +  GT    Y+ I G  K    R+ L  PK            PGS + F +   D+G+++ + + HDG+ P+  WL+  +++       ++ F C  W +  + DG  +R      +       +  YE+ V+TGD+ + GTD+ ++I+  G +G S ++QL K + + F+RGQ   FV+    + P+ K+R+R D  GS+  WY +++ + +L   E    F   +W+SK  G+  ++  E+    +   +   T Y I   T +  GAG+ A++++ IFGENG++  + +K   N + F+         P +  LG L K++V + N+G  P W L  + I D   S+ F F C +WL+    +     E       + +  +K  YE+   T +R  A T    +++L+G + + K    +E+T+K      +F    TD          S     IA I VG   +D           W + +I++   + G +  F C N   P R          C      +E  + R    V       + V + T   K A T++ V LV+YG NG +    +    +   + G    F  E   +G   K+R +HDNSG +  W LE++ +T +  G    F C +WL     D  T RE+
Sbjct: 1120 IPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKG------FAPGSVEKFSVVGLDVGEIKKMELGHDGVTPESCWLVDEIQLTVPNKGVMYTFVCKCWFAKDRGDGLTARVFNMLDATAITIGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKGDDR-FERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEE-ETVFMYGDWMSKTKGERKSLSCEMAATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQSNNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACANNDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEF-LMENTSK----KRRFARDATDTFKFS-----SKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNC-NAKVPLRSKRDDYRVFEC---AKAIESFASRARSLV----PVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNLFERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWREL 1766          

HSP 8 Score: 207.223 bits (526), Expect = 1.181e-52
Identity = 222/866 (25.64%), Postives = 376/866 (43.42%), Query Frame = 1
Query: 5077 VANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYL---FHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQG--NSSLYPLDKNEDNFERGHRDHFKLEMEDV-GKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVG----QKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFI----FPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDD--RQIFREL------ICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNV-DKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHE-------KIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL--VQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTPSE 7563
            +A   Q   Y +   TG     GT+ANVF+ ++GE G + +  L  SK+ T  FE++  D F  +  ++G + KI I HDN+G     W+L +  I D   N  +L   F C  WLSK   D    R L                      GS N +D  K                    +Y+A    + TG     G+    ++ ++G +N  T   +L   + N F  GS++  +++AP++  I+++ I +      + W+L  + IE      +Y   C  WL+    + K  R   +     T     I Y ++++TGD+   GT+S + + L G +G  NS    L+  E  FERG  D F +E+  +   + ++ I +DGNG    W+ EK+ +    T     F    +L  + G    +++   +        KK  + + + TS++KSAGT + + ++ YGE G S +++L   + N+  F+  Q+D F+    F +     D     V   N G+   +    ++  EV       F    W + TD +    I+ EL        + A +  K  R +       I  ++     P      +          ++ N++  +E +F+        +  V LGELK +K+     +++    +  WF + V + +      Y F  Q W+ V E       ++   D       +  +D ++A +   +K     Y + + TG     GTDANVF+ L+GE  ++G   L   +  +N FE+GQ D F +E VD+G + K+KI HD+    + WFLD V++   S  +  K+PC  WL KS+    + + L PSE
Sbjct:    1 MAPTHQYYIYEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHLT-SKSRT-AFERSKTDVFRVKTNNVGPLKKIRIEHDNTGM-NAGWYLDRAIITDM--NRPHLRFYFPCNNWLSKEDGDGLYVRDLL---------------------GSLNPMDVPK------------------MNKYVA---RVFTGAANGSGTDADVFLNIFG-ENGDTGERKLDN-DKNNFEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVGGSEATG----IVYNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFLEGGE--FERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKL---DNNSDNFEAGQVDRFMGSPTFFNHEQHKDKKSPVV--PNKGYGGLFGSTCMDCYEVHV-----FTGTVWGAGTDANVYAAIYGELGDTGERQLKKANHLNKFERGQVCPRCGCIRCNRAACWRPLSYPLTWASVTFPGLLTLLLNSIFLQEDIFT--------IKAVDLGELKKLKI-----RHDNKGANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSE 788          

HSP 9 Score: 159.844 bits (403), Expect = 3.183e-38
Identity = 123/432 (28.47%), Postives = 206/432 (47.69%), Query Frame = 1
Query:  547 HDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEI--MNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSV-----RTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG-FKEGSIFEHTLPLRQ-LGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEG-----LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKG 1785
            H   +Y+V   T DV+GAGT   +++++ G+    P+I L          +        T +F ++ +++G L+ I IEHD       W L    I  MN  + R + F CN+WLS    DG   R+L    +        KY   V TG  + SGTD+ VF+++ G  G + + +L  +    F++G   KF I A  +G I KI I  +  G  + W+L++V I D+ N    Y F C  WL+ D  D    R++  G  E  GI     Y ++  T +  GAG+ + I++ + GE G  +   +  + G F+ G I    + +   L  L ++ +G+  NG    W+  KVI+      ++Q+    FPCG WL   +G+G     L ++L +++  +R +K+ + + I T +   A T +   + + G
Sbjct:    5 HQYYIYEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHL-------TSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFY-FPCNNWLSKEDGDGLYVRDLLGSLNPMDVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNN-FEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKT-VYEFPCSRWLAIDEDDGKIQRDLLVGGSEATGIV----YNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFLEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQT----FPCGHWLDVDEGDGLIERELYEMLSLRQ--KRQKKHPWSLWIWTSDMKSAGTDANILLQVYG 416          

HSP 10 Score: 137.502 bits (345), Expect = 2.325e-31
Identity = 93/317 (29.34%), Postives = 159/317 (50.16%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK--YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIP-ATCVGPISKIRIRQDESGSKSSWYLDRVCI----TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYK----ISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSI 1476
            Y   V T    G+GT   ++++I G+  +    +L   K +           GS   F I   +LG +  I I H+       W L+ V I ++ NK ++ F C+ WL++ ++DGK+ R+L    S  T   Y + ++TGD+  +GTDSK+ + L G  G+    +LF E  + F+RG+   F I  A  + P+S++ I  D +G  + WY ++V +    T ++       F C +WL  D GD    RE+    E++ +  + + K    +  +T +   AG+ A+I +Q++GE G+SD I +  N D F+ G +
Sbjct:  139 YVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNN--------FEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVGGSEATGIVYNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFLEGGE-FERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQT-----FPCGHWLDVDEGDGLIERELY---EMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSDNFEAGQV 438          

HSP 11 Score: 136.732 bits (343), Expect = 3.633e-31
Identity = 135/567 (23.81%), Postives = 237/567 (41.80%), Query Frame = 1
Query:  469 CYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGK-VSRELFAFKSVR-----TKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKE-NTQCFQRGQTSKFVIP-ATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGA-KEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN---KDGFKEGSIFEHTLPLRQLGTLKKIKVGN-----KNNGPQP--RWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERYQK-------YKYEMKISTGNRAHASTTSRAYVILKGP-------EIKDKILDKIE--STNKIWIENAKFKEGFTDVVPVEL-NEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQT 2061
            C+ +    + L  R  +      ++   +ILY+V V T DV   GT   IYI+  G   +   ++L             +   G    F +  +D+  L+ + +  DG   +  W  + + + N+  +   +F    W+S  K + K +S E+ A          T Y I V T D+  +GTD+ VF+ + G  G +  + L +  N+  F+R Q+  F  P    +G + K+R+  D SG    W+L+ + I D +     + FQC  WL+K+  DH  +RE+  A  +I+ +  +T Y+I   T ++  A +  +++I + G+ G S    ++N   K  F   +        + LG +  I VG+     +   P+P   W + ++I+ + +    + F C   +         ++    K  E +          KYE+ + TG    A T +   +++ G         +K K+ +  E   TN+ +IE     E     V VE  N  LSP                W L+ + +    TG+   F CG WL   R   +T
Sbjct: 1222 CWFAKDRGDGLTARVFNMLDATAITIGHKILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQL--------PKGDDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMYGDWMSKTKGERKSLSCEMAATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQSNNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKD-ETMSKSFRFQCDRWLAKNADDHQIIRELACANNDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNAKVPLRSKRDDYRVFECAKAIESFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNLFERGKTNRFYIETLDLGE--MKKVRVEHDNSGLSP---------------GWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGET 1762          

HSP 12 Score: 58.151 bits (139), Expect = 2.539e-7
Identity = 40/126 (31.75%), Postives = 61/126 (48.41%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHD--GLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+V V T   KGAGT   + + + G   +  +  LK+  ++           G T  F I   DLG+++ + +EHD  GL P   WLL+ VE+ N       +F C  WL   + DG+  REL+
Sbjct: 1651 VKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNL-------FERGKTNRFYIETLDLGEMKKVRVEHDNSGLSP--GWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWRELY 1767          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Xenopus
Match: LOXHD1 (lipoxygenase homology domains 1 [Source:HGNC Symbol;Acc:HGNC:26521])

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 494/1267 (38.99%), Postives = 722/1267 (56.99%), Query Frame = 1
Query: 3817 YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQ--FKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVD-SVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQ-KLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKK--WFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTP 7557
            Y V V TG  +G+GTDANV+  I+G+ GD+GER LK    N +NKFE    D F IKA+DLG L+K+KIRHDN    A W+LD V + DE D+  Y FPC  WLA ++D G +++ + P + A  K  +D   D+SQ    + Q+ K   + V + T  K  +GTDANV +ILYGE +D+G + LK S T+ NKFE G  D F V+  D+G L K++IGHDN G +A W L  VEI+A  LGQ   FPC  W+ KS+ DG +ER L+P    T    P + YEIT  TS+   AGT+A+V+I +YGR+  CT++ +L  N    +   +    D F V +EDV D IEKIRIGH +KG+ + WHL++V ++RLL N   S    FPC RWLA+ E+DG   REL+P  +     M     ++ Q++  V + L+   Y+I V+TG    +GT+ANVF+ +YG+ GD+GER+L  S+T+++KFE+  +D+F  EAVDLG ++KI IRHDNS     DW+L+++EI+++   ETYLF CERWLS  K+DKKI+R LY   Y GER +   G S   + GS+ SL SQ + ++                  I Y ITI TG ++  G+    ++ + GP+ ++T  + L    +   FAPGS E  SV   DV  IK++EI  E         +  ++ ++P  G   N    ++++ F                                     G + S+  +QL             K +D FERG RD F +E+ D+  +KK+R++ DG G RP W+ E++ + N +T E   F Y +++SK  G++K L+ ++A   D    ++ T Y + VKTS+V  AGT + V +  +GE GD+G L LK    +NK F+ NQ D F FPDMLSLGDL + +VWH+NSG    WHLE+I++K+    +S++F C++WL+   DD QI REL C N  N     + +TSYE+  +T D+ +A    +VW V  G+K  S +F+ME N  K++ F+R + D  K +   LG++  I +G        +S      W   E+ V        YVF   + + +  K    D  +F+ +  +E    +R   L     VKYE++VVTG   G GTDANV + ++G N +SGK  L QK RNLFE+G+ ++F +E +DLG+++K+++EHD+S     W L+RV+V N +T     +PC +WL K +G    W+ L P
Sbjct:  606 YEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKA--NHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKK-EDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKD--GTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIRIRHDNS-MLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSL--GSSSKSFWGSSLSLRSQDNNAN------------VKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMEILYE---------VTVVTGDVPNGGTDAN----IYITCF-------------------------------------GASGSSEEMQL------------PKGDDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMYGDWMSKTKGERKSLSCEMAATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQSNNSNK-FERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACAN--NDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLME-NTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNAKVPLRSK--RDDYRVFECAKAIE-SFASRARSLVP---VKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNLFERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWRELYP 1780          

HSP 2 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 419/1242 (33.74%), Postives = 644/1242 (51.85%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS-KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNG--DEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELT----------------GTTLLG------KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK----TLEYDLDPSKI--DKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKD-----KKTDQLPLKSKSDTFERGNEDVFKINAADVG-VIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKR-SPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTD---EKGNPLSNLKELK-----------YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLD---------KSQFKIYQEDKLEN--------FNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRI 4458
            YE+V +TGD+  +GTD+ VF++L G  GI+P+I L  ++   F+R +T  F +    VGP+ KIRI  D +G  + WYLDR  ITD+  P  R++F C NWLSK+ GD   VR++ G+   M +    +Y    +T    G+G+ AD+++ IFGENG++    + N K+ F++GS  + T+    LG ++KI +G+ N G    WFL KVII D+    V+EFPC +WL+  + +G +++ L V           Y + I TG+   A T S+ +VIL G +        ++++ K+++E  +F+ G  D+  +E+   LSPL+ +  G +  G    W+ + ++++CP TGIEQ+F CG+WL         E  L E LS R+ +      ++ W + I+TSD+K+A T++ ++L +YG+ GK+D+I +  +S   ++G V  F   + + G+   +R                  +  AV G  D+  F         + D  T++                 Y+V ++TG    AGTDANV+  IYGE GDTG+R L  +  + NKFE+GQ D F I+AV LG + K+K+ HD+K A +GWF+D+V I +E++ +    F C  W    E DG   R+L                     LG        TY V +KTG  + +GTD+NVF+ ++G+  DTG + LK S TNKNKFE G TD+F +EA DIG +  ++I HD+ G  + WF+D + +  P LG +  F   +WLD      T+E  L PS++  ++    +PY+ITV+T D+  AGTD+ VFI +YG+D     +K+  +  + +   FER + D F +   DVG +I+KIRIGH  K   +GW LD+V                                        I+R  P+ K    ++           F C RWLA  EDD   VREL+P+D   EK      LK+++           Y + V TG+ +GSGTDANVF+TI+G  GD+GER L  +  NS NKFE   +DKF I+A+DLGT+ KI+IRHDNS     WYL+ V + +E  E  YLF C  WL+T K+   + + ++       K++   +L           S   +  +D   N        +++ + T      GT++  ++I+ G                   F  G+ ++F V   D+GE+KK+ I
Sbjct:  138 YEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHLTSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLLGSLNPMDVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNNFEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVG--GSEATGIVYNVAIMTGDIRGAGTDSKIHVILHGEK-------GVKNSGKLFLEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQ----KKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSDNFEAGQVDRF---MHLYGLAVNMR------------------LCLAVQGILDKGSF--------RNLDLHTLKN---------------SYEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKA-NHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYF-FPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRV---------------------------------------EIRRLLPNGKGSQTVT-----------FPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNS-NKFERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYE------KEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMEI 1263          

HSP 3 Score: 484.182 bits (1245), Expect = 2.028e-139
Identity = 372/1301 (28.59%), Postives = 594/1301 (45.66%), Query Frame = 1
Query: 3268 YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDT-FERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCD-LGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLET--NYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQG---NSSLYPLDKNEDN--FERGHRDHFKLEMEDVGK-IKKIRIQNDGNGDRPHWFLEKLDI----TNESTNESYQFEYNEFLSKNVGQKKKL--------------------AIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFREL-------------------------ICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYG-EKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKL 6984
            Y++   TGDV  AGTD+ VF+ ++G+   T ++ L SKS T FER   DVF++   +VG ++KIRI HD     +GW+LD+ +                                                   I++    ++  Y F CN WL+ ++ D + VR+LL +    NP+   K  KY+  V TG   GSGTDA+VFL IFG+NGD+GER L    DN  N FE+ S DKF I A +LG + KI I H+N  G A W+L+ V++ D  ++  Y FPC  WLA ++D G + +D+                         E     +NV + T     AGTD+ +H+IL+GE    G+    +      +FE G  D F ++    L  L ++ IGHD +G  A W+  KV +     G    FPC  W+   + DG +ERELY  LSL   ++ K  + +   TS+ K AGT+AN+ +QVYG    +++  L+N SD    + G  D F                           HL  + V   L                             L    ++ +GS   L      + ++ N  +   +T  V+     GT+ANV+  +YGE GD+GERQL  +  H +KFE+   D F  +AVDLG++ K+ IRHDN G     WFL ++EI+D+ D+  Y F C+RWL+  +DD +I R L                   +        D  +D S   T   E     T       YT+TI TG +K+ G+    ++ LYG K+  T  + L+  +T  N F  G  +V +VEA D+  + +++I ++     + W+L+ + I+ P+ G+     CG WL K   +    R     +         + Y I+V T D+   GT++ +F+ L+G  G         ++K E    FER   D F +E+EDVG  I+KIRI +   G    W L++++I     N   +++  F    +L+K+    + +                     I++   + ++   Y + V T ++  +GT + V +  YG+ GD+G+ +L   E N+  F+  Q+D+F   + + LG + + ++ H+NS  +  W+LE +E+    T  ++ F C +WLS   +D++I R L                         +     N    SRN   Y +T+ TG  +  G     + +  G +K  +++  ++   DK K F+  S +K  V  + +GE+K +++
Sbjct:  138 YEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHLTSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAI---------------------------------------------------ITDMNRPHLRFY-FPCNNWLSKEDGDGLYVRDLLGS---LNPMDVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKL----DNDKNNFEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVGG--------------------SEATGIVYNVAIMTGDIRGAGTDSKIHVILHGE---KGVKNSGKLFLEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSD--NFEAGQVDRFM--------------------------HLYGLAVNMRLC----------------------------LAVQGILDKGSFRNL-----DLHTLKNSYEVHVFTGTVWG---AGTDANVYAAIYGELGDTGERQLKKA-NHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKG-ANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLV-----------------PVDEAFMKKEDEGQDQSQ-ATLGLEQKAKST------TYTVTIKTGDKKNSGTDANVFLILYGEKD-DTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNI-EAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDK-KGFAPGSVEKFSVVGLDVGEIKKMEI 1263          

HSP 4 Score: 461.84 bits (1187), Expect = 4.306e-132
Identity = 383/1281 (29.90%), Postives = 599/1281 (46.76%), Query Frame = 1
Query: 1696 YQKYK-YEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIF-CPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD-SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGP---GIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKG--DTGDRFLTHSTTNTNKFEKGQMDEFLIE-AVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVRELTGTTLL-----GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKS--DTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDE-------KGNPLSN--------LKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDES--DEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK-----FESGNCDEFQVKCCDLGE-LKKIRIGHDNSGPNADWHLAKVEIEA----EKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLT--MTKRPKIK--------------YEITTVTSNRKGAGTNANVYIQVYGR-NDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGE----------SIDQVDSVANILQKK--AYTIRVYTGGET--GTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHD 5310
            Y K K YE+   TG+   A T +  +V L G   +  I  KI  T+K       F+   TDV  V+ N  + PL +I    +  G N  W+LD  +I    +  +   F C NWLS           L+  L+   +  +     N ++  ++T     + T++ V L ++G+NG T +  +  D +  + GS  +F  +   +G   K+   H+N G ++ W LEK+++    N   Y+F C+RWL+   +D    R++   G    GIV       Y V I TG+   AGTD+ + + ++GEKG  ++G  FL        +FE+G++D F IE A  L  +S++ +GHD    G+GW+ +KVI++    P   +  TF C  W D  EGDGL  REL     L      K  + + + T  ++ AGTD+N+ ++++G+ G +  ++L     N + FE G  D F         +  + ++             ++C+ V  +  K  F   + LD  TL+                Y++ VFTG V  AGTD+ V+  IYG+   T +  LK  +  + FERG ED+F I A D+G ++K++I HD K   +GWF                                                     L ++   +E +  +Y+F C RWLA DEDD  I R+L+P DE       +G   S          K   Y V +KTG++  SGTDANVFL ++G+  D+G   LK +  N  NKFE    D F ++A+D+GTL K+KI HDN    A W+LD+V ++  S      FPC  WL  ++D G + + +FP                S+ +  Q      + + VYT+    AGTDA+V I+LYG     G+   ++SL  + +     FE  + D+F V+  D+G+ ++KIRIGH + G +A WHL +VEI       K  Q+  FPC  W++KS+ DG   REL P    T  + K   +K              Y I+  T +  G+GT+ANV+I +YG   D  E+    + ++ +K + G  D F +   D+   I KIRI HDN  L   W+LE+V +     N+     Y F C RWL+  +ED  IER L   +    G   +LG           S+   D+ AN+  +    Y I + TG +   GT +  ++ + G      ER  +D       F   ++++F    +D+G++ K++I ++
Sbjct:  132 YNKKKVYEVVTVTGDVRGAGTDANVFVTLFG---EFGITPKIHLTSK---SRTAFERSKTDVFRVKTN-NVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLLGSLNPMDVPKM-----NKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNNFEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVGGSEATGIV-------YNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFL-----EGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVY---CPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDN---NSDNFEAGQVDRFM-------HLYGLAVNM------------RLCLAVQGILDKGSF---RNLDLHTLKN--------------SYEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKANHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWF-----------------------------------------------------LDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNK-NKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFP----------------SELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGR---DGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDL-GTIYKIRIRHDNSMLNPDWYLERVEI----LNEVTEETYLFICERWLSTKKEDKKIERILYEKEY--DGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMEILYE 1266          

HSP 5 Score: 369.777 bits (948), Expect = 9.769e-103
Identity = 356/1341 (26.55%), Postives = 594/1341 (44.30%), Query Frame = 1
Query:  403 NLEDYFIRKFSRVLSPHLPLRDCYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF----AF-------------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCGR---TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAK-EIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENG---ESDVIDIKNKDG---FKEGSIFEHTLPLRQLG-TLKKIKVGNKNNGPQPRWFLNKVIINDL----DQSRVFEFPCGQWL--SDVKGEGLEKILPVKKLPERYQK-----------------YKYEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVE-DLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSW-NLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKI-EAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKID--KTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKINAADVGVIQKIRIGH---DGK----KPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRW--LASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESD--EYLFPCFSWLATNKDGGHLSKDIFP 4167
            N E   + +F  +    + +R C      A +  L   SFR  +  +  +   Y+V V T  V GAGT   +Y +I G+  +    +LKK    NK         G   IF I+  DLG+L+ + I HD       W L  VEI++ ++   + F C  WL++ ++DG+++R+L     AF                   K+  T Y + + TGD  +SGTD+ VF+ L G    TG    ++  K N   F+RGQT  F + A  +G ++K++I  D  G+ + W+LD V I D  +   R  F C  WL K   D    R +  ++ +         Y+I+ YT +   AG+ AD++I ++G +G   +   + +  ++    F+  S+ +  + L  +G  ++KI++G+ + G    W L++V I  L      S+   FPC +WL  S+  GE + +++P     E+  K                 + Y + + TG+   + T +  ++ + G   +  ++ L K E+ +       KF+ G  D   +E  + L  + +I    +    N DW+L+ + I    T     FIC  WLS  +   + E  L E +    +L                 S   NA+  S+ I+  +          I   + LD     E R  + I+G P K+R       T   W +L K         D+  F        S E FS V        G +K   I  Y+V + TG+    GTDAN++I  +G  G + +  L       ++FE+GQ D F++E   +  + K++L  D K +   W+ +++ +        +V F    W   ++G+  ++       + G  ++   TY ++VKT  V GAGTD+NVF+ IFG+ GDTG + LK S  N NKFE   +D+F+  +   +G++  +R+ HD++G G  W ++ I +    +   + F  ++WL    D   +  +L  +  D +D  +   Y+I   T D   A T   V+I + GK  ++ +  ++  SK   F R   D FK ++ ++G I  I +GH   DG+    KP   W + +++                                                   ++E E  N  +Y F CN    L S  DD  +       +   +   +L  +KY V V TG E G+GTDANV L ++G NGDSG+ ALK  + N    FE    ++F I+ +DLG ++K+++ HDNS     W L+ V V + +     +FPC  WL   +  G   ++++P
Sbjct:  560 NFEAGQVDRFMHLYGLAVNMRLCL-----AVQGILDKGSFRNLDLHTLKNS--YEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKANHLNK------FERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFM-NLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEI-DAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSN------KFERGQVDKFNIEAVD-LGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYH----------ITITTGLDRVGGTESRAYVIIMG-PQKIR-------TERLWLDLPK---------DKKGF-----APGSVEKFSVV----GLDVGEIKKMEIL-YEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKG---DDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETV-FMYGDWMSKTKGERKSLSCEMAATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQS-NNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACANNDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEII---------------------------------------------------VTETELGN--KYVFNCNAKVPLRSKRDDYRVFECAKAIESFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKMRNL---FERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWRELYP 1780          

HSP 6 Score: 364.77 bits (935), Expect = 3.324e-101
Identity = 296/1059 (27.95%), Postives = 475/1059 (44.85%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK--YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIP-ATCVGPISKIRIRQDESGSKSSWYLDRVCI----TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYK----ISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLV-------------EDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDR--FLTHSTTNTNKFEKGQMDEFLIEAVKLG-AISKIKLGHDSKLAGSGWFVDKVII---WEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTL---------------------LGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK---------TLEYDLDPSKID------------------------KIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDK-KTDQLPLKSKSDT--FERGNEDVFKINAADVGVIQKIRI 3462
            Y   V T    G+GT   ++++I G+  +    +L   K +           GS   F I   +LG +  I I H+       W L+ V I ++ NK ++ F C+ WL++ ++DGK+ R+L    S  T   Y + ++TGD+  +GTDSK+ + L G  G+    +LF E  + F+RG+   F I  A  + P+S++ I  D +G  + WY ++V +    T ++       F C +WL  D GD    RE+    E++ +  + + K    +  +T +   AG+ A+I +Q++GE G+SD I +  N D F+ G + +  + L  L    ++ +  +         L+K    +LD   +                               K  YE+ + TG    A T +  Y  + G E+ D    +++  N +     KF+ G  D+  ++  + L  L ++    +  G N  WFLD + I   +   +  F C  WL+      Q    LV             +D S+  L         T+ V+I T D KN+ T++ V L+LYG+   T  + + A     +K + G    F  E   +G   KL+  HDN GT++ W L+ + +     G   +F C RWL  S +D +  R +  +     +  P   Y++ +YT +   AGTDA+VFI +YG  G    +     +       FE+  +D+F++E   +G  I KI++GH  K   +GW +D+V I         S +VTF C  W   SE DG TVREL  + +                     L   TY + V TG + G+GTD+NVFI I+G  GDTG  +L  S TN NKFE G  D F IEA D+G I  IRI HD++     W+++++ ++       Y+F   +WL +K           E + D  ++                         K    IPY IT+ TG     GT+S+ ++ I G  K +T++L L    D   F  G+ + F +   DVG I+K+ I
Sbjct:  267 YVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNN--------FEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKTVYEFPCSRWLAIDEDDGKIQRDLLVGGSEATGIVYNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFLEGGE-FERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQT-----FPCGHWLDVDEGDGLIERELY---EMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSDNFEAGQV-DRFMHLYGLAVNMRLCLAVQG-------ILDKGSFRNLDLHTL-------------------------------KNSYEVHVFTGTVWGAGTDANVYAAIYG-ELGDTGERQLKKANHL----NKFERGQEDIFTIKAVD-LGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMEI 1263          

HSP 7 Score: 332.413 bits (851), Expect = 4.566e-91
Identity = 306/1187 (25.78%), Postives = 526/1187 (44.31%), Query Frame = 1
Query: 4270 YTTKKMY-----------AGTDANVHIILYGETNDSGIIPLKQSLTHSNK--FESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEI-EAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKI-KYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWE-AVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLS------------------KSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANS----LDSQKDGSHGGT-------FAFETD----------------ENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKL-ETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLS-----------------KFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDK---NEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKN----VGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKP--FKINQLDEFIFPDMLSLGDL-SRCQVWHNNSGFSSRWHLEYIEMKEV----KTRRSWKFPCNKWLSMTDDDRQIFRELICEN------------------APNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVH------EKI---READGEIFDIS-----------NIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQ--KGRNLFEQGQEDKFILECVDLGKIEKIKIEHD 7425
            Y  KK+Y           AGTDANV + L+GE    GI P K  LT  ++  FE    D F+VK  ++G LKKIRI HDN+G NA W+L +  I +  +    F FPCN W+SK   DG   R+L    SL     PK+ KY     T    G+GT+A+V++ ++G N  T +  L+N  DK+  + G  D F +   ++   I KI IGH+NKG  + W LEKV+++ +    NK++ YEFPC+RWLA DE+DG I+R+LL       G   A G                 Y + + TG     GT++ + + ++GE G     +L        +FE+  +D F  E A  L  + ++ I HD +G     W+ +K+ +   F      F C  WL                   + K  KK   +L+I     + +   +     +Y     S    LD+  D    G        +    +                 N    T   +Y + + TG     G+    +  +YG     T   +L+K    N F  G +++ +++A D+  +K+++I ++     + W+L+ + I        Y   C  WL+                  FM +    +  S     +   +K  TY +++ TGD    GT++ +FL L+G + ++    L     N++ FERG  D F +E  D+G + K++I +D  G    WFL+ ++I   S  +  +F    +L K+      ++     +L     +    Y++ V TS++ +AGT + V +  YG  G     +     +  +   F+ N +D+FI  ++  +GD+  + ++ H + G S+ WHL+ +E++ +    K  ++  FPC +WL+ ++DD +  REL+  +                    +P +T     +Y ++V TGD   +G   +V+   YG+   + +  +  +      F R   DK  +  V LG +  I+   + + N + +    W+   V + N  T +TY+F  + W+         E+I   +E DGE   +            ++    N A V   K + ++ Y I + TG     GT++  ++ + G      +R  +   K +  F  G  +KF +  +D+G+I+K++I ++
Sbjct:  132 YNKKKVYEVVTVTGDVRGAGTDANVFVTLFGEF---GITP-KIHLTSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLLG--SLNPMDVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDN--DKNNFEKGSEDKFTIDAPNLG-KIRKITIGHNNKGGSAGWFLEKVIIEDI---GNKTV-YEFPCSRWLAIDEDDGKIQRDLLV------GGSEATG---------------IVYNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLF---LEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGV-GAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKLDNNSDNFEAGQVDRFMHLYGLAVNMRLCLAVQGILDKGSFRNLDLHTLKNSYEVHVFTGTVWGAGTDANVYAAIYGELG-DTGERQLKKANHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTVEAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFPSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIV-ELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETH----TYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIR---IRHDNSMLN--PDWYLERVEILNEVTEETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANV---KSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLPKDKKGFAPGSVEKFSVVGLDVGEIKKMEILYE 1266          

HSP 8 Score: 294.664 bits (753), Expect = 2.199e-79
Identity = 262/946 (27.70%), Postives = 427/946 (45.14%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKA--NLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSD-LGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKV-IINDLDQSRVFEFPCGQWLS--DVKGEGLEKILPVKK------------------LPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILD-KIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNG---KTDDIVIPADSK---LDSGSVVEFRTELAIVG-IPYKLRAQHDNSGTNSSWNLEKILMTQAV-NGDEYQ---FLCNRWLSDSHEDFSTVREIPATG--------PGIVK--------PAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDG-----LTVRELTGTTL-LGK--------------------------VTYEVEVKTGKVQGAGTDSNVFIRIFG-QTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDT 3111
            I+Y VA+ T D++GAGT   I++ + G+K   N  ++ L             +   G   IF I  +  L  L  + I HDG      W  + V +          F C HWL + + DG + REL+   S+R K      + + + T D+  +GTD+ + + + G  G S +I+L   N+  F+ GQ  +F+      G    +R+     G         + +  LKN                                        Y++  +T    GAG+ A++Y  I+GE    GE  +    + + F+ G     T+    LG LKK+K+ + N G    WFL++V I+++ D ++ F FPC +WL+  +  G+   +++PV +                  L ++ +   Y + I TG++ ++ T +  ++IL G +     ++ K   TNK      KF+ G TDV  VE  + +  L ++  G +  G +  WFLD + I  P  G    F CG WL  S      E  L    S+ + +  + F    + +++YTSDI  A T++ V +VLYG +G   +   + +    +    +  SV +F  EL  VG I  K+R  H + G ++ W+L+++ + + + NG   Q   F C RWL+ S +D  TVRE+  +          G +K        P     Y + ++TG+   +GTDANVFI IYG+ GDTG+R L+ S TN+NKFE+GQ+D+F IEAV LG I KI++ HD+ +    W++++V I  E     +  F C  W  + + D      L  +E  G  L LG                           + Y + + TG  +  GT+S  ++ I G Q   T  + L     +K  F  G+ + F +   D+GEIK + I ++ T
Sbjct:  389 IVYNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFL----------EGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEGDGLIERELYEMLSLRQKRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGKSDEIKL-DNNSDNFEAGQVDRFM---HLYGLAVNMRLCLAVQGILDKGSFRNLDLHTLKNS---------------------------------------YEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKANHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYF-FPCQRWLAVDEDDGQIARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNK-----NKFERGQTDVFTVEAVD-IGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLFP--SELQTEQYVPFV--PYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQFIVELEDVGDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSEDDGETVRELVPSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVT-EETYLFICERWLSTKKEDKKIERILYEKEYDGERLSLGSSSKSFWGSSLSLRSQDNNANVKSRNIIPYHITITTGLDRVGGTESRAYVIIMGPQKIRTERLWLDLP-KDKKGFAPGSVEKFSVVGLDVGEIKKMEILYEVT 1268          

HSP 9 Score: 239.965 bits (611), Expect = 1.403e-62
Identity = 175/566 (30.92%), Postives = 286/566 (50.53%), Query Frame = 1
Query: 5998 KITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDK--NEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLAIDLAPINDI----------------------KKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNE--TSYEVTVITGDKKNAGMPHDVWFVFYGEKNY--SDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNEL-YSD---SKKWFCNEVHVKNLAT----LKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVK--------------YEILVVTGKGNGCGTDANVFITLFGENSESGKRPLV--QKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSK 7533
            K +Y + V TG V   GT++ ++  ++G  G++    L K  + + FERG  D F ++  D+G++KK++I++D  G    WFL++++I +E  +  Y F    +L+  ++ GQ   +A  L P+++                       K T Y V +KT + K++GT + V +  YGE  D+G + LK  + N   F+  Q D F   + + +G L++ ++ H+N G S+ W L+++E+      +  KFPC +WL  ++DD  I R L     P+  +T +      YE+TV T D   AG   DV+ V YG        K +  N  ++   F R+S D+      ++ EL+++  G ++ K  + ++D   S  W  + V ++ L       +T  F  + W+   E     DGE   +  +V  P+    E+L K G +K              Y I V TG   G GTDANVFIT++G+  ++G+R L   +   N FE+GQ DKF +E VDLG I KI+I HD+S    DW+L+RV++ N  T + + + C  WLS  K
Sbjct:  603 KNSYEVHVFTGTVWGAGTDANVYAAIYGELGDTGERQLKKANHLNKFERGQEDIFTIKAVDLGELKKLKIRHDNKGANAGWFLDRVEIVDEKDDTKYFFPCQRWLAVDEDDGQ---IARQLVPVDEAFMKKEDEGQDQSQATLGLEQKAKSTTYTVTIKTGDKKNSGTDANVFLILYGEKDDTGFMNLKASKTNKNKFERGQTDVFTV-EAVDIGTLAKLKIGHDNKGTSAGWFLDWVEIDAPSLGQRVKFPCGRWLDKSEDDGTIERYLF----PSELQTEQYVPFVPYEITVYTSDIFAAGTDADVFIVLYGRDGVCTQQKSLCVNKRERRLYFERNSVDQ------FIVELEDV--GDIIEKIRIGHTDKGMSAGWHLDRVEIRRLLPNGKGSQTVTFPCERWLAKSED----DGET--VRELV--PSDIFTEKLMKDGTLKQIEMEVEDPLETHTYSISVFTGDIYGSGTDANVFITIYGDLGDTGERKLSKSETNSNKFERGQVDKFNIEAVDLGTIYKIRIRHDNSMLNPDWYLERVEILNEVTEETYLFICERWLSTKK 1144          

HSP 10 Score: 234.958 bits (598), Expect = 5.003e-61
Identity = 177/564 (31.38%), Postives = 277/564 (49.11%), Query Frame = 1
Query: 3808 ELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVND--ESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLEN--FNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVK-CCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGH---DNKGLGSA----WHLEKVLVKRL-LANKNKSIAYEFPCNRWLA-RDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLY 5451
            E+ Y V V TG+    GTDAN+++T FG +G S E  L    D    +FE    D F+++  D+  L+K+++R D       WY + + + +    +E +F    W++  K      +       A   D               E+ +E   + ++V T+    AGTDANV +I++GE  D+G + LKQS  +SNKFE    D F+      LG+L K+R+ HDNSG    WHL  ++I+ E + +SF F C+ W++K+  D  + REL    +  +  + K  YEI TVTS+R  A T  NV+I + G+   +++  + N S K +     TD F  S +++ D I  I +GH   D +         WH+++++V    L NK     Y F CN  +  R + D                 +    ++I+   S A  L    Y + V TG E   GT+ANV L +YG NGDSG+  L   +   + FE+   + F  E +DLG++ K+ + HDNSG     W L+++E+ +     T +F C +WL K + D +  R LY
Sbjct: 1262 EILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKGDD----RFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMYGDWMSKTKG----ERKSLSCEMAATVD--------------GEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQS-NNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACANNDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENTSKKRRFARDATDTFKFSSKNLGD-IAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNK-----YVFNCNAKVPLRSKRDDY--------------RVFECAKAIESFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHAL--KQKMRNLFERGKTNRFYIETLDLGEMKKVRVEHDNSG-LSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWRELY 1779          

HSP 11 Score: 231.491 bits (589), Expect = 4.718e-60
Identity = 175/611 (28.64%), Postives = 286/611 (46.81%), Query Frame = 1
Query: 3226 LDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIK-AIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHD-------NSGPNADWHLAKVEIEAEKLGQSFVFPCNEWIS-KSKVDGNLERELYPQLSLTMTKRPK----IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP 5013
            LD  +I K++  I Y++TV TGDV + GTD+ ++I  +G    ++++ L    D FERG  D F +  AD+  ++K+R+  DGK     W+ +++                                                SL  ++ +EE       F+   W++  + +   +   +     G  +  ++   Y++ VKT +  G+GTDANVFL IFG+NGD+G  ALK +  N+ NKFE    D F     + LG L K+++ HDNS  G  W+L+++ + DE  S  + F C  WLA N D   + +++  AN        ++ LD  +   Y+        +   T+ +  A T  NV I+L G+   S    L ++ +   +F     D F+    +LG++  I +GH        +  P+  WH+ ++ +   +LG  +VF CN  +  +SK D     E    +  +   R +    +KYE+  VT   KGAGT+ANV + +YG N  + K  L     ++  + G T+ FY+   D+ + ++K+R+ HDN GL   W LE+V V     N    +   FPC +WL +   DG   REL P
Sbjct: 1253 LDVGEIKKME--ILYEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKGDDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQI------------------------------------------------SLKNLTTEEETV-----FMYGDWMSKTKGERKSLSCEMAATVDGEEM--VETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQS--NNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGWHLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACAN--------NDILDLKEKTSYE--------IVTVTSDRDDAETKDNVWIVLEGKKGRSKEF-LMENTSKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNAKVPLRSKRDDYRVFECAKAIE-SFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKM-RNLFERGKTNRFYIETLDLGE-MKKVRVEHDNSGLSPGWLLERVEV----TNSATGVTTIFPCGKWLDKKRGDGETWRELYP 1780          

HSP 12 Score: 218.779 bits (556), Expect = 3.646e-56
Identity = 176/610 (28.85%), Postives = 281/610 (46.07%), Query Frame = 1
Query: 2842 GLTVRELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLEYDLDPSKID--KIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKE-LKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNG-------GAAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQ 4611
            GL V E+    +L    YEV V TG V   GTD+N++I  FG +G +  +QL       ++FE G  D F +E  DI  +K +R+  D  G+   W+ +QI +       + +F    W+     + K+L  ++  + +D  ++ +T  Y I V T DV  AGTD+ VF+ I+G++  T  L LK  + S+ FER   DVF+  +   +G + K+R+ HD    G GW                                                      L  I  ++E     + F C+RWLA + DD+ I+REL   +   N + +LKE   Y +   T +   + T  NV++ + GK G S E  ++NT  +   +F   + D F   + +LG +  I + H   +G          W++  ++V +    ++Y+F C +            K    +    Y+ ++  K  +S     +      + V V T  +  AGTDANV +++YG   DSG   LKQ +   N FE G  + F ++  DLGE+KK+R+ HDNSG +  W L +VE+     G + +FPC +W+ K + DG   RELYP+
Sbjct: 1252 GLDVGEIKKMEIL----YEVTVVTGDVPNGGTDANIYITCFGASGSSEEMQLPKG---DDRFERGQRDTFVMEIADIAPLKKMRLRIDGKGSRPEWYFEQISLKNLTTEEETVFMYGDWMSKTKGERKSLSCEM-AATVDGEEMVETTTYIIQVKTSDVSGAGTDANVFLIIFGENGDTGTLALKQSNNSNKFERNQSDVFRFPDMLSLGDLCKVRVWHDNSGIGPGW-----------------------------------------------------HLEFIDIKDETMSKSFRFQCDRWLAKNADDHQIIRELACAN---NDILDLKEKTSYEIVTVTSDRDDAETKDNVWIVLEGKKGRSKEFLMENT--SKKRRFARDATDTFKFSSKNLGDIAAICVGHCPKDGRKFSPKPDLYWHVKEIIVTETELGNKYVFNCNA------------KVPLRSKRDDYRVFECAKAIESFASRARSLVPVKYEVIVVTGFEKGAGTDANVTLVMYGSNGDSGKHALKQKM--RNLFERGKTNRFYIETLDLGEMKKVRVEHDNSGLSPGWLLERVEVTNSATGVTTIFPCGKWLDKKRGDGETWRELYPK 1781          

HSP 13 Score: 158.688 bits (400), Expect = 7.368e-38
Identity = 123/432 (28.47%), Postives = 207/432 (47.92%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEI--MNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSV-----RTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG-FKEGSIFEHTLPLRQ-LGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEG-----LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIK 1797
            +Y+V   T DV+GAGT   +++++ G+    P+I L          +        T +F ++ +++G L+ I IEHD       W L    I  MN  + R + F CN+WLS    DG   R+L    +        KY   V TG  + SGTD+ VF+++ G  G + + +L  +    F++G   KF I A  +G I KI I  +  G  + W+L++V I D+ N    Y F C  WL+ D  D    R++  G  E  GI     Y ++  T +  GAG+ + I++ + GE G  +   +  + G F+ G I    + +   L  L ++ +G+  NG    W+  KVI+      ++Q+    FPCG WL   +G+G     L ++L +++  +R +K+ + + I T +   A T +   + + G + K
Sbjct:  137 VYEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHL-------TSKSRTAFERSKTDVFRVKTNNVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFY-FPCNNWLSKEDGDGLYVRDLLGSLNPMDVPKMNKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNN-FEKGSEDKFTIDAPNLGKIRKITIGHNNKGGSAGWFLEKVIIEDIGNKT-VYEFPCSRWLAIDEDDGKIQRDLLVGGSEATGIV----YNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFLEGGEFERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQT----FPCGHWLDVDEGDGLIERELYEMLSLRQ--KRQKKHPWSLWIWTSDMKSAGTDANILLQVYGEKGK 548          

HSP 14 Score: 130.954 bits (328), Expect = 2.045e-29
Identity = 105/392 (26.79%), Postives = 185/392 (47.19%), Query Frame = 1
Query: 6367 KKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEV-KTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDL-GKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            KK  Y+V+  T +V+ AGT + V V  +GEFG +  + L +  ++   F+ ++ D F      ++G L + ++ H+N+G ++ W+L+   + ++ +    + FPCN WLS  D D    R+L+   + NP    +    Y   V TG    +G   DV+   +GE   + +  ++N+ +    F + SEDK  +    LG+++ I +G   + N+    S  WF  +V ++++     Y F    W+     I E DG+I              V   +  G+V Y + ++TG   G GTD+ + + L GE        L  +G   FE+G+ D F +E   L   + ++ I HD +   + W+ ++V V    T     +PC  WL   +G
Sbjct:  134 KKKVYEVVTVTGDVRGAGTDANVFVTLFGEFGITPKIHLTS--KSRTAFERSKTDVFRVKTN-NVGPLKKIRIEHDNTGMNAGWYLDRAIITDMNRPHLRFYFPCNNWLSKEDGDGLYVRDLL--GSLNPMDVPKM-NKYVARVFTGAANGSGTDADVFLNIFGENGDTGERKLDNDKNN---FEKGSEDKFTIDAPNLGKIRKITIG---HNNK--GGSAGWFLEKVIIEDIGNKTVYEFPCSRWL----AIDEDDGKI---------QRDLLVGGSEATGIV-YNVAIMTGDIRGAGTDSKIHVILHGEKGVKNSGKLFLEGGE-FERGRIDIFNIEIAALLSPLSRVTIGHDGNGVGAGWYCEKVIVYCPFTGIEQTFPCGHWLDVDEG 496          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Xenopus
Match: traf3ip1 (TRAF3 interacting protein 1 [Source:Xenbase;Acc:XB-GENE-5871494])

HSP 1 Score: 222.631 bits (566), Expect = 2.600e-62
Identity = 122/294 (41.50%), Postives = 189/294 (64.29%), Query Frame = 1
Query: 2656 QMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELT--GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            + D+F+IEAV L  + ++++GHD K  G GW++DKV++ E+  P + ++ F CN WFD +E DG  +REL   G +   +  Y  ++KTG V GA +DS VF++++G+ GDT    L  S  +  + FE G  D F I   DIG+I  + I HD+ G  + WF+  + V VP  G +Y+F +N+WL     D K +E ++  S++  I+K + Y++ V TG+V  +GT++ VF+Q+YG+  KT++  L+S+S+ FERG  D+FKI AA+VG I+K+RIGHDG   G GW+L+ V
Sbjct:   44 KADDFIIEAVTLKQVKRVRIGHDGKGGGCGWYMDKVVVREDGKPETEAIEFPCNRWFDRNEDDGHIIRELVPAGDSQNLRSIYHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADNFERGRVDNFTINTIDIGKINKLLIGHDNVGIRAGWFLANVVVQVPAHGKEYMFPVNRWLCKDECDGK-VEVEVYASEVKSIEKMVNYEVVVTTGNVRGSGTNANVFMQLYGEQGKTEETFLRSRSNDFERGAVDIFKIEAAEVGKIRKLRIGHDGSGFGDGWYLESV 336          

HSP 2 Score: 201.06 bits (510), Expect = 5.043e-55
Identity = 129/386 (33.42%), Postives = 195/386 (50.52%), Query Frame = 1
Query: 3970 DKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVND----ESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK-----FESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRL-----------------------------LANKNKSIAYEFPCNRWLARDEEDGAIERELLP 5013
            D F+I+A+ L  +++++I HD   GG  WY+D V+V +    E++   FPC  W   N+D GH+ +++ PA  +           ++   IY      +F +K  T     A +D+ V + LYGE  D+     KQ L  S+      FE G  D F +   D+G++ K+ IGHDN G  A W LA V ++    G+ ++FP N W+ K + DG +E E+Y     ++ K   + YE+   T N +G+GTNANV++Q+YG    TE+T L + S+    + G  D+F +   +V   I K+RIGHD  G G  W+LE V +KR+                             L  +    +Y+F C RWLAR EEDG +  ELLP
Sbjct:   46 DDFIIEAVTLKQVKRVRIGHDGKGGGCGWYMDKVVVREDGKPETEAIEFPCNRWFDRNEDDGHIIRELVPAGDS-----------QNLRSIY------HFQIK--TGDVSGASSDSRVFVKLYGEKGDTN----KQFLLVSDNDLADNFERGRVDNFTINTIDIGKINKLLIGHDNVGIRAGWFLANVVVQVPAHGKEYMFPVNRWLCKDECDGKVEVEVYASEVKSIEK--MVNYEVVVTTGNVRGSGTNANVFMQLYGEQGKTEETFLRSRSN--DFERGAVDIFKIEAAEV-GKIRKLRIGHDGSGFGDGWYLESVEIKRVGIKMMPVEKPEKKKKPNKKKKSSKEEEEELQPREVVESYKFECKRWLARGEEDGELVVELLP 403          

HSP 3 Score: 157.532 bits (397), Expect = 3.570e-40
Identity = 98/336 (29.17%), Postives = 164/336 (48.81%), Query Frame = 1
Query: 3706 FICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVN--DESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEI---------------------------------EAEKLGQSFVFPCNEWISKSKVDGNLERELYP 4608
            F CNRW   +EDD  I+REL+P  +      NL+ + Y   +KTG+  G+ +D+ VF+ ++G+ GD+ ++ L  + ++  + FE   +D F I  ID+G + K+ I HDN    A W+L  V+V       EY+FP   WL  ++  G +  +++ +                  ++   +K+ N+ V V T     +GT+ANV + LYGE   +    L+   + SN FE G  D F+++  ++G+++K+RIGHD SG    W+L  VEI                                 +  ++ +S+ F C  W+++ + DG L  EL P
Sbjct:   94 FPCNRWFDRNEDDGHIIRELVPAGDS----QNLRSI-YHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADNFERGRVDNFTINTIDIGKINKLLIGHDNVGIRAGWFLANVVVQVPAHGKEYMFPVNRWLCKDECDGKVEVEVYAS------------------EVKSIEKMVNYEVVVTTGNVRGSGTNANVFMQLYGEQGKTEETFLR---SRSNDFERGAVDIFKIEAAEVGKIRKLRIGHDGSGFGDGWYLESVEIKRVGIKMMPVEKPEKKKKPNKKKKSSKEEEEELQPREVVESYKFECKRWLARGEEDGELVVELLP 403          

HSP 4 Score: 147.517 bits (371), Expect = 8.875e-37
Identity = 113/386 (29.27%), Postives = 192/386 (49.74%), Query Frame = 1
Query: 4402 CDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEI--EAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNL----NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEI---------------------------------IDKFDNETYLFHCERWLSKSKDDKKI 5436
             D+F ++   L ++K++RIGHD  G    W++ KV +  + +   ++  FPCN W  +++ DG++ REL P      ++  +  Y     T +  GA +++ V++++YG    T K  L    N+ +D    + G  D F ++  D+   I K+ IGHDN G+ + W L  V+V+     K     Y FP NRWL +DE DG +E E+   +V          +SI+++ +         Y + V TG    +GTNANVF+++YGE G + E  L   ++ ++ FE+  +D F+ EA ++GK+ K+ I HD SG F   W+L+ +EI                                   +   E+Y F C+RWL++ ++D ++
Sbjct:   45 ADDFIIEAVTLKQVKRVRIGHDGKGGGCGWYMDKVVVREDGKPETEAIEFPCNRWFDRNEDDGHIIRELVPAGD---SQNLRSIYHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADN--FERGRVDNFTINTIDIG-KINKLLIGHDNVGIRAGWFLANVVVQVPAHGKE----YMFPVNRWLCKDECDGKVEVEVYASEV----------KSIEKMVN---------YEVVVTTGNVRGSGTNANVFMQLYGEQGKTEETFL---RSRSNDFERGAVDIFKIEAAEVGKIRKLRIGHDGSG-FGDGWYLESVEIKRVGIKMMPVEKPEKKKKPNKKKKSSKEEEEELQPREVVESYKFECKRWLARGEEDGEL 397          

HSP 5 Score: 135.961 bits (341), Expect = 6.886e-33
Identity = 122/423 (28.84%), Postives = 182/423 (43.03%), Query Frame = 1
Query: 3040 TDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYI----FFLNKWLDSKT----LEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTD-QLPLKSK---SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLV-----------------------------------NDESDEYLFPCFSWLATNKDGGHLSKDIFP 4167
             D F IEA  + ++K +RI HD  G G  W++D+  V+V + G        F  N+W D       +  +L P+   +  ++I Y   + TGDV  A +DS+VF+++YG+   T+ Q  L S    +D FERG  D F IN  D+G I K+ IGHD     +GWFL  V++                                                     Q  A+   Y F  NRWL  DE D  +  E+  ++ K    S  K + Y V V TGN  GSGT+ANVF+ ++G+ G + E  L+    +  N FE  ++D F I+A ++G + K++I HD S  G  WYL+ V +                                    +  + Y F C  WLA  ++ G L  ++ P
Sbjct:   45 ADDFIIEAVTLKQVKRVRIGHDGKGGGCGWYMDK--VVVREDGKPETEAIEFPCNRWFDRNEDDGHIIRELVPAGDSQNLRSI-YHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADNFERGRVDNFTINTIDIGKINKLLIGHDNVGIRAGWFLANVVV-----------------------------------------------------QVPAHGKEYMFPVNRWLCKDECDGKVEVEVYASEVK----SIEKMVNYEVVVTTGNVRGSGTNANVFMQLYGEQGKTEETFLR----SRSNDFERGAVDIFKIEAAEVGKIRKLRIGHDGSGFGDGWYLESVEIKRVGIKMMPVEKPEKKKKPNKKKKSSKEEEEELQPREVVESYKFECKRWLARGEEDGELVVELLP 403          

HSP 6 Score: 132.109 bits (331), Expect = 1.520e-31
Identity = 89/279 (31.90%), Postives = 142/279 (50.90%), Query Frame = 1
Query: 1960 WFLDDIVIF---CPQT-GIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTD-DIVIPADSKL----DSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVII 2769
            W++D +V+     P+T  IE  F C  W   +         LV     + L+++  F        I T D+  AS++S+V + LYG+ G T+   ++ +D+ L    + G V  F      +G   KL   HDN G  + W L  +++    +G EY F  NRWL     D     E+ A+    ++   +  Y+V + TGN   +GT+ANVF+ +YGE+G T + FL    + +N FE+G +D F IEA ++G I K+++GHD    G GW+++ V I
Sbjct:   74 WYMDKVVVREDGKPETEAIE--FPCNRWFDRNEDDGHIIRELVPAGDSQNLRSIYHF-------QIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADNFERGRVDNFTINTIDIGKINKLLIGHDNVGIRAGWFLANVVVQVPAHGKEYMFPVNRWLCKDECDGKVEVEVYASEVKSIEK--MVNYEVVVTTGNVRGSGTNANVFMQLYGEQGKTEETFLR---SRSNDFERGAVDIFKIEAAEVGKIRKLRIGHDGSGFGDGWYLESVEI 338          

HSP 7 Score: 128.642 bits (322), Expect = 2.216e-30
Identity = 108/391 (27.62%), Postives = 181/391 (46.29%), Query Frame = 1
Query: 4744 TNLNNASDKSKLQTGCTD--VFYVSMEDVDD---------PIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGETG--TNANVFLKVYGENGDSGER-QLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIE 5874
             N  N  D   LQT C+   V    ++  DD          ++++RIGHD KG G  W+++KV+V+     K ++ A EFPCNRW  R+E+DG I REL+P            G+S +          +  Y  ++ TG  +G  +++ VF+K+YGE GD+ ++  LV      D FE+  +D F    +D+GK+ K+ I HDN G  +  WFL  + +      + Y+F   RWL K + D K++                      +Y+    S++                       + + Y + + TG  +  G++   +M+LYG +  KT    L+   +N F  G+ ++  +EA +V  I+++ I ++G      WYL S+ I+
Sbjct:   17 ANKANNIDNQILQTSCSPPMVSETCLQKADDFIIEAVTLKQVKRVRIGHDGKGGGCGWYMDKVVVRE--DGKPETEAIEFPCNRWFDRNEDDGHIIRELVP-----------AGDSQNL---------RSIYHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADNFERGRVDNFTINTIDIGKINKLLIGHDNVGI-RAGWFLANVVVQVPAHGKEYMFPVNRWLCKDECDGKVE--------------------VEVYASEVKSIE-----------------------KMVNYEVVVTTGNVRGSGTNANVFMQLYGEQG-KTEETFLRS-RSNDFERGAVDIFKIEAAEVGKIRKLRIGHDGSGFGDGWYLESVEIK 339          

HSP 8 Score: 124.79 bits (312), Expect = 3.622e-29
Identity = 90/325 (27.69%), Postives = 164/325 (50.46%), Query Frame = 1
Query: 6517 INQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKE--VKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETS-YEVTVITGDKKNAGMPHDVWFVFYGEKNYSDK-FIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNL 7479
            + + D+FI  + ++L  + R ++ H+  G    W+++ + ++E       + +FPCN+W    +DD  I REL+      P   S+N  S Y   + TGD   A     V+   YGEK  ++K F++ ++ D    F R   D   +  + +G++  + +G     ++       WF   V V+  A  K Y+F +  W+   E   + + E++           + V+ ++K  +V YE++V TG   G GT+ANVF+ L+GE  ++ +   ++   N FE+G  D F +E  ++GKI K++I HD S F   W+L+ V+++ +
Sbjct:   42 LQKADDFII-EAVTLKQVKRVRIGHDGKGGGCGWYMDKVVVREDGKPETEAIEFPCNRWFDRNEDDGHIIRELV------PAGDSQNLRSIYHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADNFERGRVDNFTINTIDIGKINKLLIG-----HDNVGIRAGWFLANVVVQVPAHGKEYMFPVNRWLCKDECDGKVEVEVY----------ASEVKSIEK--MVNYEVVVTTGNVRGSGTNANVFMQLYGEQGKT-EETFLRSRSNDFERGAVDIFKIEAAEVGKIRKLRIGHDGSGFGDGWYLESVEIKRV 341          

HSP 9 Score: 121.324 bits (303), Expect = 6.272e-28
Identity = 104/420 (24.76%), Postives = 191/420 (45.48%), Query Frame = 1
Query: 5704 KTNIIRLQKLETNYFAPGSKEV-------ISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNV--TCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKI--TYLISVITGDVDQGGTNSTLFLQLFGTQG--NSSLYPLDKNE--DNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKN-VGQKKKLAIDLAPINDIKK-TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTR---------------------------------RSWKFPCNKWLSMTDDDRQIFRELI------CENAPNPTKTSRNETSYEVTV 6795
            K N I  Q L+T+   P   E          +EA  ++ +K+V I ++G      WY++ + +    K +   +   C  W      +R       I++ +    S+ +   Y   + TGDV    ++S +F++L+G +G  N     +  N+  DNFERG  D+F +   D+GKI K+ I +D  G R  WFL  + +   +  + Y F  N +L K+    K ++ +  + +  I+K  +Y+V+V T NV+ +GT++ V ++ YGE G + +  L++   +   F+   +D F   +   +G + + ++ H+ SGF   W+LE +E+K V  +                                  S+KF C +WL+  ++D ++  EL+       E   +P++      +Y  TV
Sbjct:   19 KANNIDNQILQTSCSPPMVSETCLQKADDFIIEAVTLKQVKRVRIGHDGKGGGCGWYMDKVVVREDGKPETEAIEFPCNRWF-----DRNEDDGHIIRELVPAGDSQNLRSIYHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADNFERGRVDNFTINTIDIGKINKLLIGHDNVGIRAGWFLANVVVQVPAHGKEYMFPVNRWLCKDECDGKVEVEVYASEVKSIEKMVNYEVVVTTGNVRGSGTNANVFMQLYGEQGKTEETFLRSRSND---FERGAVDIFKI-EAAEVGKIRKLRIGHDGSGFGDGWYLESVEIKRVGIKMMPVEKPEKKKKPNKKKKSSKEEEEELQPREVVESYKFECKRWLARGEEDGELVVELLPLETSEIEGKVSPSEDGPQSCTYPSTV 429          

HSP 10 Score: 117.087 bits (292), Expect = 1.369e-26
Identity = 93/341 (27.27%), Postives = 155/341 (45.45%), Query Frame = 1
Query: 5248 DEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIID--KFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPK---NLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDI 6255
            D+F  EAV L +V ++ I HD        W++ K+ + +  K + E   F C RW  +++DD  I R L            P+G S+++ S                                  Y   I TG      S    +++LYG K   N +  ++    L  N F  G  +  ++   D+  I ++ I ++ V   + W+L ++ +++P  GK Y      WL K   + K      +    + ++ K + Y + V TG+V   GTN+ +F+QL+G QG +    L    ++FERG  D FK+E  +VGKI+K+RI +DG+G    W+LE ++I
Sbjct:   46 DDFIIEAVTLKQVKRVRIGHDGK-GGGCGWYMDKVVVREDGKPETEAIEFPCNRWFDRNEDDGHIIREL-----------VPAGDSQNLRS---------------------------------IYHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADN-FERGRVDNFTINTIDIGKINKLLIGHDNVGIRAGWFLANVVVQVPAHGKEYMFPVNRWLCKDECDGKVE--VEVYASEVKSIEKMVNYEVVVTTGNVRGSGTNANVFMQLYGEQGKTEETFLRSRSNDFERGAVDIFKIEAAEVGKIRKLRIGHDGSGFGDGWYLESVEI 338          

HSP 11 Score: 116.701 bits (291), Expect = 1.803e-26
Identity = 69/247 (27.94%), Postives = 130/247 (52.63%), Query Frame = 1
Query:  865 FTCNHWLSLYKEDGKVSRELFAF---KSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTG-ISPQIQLFKENTQC--FQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII 1584
            F CN W    ++DG + REL      +++R+ Y   + TGD+  + +DS+VF+ L G  G  + Q  L  +N     F+RG+   F I    +G I+K+ I  D  G ++ W+L  V +    + +  Y F    WL KD  D     E+  A E+  I     Y++   T N  G+G++A++++Q++GE G+++   ++++ + F+ G++    +   ++G ++K+++G+  +G    W+L  V I
Sbjct:   94 FPCNRWFDRNEDDGHIIRELVPAGDSQNLRSIYHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADNFERGRVDNFTINTIDIGKINKLLIGHDNVGIRAGWFLANVVVQVPAHGK-EYMFPVNRWLCKDECDGKVEVEVY-ASEVKSIEKMVNYEVVVTTGNVRGSGTNANVFMQLYGEQGKTEETFLRSRSNDFERGAVDIFKIEAAEVGKIRKLRIGHDGSGFGDGWYLESVEI 338          

HSP 12 Score: 101.293 bits (251), Expect = 2.471e-21
Identity = 76/282 (26.95%), Postives = 120/282 (42.55%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFA--FKSVR--TKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDL--------------------------------KNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            +Y   + T DV GA +   +++ + G+K +  +  L         +       G    F I   D+G +  +LI HD +  +  W L  V +    + + ++F  N WL   + DGKV  E++A   KS+     YE+VV TG++  SGT++ VF+ L G  G + +    +  +  F+RG    F I A  VG I K+RI  D SG    WYL+ V I  +                                +     Y F+CK WL++   D   V E+
Sbjct:  125 IYHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADN----FERGRVDNFTINTIDIGKINKLLIGHDNVGIRAGWFLANVVVQVPAHGKEYMFPVNRWLCKDECDGKVEVEVYASEVKSIEKMVNYEVVVTTGNVRGSGTNANVFMQLYGEQGKTEE-TFLRSRSNDFERGAVDIFKIEAAEVGKIRKLRIGHDGSGFGDGWYLESVEIKRVGIKMMPVEKPEKKKKPNKKKKSSKEEEEELQPREVVESYKFECKRWLARGEEDGELVVEL 401          

HSP 13 Score: 97.8265 bits (242), Expect = 3.562e-20
Identity = 72/312 (23.08%), Postives = 144/312 (46.15%), Query Frame = 1
Query: 1075 CFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYF-FQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESD-----VIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAK--FKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVI 1983
            C Q+     F+I A  +  + ++RI  D  G    WY+D+V + +   PE     F C  W  ++  D   +RE+  A +   +  R+ Y     T +  GA S + ++++++GE G+++     V D    D F+ G +   T+    +G + K+ +G+ N G +  WFL  V++      + + FP  +WL   + +G +E  +   ++    +   YE+ ++TGN   + T +  ++ L G + K         T + ++ +    F+ G  D+  +E  E +  + ++  G +  G    W+L+ + I
Sbjct:   41 CLQKA--DDFIIEAVTLKQVKRVRIGHDGKGGGCGWYMDKVVVREDGKPETEAIEFPCNRWFDRNEDDGHIIRELVPAGDSQNL--RSIYHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADNFERGRVDNFTINTIDIGKINKLLIGHDNVGIRAGWFLANVVVQVPAHGKEYMFPVNRWLCKDECDGKVEVEVYASEVKSIEKMVNYEVVVTTGNVRGSGTNANVFMQLYGEQGK---------TEETFLRSRSNDFERGAVDIFKIEAAE-VGKIRKLRIGHDGSGFGDGWYLESVEI 338          

HSP 14 Score: 77.0258 bits (188), Expect = 1.610e-13
Identity = 39/108 (36.11%), Postives = 62/108 (57.41%), Query Frame = 1
Query: 7219 YEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNL---FEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSK 7533
            Y   + TG  +G  +D+ VF+ L+GE  ++ K+ L+    +L   FE+G+ D F +  +D+GKI K+ I HD+   R+ WFL  V VQ  +  K + +P N WL K +
Sbjct:  126 YHFQIKTGDVSGASSDSRVFVKLYGEKGDTNKQFLLVSDNDLADNFERGRVDNFTINTIDIGKINKLLIGHDNVGIRAGWFLANVVVQVPAHGKEYMFPVNRWLCKDE 233          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000038579.1 (polycystin 1 like 2 (gene/pseudogene) [Source:NCBI gene;Acc:100486136])

HSP 1 Score: 76.2554 bits (186), Expect = 9.043e-13
Identity = 38/108 (35.19%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 7216 KYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECV-DLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            +Y + V TG   G  T + V ITL+G + ES    L      +FE+G ED F+L  +  LG ++ I++ HD+S  +  W+++RV V ++  ++ W + CN WLS   G
Sbjct: 1153 RYLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHLSDPEGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVLVHDMELDQKWYFLCNSWLSIEVG 1260          

HSP 2 Score: 69.3218 bits (168), Expect = 1.243e-10
Identity = 51/167 (30.54%), Postives = 94/167 (56.29%), Query Frame = 1
Query: 1261 KDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG--FKEGS--IFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYK--YEMKISTGNR 1740
            KD  D+A V+ I  A E     ++ RY ++ +T ++ GA + + + I ++G +GESD   + + +G  F+ G   IF  T  L  LG ++ I++ + N+G +P W++N+V+++D++  + + F C  WLS   G+  L+K+  V    E  +++   + MK S G R
Sbjct: 1130 KDIQDNAKVKII--ALEDNDPFAQYRYLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHLSDPEGPVFERGGEDIFLLTT-LFPLGDVQTIRLWHDNSGDKPSWYVNRVLVHDMELDQKWYFLCNSWLSIEVGDCVLDKVFSVAT-EEDMKQFSNLFFMKTSKGFR 1292          

HSP 3 Score: 68.9366 bits (167), Expect = 1.667e-10
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 1
Query: 6310 KNVGQKKKLAIDLAPIND-IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDD 6708
            K++    K+ I     ND   +  Y V V T + + A T+S VT+  YG  G+S    L  PE     F+    D F+   +  LGD+   ++WH+NSG    W++  + + +++  + W F CN WLS+   D
Sbjct: 1130 KDIQDNAKVKIIALEDNDPFAQYRYLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHLSDPE--GPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVLVHDMELDQKWYFLCNSWLSIEVGD 1261          

HSP 4 Score: 64.6994 bits (156), Expect = 2.666e-9
Identity = 38/110 (34.55%), Postives = 59/110 (53.64%), Query Frame = 1
Query:  949 KYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATC-VGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGD 1275
            +Y + V TG    + T SKV I+L G  G S    L       F+RG    F++     +G +  IR+  D SG K SWY++RV + D++  + +++F C +WLS + GD
Sbjct: 1153 RYLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHLSDPEGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVLVHDMELDQ-KWYFLCNSWLSIEVGD 1261          

HSP 5 Score: 64.3142 bits (155), Expect = 3.957e-9
Identity = 39/111 (35.14%), Postives = 63/111 (56.76%), Query Frame = 1
Query: 3802 LKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAI-DLGTLEKIKIRHDNSNGGAAWYLDYVLVND-ESDE-YLFPCFSWLA 4125
              + +Y+V V TG+  G+ T + V +T++G +G+S    L    D     FE    D FL+  +  LG ++ I++ HDNS    +WY++ VLV+D E D+ + F C SWL+
Sbjct: 1149 FAQYRYLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHLS---DPEGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVLVHDMELDQKWYFLCNSWLS 1256          

HSP 6 Score: 62.003 bits (149), Expect = 1.969e-8
Identity = 47/139 (33.81%), Postives = 69/139 (49.64%), Query Frame = 1
Query: 3124 AWFVDQICVI--VPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKIDKTIP-----YQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK-SKSDTFERGNEDVFKINAA-DVGVIQKIRIGHDGKKPGSGWFLDKVL 3513
            A FVD   V+  V  + L Y+  +  W   K ++ D    KI  ++   P     Y +TVFTG    A T SKV I +YG D ++D   L   +   FERG ED+F +     +G +Q IR+ HD       W++++VL
Sbjct: 1101 ATFVDNPVVVTTVGCIALVYVLVM-IWARRKDIQ-DNAKVKIIALEDNDPFAQYRYLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHLSDPEGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVL 1237          

HSP 7 Score: 62.003 bits (149), Expect = 2.141e-8
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 1
Query: 2074 VEDLSKRKLKTVID---FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKLDSGSVVE-------FRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLS 2430
            ++D +K K+  + D   F +  ++V+++T   + A+T SKV + LYG +G++D    P       G V E         T L  +G    +R  HDNSG   SW + ++L+       ++ FLCN WLS
Sbjct: 1132 IQDNAKVKIIALEDNDPFAQYRYLVTVFTGHRRGAATTSKVTITLYGSDGESD----PHHLSDPEGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVLVHDMELDQKWYFLCNSWLS 1256          

HSP 8 Score: 61.2326 bits (147), Expect = 2.849e-8
Identity = 34/107 (31.78%), Postives = 59/107 (55.14%), Query Frame = 1
Query: 6007 YLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN-FERGHRDHFKLE-MEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVG 6321
            YL++V TG      T S + + L+G+ G S  + L   E   FERG  D F L  +  +G ++ IR+ +D +GD+P W++ ++ + +   ++ + F  N +LS  VG
Sbjct: 1154 YLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHLSDPEGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVLVHDMELDQKWYFLCNSWLSIEVG 1260          

HSP 9 Score: 58.9214 bits (141), Expect = 1.417e-7
Identity = 37/119 (31.09%), Postives = 62/119 (52.10%), Query Frame = 1
Query: 2878 LGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAE-DIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLD 3231
              +  Y V V TG  +GA T S V I ++G  G++    L  S      FE G  D+F +     +G++++IR+ HD++G   +W+V+++ V   +L  K+ F  N WL  +  +  LD
Sbjct: 1149 FAQYRYLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHL--SDPEGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVLVHDMELDQKWYFLCNSWLSIEVGDCVLD 1265          

HSP 10 Score: 58.5362 bits (140), Expect = 2.175e-7
Identity = 38/113 (33.63%), Postives = 56/113 (49.56%), Query Frame = 1
Query: 4261 VKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCC-DLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLER 4596
            V V+T  +  A T + V I LYG   +S   P   S      FE G  D F +     LG+++ IR+ HDNSG    W++ +V +   +L Q + F CN W+S    D  L++
Sbjct: 1156 VTVFTGHRRGAATTSKVTITLYGSDGESD--PHHLSDPEGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVLVHDMELDQKWYFLCNSWLSIEVGDCVLDK 1266          

HSP 11 Score: 57.7658 bits (138), Expect = 4.118e-7
Identity = 31/121 (25.62%), Postives = 65/121 (53.72%), Query Frame = 1
Query: 4639 KIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIER 5001
            + +Y +T  T +R+GA T + V I +YG +  ++  +L++  +    + G  D+F ++       ++ IR+ HDN G   +W++ +VLV  +  ++     + F CN WL+ +  D  +++
Sbjct: 1151 QYRYLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHLSDP-EGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVLVHDMELDQK----WYFLCNSWLSIEVGDCVLDK 1266          

HSP 12 Score: 56.9954 bits (136), Expect = 5.909e-7
Identity = 34/112 (30.36%), Postives = 55/112 (49.11%), Query Frame = 1
Query: 2509 KYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAV-KLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGD 2841
            +Y V ++TG++  A T + V I +YG  G++    L  S      FE+G  D FL+  +  LG +  I+L HD+      W+V++V++  +        F CN W     GD
Sbjct: 1153 RYLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHL--SDPEGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVLV-HDMELDQKWYFLCNSWLSIEVGD 1261          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Mouse
Match: Loxhd1 (lipoxygenase homology domains 1 [Source:MGI Symbol;Acc:MGI:1914609])

HSP 1 Score: 927.161 bits (2395), Expect = 0.000e+0
Identity = 669/2164 (30.91%), Postives = 1073/2164 (49.58%), Query Frame = 1
Query:  883 LSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELTGT---TLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT----LEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFK-----INAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRS--PSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDES--DEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK------FESGNCDEFQVKCCDLGE-LKKIRIGHDNSGPNADWHLAKVEIE---AEKLG-QSFVFPCNEWISKSKVDGNLERELYPQLSLT--------------MTKRPK--IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKS-KLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMN----------ALGESIDQVD------SVANILQKK---AYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERK-TSRIFSIQD--KMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDK--NEDNFERGHRDHFKL-EMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIN-----DIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWH--NNSGFSSR----WHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDR--QIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIE 7107
            L+   EDG+   E   +K+    YE+V  TGD+  +GTD+ VFI+L G  G+SP++ L  ++   F++     F +    VG I KIRI  D +G  +SWYLDRV +TD+K P  RY+F C NWLSK  GD    R++  + + M +    +Y+I  YT +  GAG+ AD++I IFGE G++    ++N KD F++G+  + TL    LG L KI VG+ N G    WFL+K+II D+   R ++FP  +WL+  + +G +++ + V           Y + + TG+   A T S+ Y+++ G           +++ KI++E   F  G TD+  ++L   LSPL+ +  G    G N+ W+ + +VI CP TGI+Q+F C NWL   +     E  L E +S RK +      +  W + ++T+D+K A TNS + + +YG  G+TD+I++ P +     G + +FR EL  +G  YK+RA HD     S W+LEK+ +   +N D+Y F CNRWL  + +D   VRE+ A GP + +   + +Y+V + TG    AGTDANV++ ++G+ GDTG+R L +   NT+ FEKG  DEF IE+V +  + ++++ HD K +GSGW++D+V++ EE  P S++V F C  W D  + DG  VREL  +     L    Y + VKTG V GA TDS V+I+++G+  DT    L  S  N K+ FE G  D F +E  +IG I  + I HD TG  + WF+  + + VP+ G +Y F  N+WLD       LE +L PS++ +I K + Y+I ++TGDV  AGT S+VF+QIYG++ KT+ L L S+S  F+RG++D+F+     I A D+G + KIRI HD      GWFLD+V                     +  Y       + ++D   + R   P  +S    SE EE                  D+N +    L   +K    S        V +KTG++  +GTDANVF+T+FG   ++G   LK++  NS +KFE  S++ F ++ +DLG L K++I HDN+     W++D+V V+  S      FPC  WLA N+D G + +D+F A              + Q ++Y       + + +YT+    AGTDAN+ I++YG       +  +Q    +NK      FE  +   F V+  D+GE ++KIRIGHDN+G N  WH + V+I     EK G ++  FPC+ W++ S+ D    REL P    T                + P   + Y +   T N  GAGT+A VYI +YG    T +  L  + +++ K + G  D F +   D+   I KI++ HDN    + W++EKV +     N      + F C RWL+  +EDG +ER     +     S N          AL   +  VD       + + +Q      Y + V TG   E  T++  F+ + GE+ +   R  +D       F   +++EF    +D+G + KI++ HD +   +  W ++++ +        Y   C  WL+K + D    R                           + LD+                      + + Y +T+ TG     G+    +M LYG  N  T  ++L K +   F     +   +E  D+    ++ I  +G+     W+L  I ++    G L     G WLS+  G++     I ++ D  +MM   S    Y +SV T D+   GT++ +F+ +FG  G+S    L +  N + FER + D F   +M  +G + K+R+ +D  G  P W L  +D+ + S +E+++F+ + +LSK+ G ++ L  D A  N     ++++T Y+++++T N     T   V +   G    S +  ++   +  + F+    D F F D + LGD++   V H      F  +    WH++ I + E++    + F C+  + +    +  ++F       +      S     YEV V TG +  AG   +V+   +G    + K  ++  +    LF R S D+  +  + LGEL+ ++L    + +  YS    W   +V V N +T    +F    W++
Sbjct:   24 LNYDSEDGEDELEHEYYKA--KVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSKSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGG--AETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGN-------KNSGKIFLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKR----LKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRV-------------DITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEG-------------GGQGDNNPLDNLALEQKDKSTTFS--------VTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNS-DKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHA--------------ELQTRLYT--PFVPYEITLYTSDVFAAGTDANIFIVIYG----CDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADL-GVIYKIKLRHDNTKWCADWYVEKVEI----WNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGAS-PESCWLVEELCLAVPTQGTKYTLRCNCWLAKDRGDGVTSRVF-------------------------DLLDAMV----------------VNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGI-NGSTEEVQLDKKKAR-FEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTS----YTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLR-DFACANNEIRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENSSR-QRAFRKGTTDTFEF-DSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKIQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEH--DSSGYYS---GWLVEKVEVTNTSTGVATIFSCGRWLD 2052          

HSP 2 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 475/1323 (35.90%), Postives = 740/1323 (55.93%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSL---DKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKD---------NKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNLNNASDKSKL--QTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-----DKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERS-NAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNY-FAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAG-MPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK-KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTPS 7560
            +Y F  NRWL  ++ D  +  EL P++     +   K + Y +++ TG+  G+GT + VF+ I+G+ G +    L  +  + V     K +   D F I AIDLG L KI+IRHDN+     W+LD V + D ++E  Y FPC  WLA  +D G LS+++ P + +     +D         N LD     + Q+DK   F+V + T  K  AGTDANV I L+G  +++G+  LK S T+S+KFE  + + F V+  DLG+L K+RIGHDN+G    W +  VE++A  LG+   FPC  W++K++ DG++ R+L+     T    P + YEIT  TS+   AGT+AN++I +YG +  CT +  L     + KL  +      F V +EDV + IEKIRIGHDN G+   WH   V ++RLL  K+ +    FPC+RWLA  E+D    REL+P     +K ++ GS+  + + +++       L    Y+++++TG     GT+A V++ +YG+ GD+GER L  S+  T+KFEK   D F  EA DLG ++KI +RHDN+ +   DW+++K+EI +  + + +LF C RWLS  K+D +++R  Y   Y G+RS N  S       + S+   D   D   G    +  D         I Y +++ TG  K+  +    ++ L G  +  TN I L   +    F+ GS E   V   DV  IK++E+ ++G   ES W +  + + +PT+G  Y + C  WL+K  G+  TSR+F + D M+ N+ KK+ Y ++V TGDV  GGT+S +F+ L+G  G++    LDK +  FER   D F +E+ D+    K+RI+ DG G RP WFLE++ + N +T +   F Y ++LS+  G KK L  ++  + D    ++ T Y V VKTS++  AGT + V +  +GE GDSG L LK     NK F+ N  D F F DMLSLG L + +VWH+N G    WHL Y+++K+     +++F C+ WLS ++ DRQ  R+  C N  N  +    ET+YE+ + TG   N G    +VW +  G KN S +F++EN+  +++ F + + D  +   ++LG++ ++ +G +  ++      +  W    + +  +     Y F     I +  K +    ++F+++   E    ++++ L     VKYE++V TG   G GTDANVF+T+FG N ++GKR L QK RNLFE+G  D+F LE ++LG++ K+++EHD S + S W +++V+V N ST     + C  WL KS+G    W+ L PS
Sbjct:  780 QYTFPANRWLDKNQADGRLEVELYPSE----VVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKT--EVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLD--NLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYGCDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEP------LDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCA-DWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQD------GPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAMVVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKG-KKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLRDFACAN--NEIRDELEETTYEIVIETG---NGGETRENVWLILEGRKNRSKEFLVENS-SRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYF--KVFEVTKTTE-SFASKIQSLVP---VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGVATIFSCGRWLDKSRGDGLTWRELFPS 2067          

HSP 3 Score: 482.256 bits (1240), Expect = 1.028e-137
Identity = 397/1473 (26.95%), Postives = 649/1473 (44.06%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK----YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRG-----QTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR------------------------TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPV-ELNEKLSPLTEIIAGINVG----GKNQDWFLD--DIVIFCPQT-GIEQ-SFICGNWLSPSRPGCQTEVSLV----------EDLSKRKLKTVIDFTENT--WMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI---------------PA-------------------TGPGI--VKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR--ELTGTTLLG---KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKID-----KTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSD--TFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG------AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQL 4614
            Y ++V T DV GA T   +YI + G+K++  +  L     + K +       G    F +   ++G +  ++I HD       W L  V+I      + + F  N WL   + DG++  EL+  + V  +    YEI + TGD+  +GT S+VF+ + G  G   ++      ++ F RG     QT  F I A  +G ++KIRIR D +G++  W+LDRV ITD+ N E  Y+F C+ WL+ +  D    RE+    E   + S                         T + ++  T +K  AG+ A+++I +FG    + +  +K    N D F+  SI   T+    LG L K+++G+ N G  P WF++ V ++     +   FPCG+WL+  + +G  +  +   +     Y  +  YE+ + T +   A T +  ++++ G        D + +  K    N + ++ F +         +L  + EII  I +G    G N  W     DI    P+  G E  +F C  WL+ S    +T   LV          +D S R++   ++   +   + V I+T ++  A T++KV + +YGD G T +  +       +K + G+   F  E A +G+ YK++ +HDN+   + W +EK+ +    N DE+ FLC RWLS   ED    R                 PA                   TGP +  V+  P+  Y V + TG    A TD+  F+ + GE  +  +R           F  G ++EF +  + +G I KI+LGHD     S W V+++ +          T RCNCW     GDG+T R  +L    ++    KV YE+ V TG V G GTDSN+F+ ++G  G T  VQL      K +FE    D F +E  DI     +RI  D  G+   WF+++I +     G   +F+   WL  K  +  L       ID     +   Y ++V T D++ AGTD+ VFI I+G++  +  L LK  ++   FER N D F   +   +G + K+R+ HD K    GW                                                      LS +  ++ +  + + F C+ WL+  E D   +R+    + +      L+E  Y + ++TGN  G  T  NV+L + G+   S E  ++N+  +    F + + D F   +I LG +  + + H              W++  + + +    + Y F C   +   +                +K ++  K  +S     Q      + V V T  +  AGTDANV + ++G   D+G   LKQ +   N FE G+ D F ++  +LGEL+K+R+ HD+SG  + W + KVE+     G + +F C  W+ KS+ DG   REL+P +
Sbjct:  686 YHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDY----FERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEG-KTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNN-ETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYG-------CDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCL-AVPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAMVVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKK---KARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGW-----------------------------------------------------HLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLRDFACANNE--IRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENS--SRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKR------------KRKYFKVFEVTKTTESFASKIQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGVATIFSCGRWLDKSRGDGLTWRELFPSV 2068          

HSP 4 Score: 432.18 bits (1110), Expect = 6.799e-122
Identity = 328/1106 (29.66%), Postives = 520/1106 (47.02%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIM--------NVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRT----KYEIVVITGDLDDSGTDSKVFISLCG-RTGISPQIQLFKENT--QCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG-FKEGS--IFE---HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS--DVKGEGLEKILPVKK------------------------LPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKI-LDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVIPADSK-----LDSGSVVEFRTELAIVG-IPYKLRAQHDNSGTNSSWNLEKI----LMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPA----------------TGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTG--------------------------TTLLGK----------VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLE-YDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVL 3513
            Y+V V T +++GAGT   +Y+ + GD  +     L   + +           G+   F I    +  +  + + HDG      W L  V +         NVE      F C  WL   K+DG++ REL    S  T    +Y I V TGD+  + TDS+V+I L G ++    Q+ L  +N     F+RG+  +F +    +G I+++ I  D +G  + W+L  V I   +  + +Y F    WL K+  D     E+    E++ I     Y+I  +T +  GAG+ + +++QI+GE G+++V+ + ++   F  GS  IF+    T+    LG L KI++ + N G +P WFL++V I D++    + FPC +WL+  +  G+   ++LPV +                        L ++ +   + + I TG++ +A T +  ++ L G +  + + L K   TN     + KF+    ++  VE  + L  L ++  G +  GK   WF+D + +  P  G   +F CG WL+ +    + + S+V DL   +L+T +      + +++YTSD+  A T++ + +V+YG D   T    +  + +      +  S   F  EL  VG I  K+R  HDN+G N  W+   +    L+ +    +   F C+RWL+ S +D  T+RE+                      + +P  I  Y VQI+TGN   AGTDA V+I IYG+ GDTG+R+L  S   TNKFEKG  D F+IEA  LG I KIKL HD+    + W+V+KV IW + N  +   F C  W    + DG   R     E TG                           T+ G           + Y V V TGK + A TDS  F+ + G+  +  N         K  F  G+ + F +   D+G IK I + HD     S W V+++C+ VP  G KY    N WL     D  T   +DL  + +  I K + Y++TV+TGDV+  GTDS +F+ +YG +  T+++ L  K   FER   D F +   D+    K+RI  DG      WFL+++L
Sbjct:  555 YRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDL-----FEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVE------FPCLRWLDKDKDDGQLVRELLPSDSNATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGK-QYTFPANRWLDKNQADGRLEVELY-PSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTN-----SDKFERDSIEIFTVETLD-LGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKN----EDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYGCDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTN-EDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAMVVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERIL 1636          

HSP 5 Score: 417.542 bits (1072), Expect = 2.608e-117
Identity = 328/1077 (30.45%), Postives = 527/1077 (48.93%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDL-GDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRG----AKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQ--SRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAK--FKEGFTDVVPVE-LNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKL-DSGSVVEFRTELAIV-----GIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPA------------PI-----------CKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPS--NSVTFRCNCWFDSSEGDGLTVRELTGTTLLGK-----VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNK----FEFGATDLFKIEAEDIGEI-KSIRISHDDTGAGSAWFVDQICV--IVP-KLGLKYIFF-LNKWL-----DSKTLE----YDLDPSK-------------IDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            I Y V V T D++GAGT   IY+ + G + N    ++                 G T IF I  + L   L  + I H  +     W  + V I+         F C++WL   K DG + R+L+   S+R K      + + V T DL  +GT+S +FI + G+ G + +I L   N + F+ G   KF +    +G   KIR   D     S W+L+++ + +  N + +Y F C  WL  +  D+  VRE+       + IMG+A   RY+++  T    GAG+ A++Y+ +FG+    GE  + + +N  D F++G+  E T+    +  +++++V +   G    W+L++V++ +  Q  S   EFPC +WL   K +G  + ++LP        + ++Y + + TG+ + AST SR Y+ L G +      D I+    +   N K  F+ G  D   +E LN  +  +  ++ G +  G +  WFL  + I  P+ G + +F    WL  ++   + EV L         K V       + + I+T D+  A T S+V + +YG+ GKT+ + + + SK+ D GS   F+T+   +     G   K+R +HDN+G    W L+++ +T   N   Y F C RWL+   +D    RE+       V P+            P+             + V I TG+K  AGTDANVFI ++G + + G   L  S TN++KFE+  ++ F +E + LG + K+++GHD+     GWFVD V   E   PS    +TF C  W   +E DG  VR+L    L  +     V YE+ + T  V  AGTD+N+FI I+G   D    + K   TNK +    FE  +   F +E ED+GEI + IRI HD+TG    W    + +  ++P K G + + F  ++WL     D KT+     YD+   K             +++    + Y + +FTG+V  AGTD+KV+I IYG    T +  L   +++++ FE+G  D F I AAD+GVI KI++ HD  K  + W+++KV
Sbjct:  296 ITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV--------FDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEI-LLNPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKD-KYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMA---RYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDS-NATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKS-----DTIKQVLLVSDNNLKDYFERGRVDEFTLETLN--IGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLV------HYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWV---EVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYGC--DAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKV 1340          

HSP 6 Score: 392.504 bits (1007), Expect = 1.635e-109
Identity = 303/1051 (28.83%), Postives = 504/1051 (47.95%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFA-FKSVRT----KYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL-EKIL--PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIK-DKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI----PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVRE-IPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQL--KTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPS-------------------------KIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK---SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            +Y+V   T DV+GAGT   ++I++ G+    P++ L          +       +  +F +R +++G +  I IEHD      SW L  V + +++   + + F CN+WLS  + D +  R+L A F  +      KYEI V TGD+  +GTD+ VFI++ G  G + + +L  E    F++G   KF + A  +G + KI +  +  G  + W+L ++ I D+ N   +Y F    WL+ D  D    R+I  G  E   I     Y ++ +T +  GAG+ + IY+ ++G  G  +   I     F EG +F+       H      L  L ++ +G+ N G    W+  KV+I      + Q+    FPC  WL + K +GL E+ L   V    +R +KY + + + T +   A T S  ++ + G + + D+IL  +   NK W     FK G  +   +EL + L    +I A  +       W L+ + +       + +F C  WL  +    + +  +V +++              + V++ T +++ A T++ V L L+GD G T + ++          + G+  EF  E   +    ++R +HD  G+ S W L+++L+ +      D  +F C RWL    +D   VRE +P+     +K     +Y + + TG+   A TD+ V+I +YGEK DT  + L  S  N  + FE+G++DEF +E + +G I+++ +GHDS    +GWF+  V I          TF  N W D ++ DG    EL  + ++     V YE+E+ TG V GAGT S VF++I+G+ G T  + L  ++ + ++   +   TD F I A D+G +  IRI HD+TG    WF+D++ +        Y F   +WL    D   L  +L P                           +++ DK+  + +T+ TGD  +AGTD+ VFI ++G         LKS    SD FER + ++F +   D+G + K+RIGHD      GWF+D V
Sbjct:   44 VYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHL-------TSKSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN-FEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKR-KYDFPLNRWLALDEDDGKIQRDILVGGAETTAIT----YIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKI-----FLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQT----FPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEIL--LNPNNK-W-----FKPGIIEKFRMELPD-LGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDAN----EDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNATLKNF---RYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQI-RVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWV 1055          

HSP 7 Score: 256.529 bits (654), Expect = 1.187e-67
Identity = 215/841 (25.56%), Postives = 396/841 (47.09%), Query Frame = 1
Query: 5092 QKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIID-KFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDV-GKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLAIDLAPIND--IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPT-KTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKT--YVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNL---FEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI---LTPSE 7563
            + K Y +   TG     GT+ANVF+ ++GENG S +  L  SK+ +  FEK N+D F     ++G ++KI I HDN+G     W+L ++ + D K  +  Y F+C  WLSK + D++  R L +A +  +  + P G                                         Y I + TG     G+    ++ ++G     T   RL+  E + F  G+++  +++APD+  + ++ + +      + W+L+ I IE     + Y+     WL+    + K  R   +     T     ITY+++V TGD+   GT S ++L ++G +GN +   +      F+RG  D F +++  +   + ++ I +   G    W+ EK+ I    T     F  + +L   K  G  ++   ++  +    +KK  + + V T+++K AGT+S + ++ YG+ G + ++ L     NNK FK   +++F   ++  LG   + + WH+     S WHLE + +     +  + F CN+WL   +DD +I RE+  E    PT +       Y VTV TG+ + AG   +V+   +G+   + + ++ N  +   LF + + D+  +  V + +++      V  +++       W+ + V V+     ++    F    W++  +     DG++  +  ++   + A ++  +      Y I V TG  +G  TD+ V+I L+GE S++ K+ L+    NL   FE+G+ D+F LE +++G I ++ I HD +   + WFL  VQ++     K + +P N WL K++   ++   L PSE
Sbjct:   41 KAKVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLT-SKSES-AFEKANVDVFRVRTNNVGLIYKIRIEHDNTGL-NASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDL-LASF--DPMDMPRGNK---------------------------------------YEIKVYTGDVIGAGTDADVFINIFGEYG-DTGERRLEN-EKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETT----AITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLN---PNNKWFKPGIIEKFRM-ELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEG---PTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVR-----RVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKD----DGQL--VRELLPSDSNATLKNFR------YHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSE 806          

HSP 8 Score: 249.98 bits (637), Expect = 1.240e-65
Identity = 220/836 (26.32%), Postives = 362/836 (43.30%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF---------------------AFKSVRTKYEIVVITGDLDD---------------------SGTDSKVFISLCGRTG-ISPQIQL-FKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR--EIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK---LDSGSVVEFRTELAIVG------IPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED-----FSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT--FRCNCWFDSSEGDGLTVREL 2862
            D +LY V + T +V GAGT   +YI+I GD  +     L K +    K        G+   F I  +DLG +  I + HD  +    W ++ VEI N  N+  +LF C  WLSL KEDG++ R  +                     A  S     +I  +TG + D                     + TDS+ F+ L G     + +I L + +  + F  G   +F +    VG I KI +  D +  +S W ++ +C+  +     +Y  +C  WL+KD GD  T R  ++  A  ++ I  +  Y+++ +T +  G G+ ++I++ ++G NG ++ + + K K  F+        + +  +    K+++     G +P WFL ++++ +++   +  F  G WLS  KG+   + +I  V    E  +   Y + + T +   A T +  ++I+ G       L   +S N  W    KF+   TD         L  L ++    +  G    W L  + +          F C  WLS S    QT    + D +    +   +  E T+ + I T +     T   V L+L G   ++ + ++   S+      G+   F  +   +G      + +  R           W+++ I +T+   G+ Y F C+  +    +      F   +   +    I    P+ KY+V + TG +  AGTDANVF+ I+G  GDTG R L     N   FE+G  D F +E ++LG + K++L HDS    SGW V+KV   E  N S  V   F C  W D S GDGLT REL
Sbjct: 1253 DIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNK-----FEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCLA-VPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAM-VVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSAN--W---NKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQT----LRDFACANNEIRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENSSRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKIQSLVPV-KYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL--FERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKV---EVTNTSTGVATIFSCGRWLDKSRGDGLTWREL 2064          

HSP 9 Score: 219.55 bits (558), Expect = 1.779e-56
Identity = 187/677 (27.62%), Postives = 307/677 (45.35%), Query Frame = 1
Query: 5581 DENDTAQTEYI---AYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISI-EMPTKGKLYNVTCGVWLSKFMGERKTSR-IFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL--VQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQV----QNLSTNKIWKYPCNEWLSKSKG---LWKILTPSE 7563
            D  D  + EY     Y +   TG  +  G+    ++ L+G   L   +    K E+  F   + +V  V   +V  I ++ I ++     +SWYL+ + + +M      Y   C  WLSK  G+R+  R + +  D M  ++ +   Y I V TGDV   GT++ +F+ +FG  G++    L+  +DNFE+G  D F L+  D+G++ KI + ++  G    WFL K+ I +      Y F  N +L+ +    K     L    +     Y V V T +++ AGT S + +  YG  G  +SG + L+        F   + D F     + L  LSR  + H N G +  W+ E + +    T     FPC+ WL     D  I R+L      +  K    +  + + V T D K AG    ++   YG+K  +D+ ++  N    K F     +K ++    LG    I+       ++  +    W   ++ + N      Y F    W++ +E   E   E+       E P   R+      G+ +Y + V TG+  G GTDANV++ LFG+  ++G+R L   +   +LFE+G  D+F +E V + K+ ++++ HD     S W+LDRV V    Q  S N   ++PC  WL K K    L + L PS+
Sbjct:   30 DGEDELEHEYYKAKVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSKSESA-FEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPM--DMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLE-----GGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLY--EMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPN---NKWFKPGIIEKFRMELPDLGRFYKIRAW-----HDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREM-----TAEGPTVRRI-----MGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNV--EFPCLRWLDKDKDDGQLVRELLPSD 676          

HSP 10 Score: 95.9005 bits (237), Expect = 6.806e-19
Identity = 73/293 (24.91%), Postives = 132/293 (45.05%), Query Frame = 1
Query:  466 DCYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEH----DGLEPKDS--WLLQGVEIMNVENKRIWLFTCNHWLSL-----YKEDGKVSRELFAFKS-----VRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            DC+ S  + ++  LR  +          +E  Y++ + T +  G  T   +++ + G K       ++   +            G+T  F      LGD+ S+ + H    D   PK    W ++ + I  +E   ++ F C+  + L     Y +  +V++   +F S     V  KYE++V TG    +GTD+ VF+++ G  G + + +L ++    F+RG T +F +    +G + K+R+  D SG  S W +++V +T+         F C  WL K  GD  T RE+
Sbjct: 1781 DCWLSKSEGDRQTLRDFACANNEIRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENSSRQRA------FRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKIQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGV-ATIFSCGRWLDKSRGDGLTWREL 2064          

HSP 11 Score: 61.2326 bits (147), Expect = 2.366e-8
Identity = 38/124 (30.65%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+V VTT    GAGT   ++++I G   +  +  LK+  ++           GST  F +   +LG+L  + +EHD       WL++ VE+ N       +F+C  WL   + DG   RELF
Sbjct: 1949 VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL-------FERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGVATIFSCGRWLDKSRGDGLTWRELF 2065          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Mouse
Match: Loxhd1 (lipoxygenase homology domains 1 [Source:MGI Symbol;Acc:MGI:1914609])

HSP 1 Score: 915.99 bits (2366), Expect = 0.000e+0
Identity = 658/2114 (31.13%), Postives = 1052/2114 (49.76%), Query Frame = 1
Query:  898 EDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELTGT---TLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT----LEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFK-----INAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRS--PSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDES--DEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK------FESGNCDEFQVKCCDLGE-LKKIRIGHDNSGPNADWHLAKVEIE---AEKLG-QSFVFPCNEWISKSKVDGNLERELYPQLSLT--------------MTKRPK--IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKS-KLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMN----------ALGESIDQVD------SVANILQKK---AYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERK-TSRIFSIQD--KMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDK--NEDNFERGHRDHFKL-EMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIN-----DIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWH--NNSGFSSR----WHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDR--QIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELK 6972
            EDG+   E   +K+    YE+V  TGD+  +GTD+ VFI+L G  G+SP++ L  ++   F++     F +    VG I KIRI  D +G  +SWYLDRV +TD+K P  RY+F C NWLSK  GD    R++  + + M +    +Y+I  YT +  GAG+ AD++I IFGE G++    ++N KD F++G+  + TL    LG L KI VG+ N G    WFL+K+II D+   R ++FP  +WL+  + +G +++ + V           Y + + TG+   A T S+ Y+++ G           +++ KI++E   F  G TD+  ++L   LSPL+ +  G    G N+ W+ + +VI CP TGI+Q+F C NWL   +     E  L E +S RK +      +  W + ++T+D+K A TNS + + +YG  G+TD+I++ P +     G + +FR EL  +G  YK+RA HD     S W+LEK+ +   +N D+Y F CNRWL  + +D   VRE+ A GP + +   + +Y+V + TG    AGTDANV++ ++G+ GDTG+R L +   NT+ FEKG  DEF IE+V +  + ++++ HD K +GSGW++D+V++ EE  P S++V F C  W D  + DG  VREL  +     L    Y + VKTG V GA TDS V+I+++G+  DT    L  S  N K+ FE G  D F +E  +IG I  + I HD TG  + WF+  + + VP+ G +Y F  N+WLD       LE +L PS++ +I K + Y+I ++TGDV  AGT S+VF+QIYG++ KT+ L L S+S  F+RG++D+F+     I A D+G + KIRI HD      GWFLD+V                     +  Y       + ++D   + R   P  +S    SE EE                  D+N +    L   +K    S        V +KTG++  +GTDANVF+T+FG   ++G   LK++  NS +KFE  S++ F ++ +DLG L K++I HDN+     W++D+V V+  S      FPC  WLA N+D G + +D+F A              + Q ++Y       + + +YT+    AGTDAN+ I++YG       +  +Q    +NK      FE  +   F V+  D+GE ++KIRIGHDN+G N  WH + V+I     EK G ++  FPC+ W++ S+ D    REL P    T                + P   + Y +   T N  GAGT+A VYI +YG    T +  L  + +++ K + G  D F +   D+   I KI++ HDN    + W++EKV +     N      + F C RWL+  +EDG +ER     +     S N          AL   +  VD       + + +Q      Y + V TG   E  T++  F+ + GE+ +   R  +D       F   +++EF    +D+G + KI++ HD +   +  W ++++ +        Y   C  WL+K + D    R                           + LD+                      + + Y +T+ TG     G+    +M LYG  N  T  ++L K +   F     +   +E  D+    ++ I  +G+     W+L  I ++    G L     G WLS+  G++     I ++ D  +MM   S    Y +SV T D+   GT++ +F+ +FG  G+S    L +  N + FER + D F   +M  +G + K+R+ +D  G  P W L  +D+ + S +E+++F+ + +LSK+ G ++ L  D A  N     ++++T Y+++++T N     T   V +   G    S +  ++   +  + F+    D F F D + LGD++   V H      F  +    WH++ I + E++    + F C+  + +    +  ++F       +      S     YEV V TG +  AG   +V+   +G    + K  ++  +    LF R S D+  +  + LGEL+
Sbjct:   29 EDGEDELEHEYYKA--KVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSKSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGG--AETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGN-------KNSGKIFLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKR----LKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRV-------------DITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEG-------------GGQGDNNPLDNLALEQKDKSTTFS--------VTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNS-DKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHA--------------ELQTRLYT--PFVPYEITLYTSDVFAAGTDANIFIVIYG----CDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADL-GVIYKIKLRHDNTKWCADWYVEKVEI----WNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGAS-PESCWLVEELCLAVPTQGTKYTLRCNCWLAKDRGDGVTSRVF-------------------------DLLDAMV----------------VNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGI-NGSTEEVQLDKKKAR-FEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTS----YTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLR-DFACANNEIRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENSSR-QRAFRKGTTDTFEF-DSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKIQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELR 2012          

HSP 2 Score: 750.74 bits (1937), Expect = 0.000e+0
Identity = 454/1269 (35.78%), Postives = 708/1269 (55.79%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSL---DKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKD---------NKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNLNNASDKSKL--QTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-----DKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERS-NAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNY-FAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAG-MPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK-KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEK 7407
            +Y F  NRWL  ++ D  +  EL P++     +   K + Y +++ TG+  G+GT + VF+ I+G+ G +    L  +  + V     K +   D F I AIDLG L KI+IRHDN+     W+LD V + D ++E  Y FPC  WLA  +D G LS+++ P + +     +D         N LD     + Q+DK   F+V + T  K  AGTDANV I L+G  +++G+  LK S T+S+KFE  + + F V+  DLG+L K+RIGHDN+G    W +  VE++A  LG+   FPC  W++K++ DG++ R+L+     T    P + YEIT  TS+   AGT+AN++I +YG +  CT +  L     + KL  +      F V +EDV + IEKIRIGHDN G+   WH   V ++RLL  K+ +    FPC+RWLA  E+D    REL+P     +K ++ GS+  + + +++       L    Y+++++TG     GT+A V++ +YG+ GD+GER L  S+  T+KFEK   D F  EA DLG ++KI +RHDN+ +   DW+++K+EI +  + + +LF C RWLS  K+D +++R  Y   Y G+RS N  S       + S+   D   D   G    +  D         I Y +++ TG  K+  +    ++ L G  +  TN I L   +    F+ GS E   V   DV  IK++E+ ++G   ES W +  + + +PT+G  Y + C  WL+K  G+  TSR+F + D M+ N+ KK+ Y ++V TGDV  GGT+S +F+ L+G  G++    LDK +  FER   D F +E+ D+    K+RI+ DG G RP WFLE++ + N +T +   F Y ++LS+  G KK L  ++  + D    ++ T Y V VKTS++  AGT + V +  +GE GDSG L LK     NK F+ N  D F F DMLSLG L + +VWH+N G    WHL Y+++K+     +++F C+ WLS ++ DRQ  R+  C N  N  +    ET+YE+ + TG   N G    +VW +  G KN S +F++EN+  +++ F + + D  +   ++LG++ ++ +G +  ++      +  W    + +  +     Y F     I +  K +    ++F+++   E    ++++ L     VKYE++V TG   G GTDANVF+T+FG N ++GKR L QK RNLFE+G  D+F LE ++LG++ K
Sbjct:  780 QYTFPANRWLDKNQADGRLEVELYPSE----VVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKT--EVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLD--NLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYGCDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEP------LDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCA-DWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQD------GPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAMVVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKG-KKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLRDFACAN--NEIRDELEETTYEIVIETG---NGGETRENVWLILEGRKNRSKEFLVENS-SRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYF--KVFEVTKTTE-SFASKIQSLVP---VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRK 2013          

HSP 3 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 561/1918 (29.25%), Postives = 925/1918 (48.23%), Query Frame = 1
Query: 2116 FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPA--DSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGD-EYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRE-LTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGD--TGNVQLKTSMTNKNKFEFGATDLFKIE-AEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLE-------YDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE----SDEYLFPCFSWLATNKDGGHLSKDIFPANP-AMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK-----FESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNAS---DKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-DKVIRRGSMNALGESIDQVDSVANI-LQKK----AYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYG-------PKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDV-ENIKQVEICNEGVDRESSWYLNSISIE--MPTKGKLYNVT--CGVWLSKFMGERKTSR------IFS---IQDKMMTNVSKKI-------TYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN---FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLA------------------------------IDL----APINDIKK----TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFR--ELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKL-FSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGR-NLFEQGQEDKF-ILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            +    + V   T D++ A T++ V + L+G+NG +  + + +  +S  +  +V  FR     VG+ YK+R +HDN+G N+SW L+++++T        Y F CN WLS    D    R++ A+   +  P    KY++++YTG+ + AGTDA+VFINI+GE GDTG+R L +   N   FEKG  D+F ++A  LG + KI +GH++K   +GWF+ K+II E+        F  N W    E DG   R+ L G      +TY V V TG ++GAGT S +++ ++G  G+  +G + L+  +     F+ G TD+F I+ A  +  +  + I H + G    W+ +++ ++ P  G++  F  + WLD K  +       Y++   +  ++ K  P+ + V+T D+  AGT+S +FIQIYGK  +TD++ L   +  F+ G  + F++   D+G   KIR  HD + PGSGW                                                      L +++     N D+Y F CNRWL ++EDDN IVRE+  T E       +   +Y V V TG   G+GTDANV+L +FG  GD+GER L N  +N+ + FE+ + D+F I+++ +  + ++++RHD    G+ WYLD VLV +E    SD   FPC  WL  +KD G L +++ P++  A  K+++                   +++ V T     A TD+ V+I LYGE +D+    +KQ L  S+      FE G  DEF ++  ++G + ++ IGHD++G +A W L  V+I   + G+ + FP N W+ K++ DG LE ELYP   + + K   + YEI   T +  GAGT + V++Q+YG    TE   L++ S   D+       TD F +   D+   + KIRI HDN G    W L++V +     + N    Y FPC RWLA +E+DG + RELLP D+     S +  G      + + N+ L++K     +++ + TG +   GT+ANVF+ ++G   ++G   L  SKT++DKFE+++++ F  E +DLG ++K+ I HDN+G     WF+  +E+      +   F C RWL+K++DD  I R L+ A  Q             +Y                              T ++ Y IT+ T      G+    ++ +YG        K L TN  R QKL   +F   S     VE  DV E I+++ I ++       W+ + + I   +P K     +T  C  WL+    ++KT R      IF+   ++D  +  V K++        Y + + TG+V   GT++ +++ ++G  G++    L K+E+    FE+G  D F +E  D+G I KI++++D       W++EK++I N++  + + F    +LS  K  G+ ++L                               +D+     P+ D  +      Y V V T   K A T S   V   GE  +  +       Q  + F    ++EF +   L +G + + ++ H+ +   S W +E + +        +   CN WL+    D    R  +L+     N  K    +  YE+TV TGD    G   +++   YG    ++    E  +DK+K  F R   D   +  + +     +++     + +      +WF   + +KN+ T    +F    W+   +  +     + +I  +++       EE+ +     Y + V T    G GTDANVFI +FGEN +SG   L Q    N FE+   D F   + + LG + K+++ HD+      W L  V V++ S ++ +++ C+ WLSKS+G
Sbjct:   40 YKAKVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSKSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRG-NKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN---FEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIII-EDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRL-KKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGW-----------------------------------------------------HLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREM--TAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNT-DLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNATLKNFR-------------------YHISVKTGDVSGASTDSRVYIKLYGEKSDT----IKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKL--VHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLG-ALTKIRIRHDNTGNRPGWFLDRVDI----TDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGK-APGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQ-----------TRLY------------------------------TPFVPYEITLYTSDVFAAGTDANIFIVIYGCDAVCTRQKFLCTNK-REQKL---FFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEF-YVGGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAMVVNIGK----KVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTE----EVQLDKKKARFEREQNDTFIMEILDIAPFTKMRI-----RIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTL---VCEICAVIDG------EEMME--WTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEG 1789          

HSP 4 Score: 436.417 bits (1121), Expect = 3.205e-123
Identity = 378/1424 (26.54%), Postives = 618/1424 (43.40%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK----YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRG-----QTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR------------------------TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPV-ELNEKLSPLTEIIAGINVG----GKNQDWFLD--DIVIFCPQT-GIEQ-SFICGNWLSPSRPGCQTEVSLV----------EDLSKRKLKTVIDFTENT--WMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI---------------PA-------------------TGPGI--VKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR--ELTGTTLLG---KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKID-----KTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSD--TFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG------AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHD 4467
            Y ++V T DV GA T   +YI + G+K++  +  L     + K +       G    F +   ++G +  ++I HD       W L  V+I      + + F  N WL   + DG++  EL+  + V  +    YEI + TGD+  +GT S+VF+ + G  G   ++      ++ F RG     QT  F I A  +G ++KIRIR D +G++  W+LDRV ITD+ N E  Y+F C+ WL+ +  D    RE+    E   + S                         T + ++  T +K  AG+ A+++I +FG    + +  +K    N D F+  SI   T+    LG L K+++G+ N G  P WF++ V ++     +   FPCG+WL+  + +G  +  +   +     Y  +  YE+ + T +   A T +  ++++ G        D + +  K    N + ++ F +         +L  + EII  I +G    G N  W     DI    P+  G E  +F C  WL+ S    +T   LV          +D S R++   ++   +   + V I+T ++  A T++KV + +YGD G T +  +       +K + G+   F  E A +G+ YK++ +HDN+   + W +EK+ +    N DE+ FLC RWLS   ED    R                 PA                   TGP +  V+  P+  Y V + TG    A TD+  F+ + GE  +  +R           F  G ++EF +  + +G I KI+LGHD     S W V+++ +          T RCNCW     GDG+T R  +L    ++    KV YE+ V TG V G GTDSN+F+ ++G  G T  VQL      K +FE    D F +E  DI     +RI  D  G+   WF+++I +     G   +F+   WL  K  +  L       ID     +   Y ++V T D++ AGTD+ VFI I+G++  +  L LK  ++   FER N D F   +   +G + K+R+ HD K    GW                                                      LS +  ++ +  + + F C+ WL+  E D   +R+    + +      L+E  Y + ++TGN  G  T  NV+L + G+   S E  ++N+  +    F + + D F   +I LG +  + + H              W++  + + +    + Y F C   +   +                +K ++  K  +S     Q      + V V T  +  AGTDANV + ++G   D+G   LKQ +   N FE G+ D F ++  +LGEL+K   G D
Sbjct:  686 YHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDY----FERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEG-KTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNN-ETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYG-------CDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCL-AVPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAMVVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKK---KARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGW-----------------------------------------------------HLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLRDFACANNE--IRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENS--SRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKR------------KRKYFKVFEVTKTTESFASKIQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKWYPGWD 2019          

HSP 5 Score: 431.409 bits (1108), Expect = 1.443e-121
Identity = 328/1106 (29.66%), Postives = 520/1106 (47.02%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIM--------NVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRT----KYEIVVITGDLDDSGTDSKVFISLCG-RTGISPQIQLFKENT--QCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG-FKEGS--IFE---HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS--DVKGEGLEKILPVKK------------------------LPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKI-LDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVIPADSK-----LDSGSVVEFRTELAIVG-IPYKLRAQHDNSGTNSSWNLEKI----LMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPA----------------TGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTG--------------------------TTLLGK----------VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLE-YDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVL 3513
            Y+V V T +++GAGT   +Y+ + GD  +     L   + +           G+   F I    +  +  + + HDG      W L  V +         NVE      F C  WL   K+DG++ REL    S  T    +Y I V TGD+  + TDS+V+I L G ++    Q+ L  +N     F+RG+  +F +    +G I+++ I  D +G  + W+L  V I   +  + +Y F    WL K+  D     E+    E++ I     Y+I  +T +  GAG+ + +++QI+GE G+++V+ + ++   F  GS  IF+    T+    LG L KI++ + N G +P WFL++V I D++    + FPC +WL+  +  G+   ++LPV +                        L ++ +   + + I TG++ +A T +  ++ L G +  + + L K   TN     + KF+    ++  VE  + L  L ++  G +  GK   WF+D + +  P  G   +F CG WL+ +    + + S+V DL   +L+T +      + +++YTSD+  A T++ + +V+YG D   T    +  + +      +  S   F  EL  VG I  K+R  HDN+G N  W+   +    L+ +    +   F C+RWL+ S +D  T+RE+                      + +P  I  Y VQI+TGN   AGTDA V+I IYG+ GDTG+R+L  S   TNKFEKG  D F+IEA  LG I KIKL HD+    + W+V+KV IW + N  +   F C  W    + DG   R     E TG                           T+ G           + Y V V TGK + A TDS  F+ + G+  +  N         K  F  G+ + F +   D+G IK I + HD     S W V+++C+ VP  G KY    N WL     D  T   +DL  + +  I K + Y++TV+TGDV+  GTDS +F+ +YG +  T+++ L  K   FER   D F +   D+    K+RI  DG      WFL+++L
Sbjct:  555 YRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDL-----FEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVE------FPCLRWLDKDKDDGQLVRELLPSDSNATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGK-QYTFPANRWLDKNQADGRLEVELY-PSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTN-----SDKFERDSIEIFTVETLD-LGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKN----EDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYGCDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTN-EDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAMVVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERIL 1636          

HSP 6 Score: 417.157 bits (1071), Expect = 4.485e-117
Identity = 328/1077 (30.45%), Postives = 527/1077 (48.93%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDL-GDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRG----AKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQ--SRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAK--FKEGFTDVVPVE-LNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKL-DSGSVVEFRTELAIV-----GIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPA------------PI-----------CKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPS--NSVTFRCNCWFDSSEGDGLTVRELTGTTLLGK-----VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNK----FEFGATDLFKIEAEDIGEI-KSIRISHDDTGAGSAWFVDQICV--IVP-KLGLKYIFF-LNKWL-----DSKTLE----YDLDPSK-------------IDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            I Y V V T D++GAGT   IY+ + G + N    ++                 G T IF I  + L   L  + I H  +     W  + V I+         F C++WL   K DG + R+L+   S+R K      + + V T DL  +GT+S +FI + G+ G + +I L   N + F+ G   KF +    +G   KIR   D     S W+L+++ + +  N + +Y F C  WL  +  D+  VRE+       + IMG+A   RY+++  T    GAG+ A++Y+ +FG+    GE  + + +N  D F++G+  E T+    +  +++++V +   G    W+L++V++ +  Q  S   EFPC +WL   K +G  + ++LP        + ++Y + + TG+ + AST SR Y+ L G +      D I+    +   N K  F+ G  D   +E LN  +  +  ++ G +  G +  WFL  + I  P+ G + +F    WL  ++   + EV L         K V       + + I+T D+  A T S+V + +YG+ GKT+ + + + SK+ D GS   F+T+   +     G   K+R +HDN+G    W L+++ +T   N   Y F C RWL+   +D    RE+       V P+            P+             + V I TG+K  AGTDANVFI ++G + + G   L  S TN++KFE+  ++ F +E + LG + K+++GHD+     GWFVD V   E   PS    +TF C  W   +E DG  VR+L    L  +     V YE+ + T  V  AGTD+N+FI I+G   D    + K   TNK +    FE  +   F +E ED+GEI + IRI HD+TG    W    + +  ++P K G + + F  ++WL     D KT+     YD+   K             +++    + Y + +FTG+V  AGTD+KV+I IYG    T +  L   +++++ FE+G  D F I AAD+GVI KI++ HD  K  + W+++KV
Sbjct:  296 ITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV--------FDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEI-LLNPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKD-KYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMA---RYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDS-NATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKS-----DTIKQVLLVSDNNLKDYFERGRVDEFTLETLN--IGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLV------HYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWV---EVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYG--CDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKV 1340          

HSP 7 Score: 391.734 bits (1005), Expect = 3.096e-109
Identity = 302/1047 (28.84%), Postives = 501/1047 (47.85%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFA-FKSVRT----KYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGL-EKIL--PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIK-DKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI----PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVRE-IPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQL--KTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPS-------------------------KIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK---SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            +Y+V   T DV+GAGT   ++I++ G+    P++ L          +       +  +F +R +++G +  I IEHD      SW L  V + +++   + + F CN+WLS  + D +  R+L A F  +      KYEI V TGD+  +GTD+ VFI++ G  G + + +L  E    F++G   KF + A  +G + KI +  +  G  + W+L ++ I D+ N   +Y F    WL+ D  D    R+I  G  E   I     Y ++ +T +  GAG+ + IY+ ++G  G  +   I     F EG +F+       H      L  L ++ +G+ N G    W+  KV+I          FPC  WL + K +GL E+ L   V    +R +KY + + + T +   A T S  ++ + G + + D+IL  +   NK W     FK G  +   +EL + L    +I A  +       W L+ + +       + +F C  WL  +    + +  +V +++              + V++ T +++ A T++ V L L+GD G T + ++          + G+  EF  E   +    ++R +HD  G+ S W L+++L+ +      D  +F C RWL    +D   VRE +P+     +K     +Y + + TG+   A TD+ V+I +YGEK DT  + L  S  N  + FE+G++DEF +E + +G I+++ +GHDS    +GWF+  V I          TF  N W D ++ DG    EL  + ++     V YE+E+ TG V GAGT S VF++I+G+ G T  + L  ++ + ++   +   TD F I A D+G +  IRI HD+TG    WF+D++ +        Y F   +WL    D   L  +L P                           +++ DK+  + +T+ TGD  +AGTD+ VFI ++G         LKS    SD FER + ++F +   D+G + K+RIGHD      GWF+D V
Sbjct:   44 VYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHL-------TSKSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN-FEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKR-KYDFPLNRWLALDEDDGKIQRDILVGGAETTAIT----YIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKI-----FLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEIL--LNPNNK-W-----FKPGIIEKFRMELPD-LGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDAN----EDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNATLKNF---RYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQI-RVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWV 1055          

HSP 8 Score: 219.55 bits (558), Expect = 2.210e-56
Identity = 187/677 (27.62%), Postives = 307/677 (45.35%), Query Frame = 1
Query: 5581 DENDTAQTEYI---AYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISI-EMPTKGKLYNVTCGVWLSKFMGERKTSR-IFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL--VQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQV----QNLSTNKIWKYPCNEWLSKSKG---LWKILTPSE 7563
            D  D  + EY     Y +   TG  +  G+    ++ L+G   L   +    K E+  F   + +V  V   +V  I ++ I ++     +SWYL+ + + +M      Y   C  WLSK  G+R+  R + +  D M  ++ +   Y I V TGDV   GT++ +F+ +FG  G++    L+  +DNFE+G  D F L+  D+G++ KI + ++  G    WFL K+ I +      Y F  N +L+ +    K     L    +     Y V V T +++ AGT S + +  YG  G  +SG + L+        F   + D F     + L  LSR  + H N G +  W+ E + +    T     FPC+ WL     D  I R+L      +  K    +  + + V T D K AG    ++   YG+K  +D+ ++  N    K F     +K ++    LG    I+       ++  +    W   ++ + N      Y F    W++ +E   E   E+       E P   R+      G+ +Y + V TG+  G GTDANV++ LFG+  ++G+R L   +   +LFE+G  D+F +E V + K+ ++++ HD     S W+LDRV V    Q  S N   ++PC  WL K K    L + L PS+
Sbjct:   30 DGEDELEHEYYKAKVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSKSESA-FEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPM--DMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLE-----GGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLY--EMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPN---NKWFKPGIIEKFRMELPDLGRFYKIRAW-----HDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREM-----TAEGPTVRRI-----MGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNV--EFPCLRWLDKDKDDGQLVRELLPSD 676          

HSP 9 Score: 207.994 bits (528), Expect = 6.084e-53
Identity = 195/788 (24.75%), Postives = 335/788 (42.51%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF---------------------AFKSVRTKYEIVVITGDLDD---------------------SGTDSKVFISLCGRTG-ISPQIQL-FKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR--EIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK---LDSGSVVEFR------TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED-----FSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHD 2724
            D +LY V + T +V GAGT   +YI+I GD  +     L K +    K        G+   F I  +DLG +  I + HD  +    W ++ VEI N  N+  +LF C  WLSL KEDG++ R  +                     A  S     +I  +TG + D                     + TDS+ F+ L G     + +I L + +  + F  G   +F +    VG I KI +  D +  +S W ++ +C+  +     +Y  +C  WL+KD GD  T R  ++  A  ++ I  +  Y+++ +T +  G G+ ++I++ ++G NG ++ + + K K  F+        + +  +    K+++     G +P WFL ++++ +++   +  F  G WLS  KG+   + +I  V    E  +   Y + + T +   A T +  ++I+ G       L   +S N  W    KF+   TD         L  L ++    +  G    W L  + +          F C  WLS S    QT    + D +    +   +  E T+ + I T +     T   V L+L G   ++ + ++   S+      G+   F        ++A + + +  R           W+++ I +T+   G+ Y F C+  +    +      F   +   +    I    P+ KY+V + TG +  AGTDANVF+ I+G  GDTG R L     N   FE+G  D F +E ++LG + K   G D
Sbjct: 1253 DIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNK-----FEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCLA-VPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAM-VVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSAN--W---NKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQT----LRDFACANNEIRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENSSRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKIQSLVPV-KYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL--FERGSTDRFFLETLELGELRKWYPGWD 2019          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Mouse
Match: Loxhd1 (lipoxygenase homology domains 1 [Source:MGI Symbol;Acc:MGI:1914609])

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 472/1323 (35.68%), Postives = 715/1323 (54.04%), Query Frame = 1
Query: 3691 IDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKN-GDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKD---------NKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNLNNASDKSKL--QTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-----DKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGER-SNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNY-FAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAG-MPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK-KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTPS 7560
            I +Y F  NRWLA  ++DN +V EL+P  + G P  N     Y V V TGN   +GTDANV+LTI+G+  GD+GER LK +  +  NKFE+   D F I AIDLG L KI+IRHDN+     W+LD V + D ++E  Y FPC  WLA  +D G LS+++ P + +     +D         N LD     + Q+DK   F+V + T  K  AGTDANV I L+G  +++G+  LK S T+S+KFE  + + F V+  DLG+L K+RIGHDN+G    W +  VE++A  LG+   FPC  W++K++ DG++ R+L+     T    P + YEIT  TS+   AGT+AN++I +YG +  CT +  L     + KL  +      F V +EDV + IEKIRIGHDN G+   WH   V ++RLL  K+ +    FPC+RWLA  E+D    REL+P     +K ++ GS+  + + +++       L    Y+++++TG     GT+A V++ +YG+ GD+GER L  S+  T+KFEK   D F  EA DLG ++KI +RHDN+ +   DW+++K+EI +  + + +LF C RWLS  K+D +++R  Y   Y G+R SN  S       + S+   D   D   G    +  D         I Y +++ TG  K+  +    ++ L G  +  TN I L   +    F+ GS E   V   DV  IK++E+                         LY +T  VW    +G                                   GGT+S +F+ L+G  G++    LDK +  FER   D F +E+ D+    K+RI+ DG G RP WFLE++ + N +T +   F Y ++LS+  G KK L  ++  + D    ++ T Y V VKTS++  AGT + V +  +GE GDSG L LK     NK F+ N  D F F DMLSLG L + +VWH+N G    WHL Y+++K+     +++F C+ WLS ++ DRQ  R+  C N  N  +    ET+YE+ + TG   N G    +VW +  G KN S +F++EN+  +++ F + + D  +   ++LG++ ++ +G +  ++      +  W    + +  +     Y F     I +  K +    ++F+++   E    ++++ L     VKYE++V TG   G GTDANVF+T+FG N ++GKR L QK RNLFE+G  D+F LE ++LG++ K+++EHD S + S W +++V+V N ST     + C  WL KS+G    W+ L PS
Sbjct:  991 IVQYKFDVNRWLARGKEDNELVVELVPAGQSG-PEPN----TYEVQVITGNVPKAGTDANVYLTIYGEEYGDTGERPLKKS--DKSNKFEQGQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLD--NLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYGCDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEP------LDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWC-ADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQD------GPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIEV-------------------------LYEMT--VWTGDVVG-----------------------------------GGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKG-KKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLRDFACAN--NEIRDELEETTYEIVIETG---NGGETRENVWLILEGRKNRSKEFLVENS-SRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYF--KVFEVTKTTE-SFASKIQSLVP---VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGVATIFSCGRWLDKSRGDGLTWRELFPS 2215          

HSP 2 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 345/888 (38.85%), Postives = 523/888 (58.90%), Query Frame = 1
Query:  883 LSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELTGT---TLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT----LEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            L+   EDG+   E   +K+    YE+V  TGD+  +GTD+ VFI+L G  G+SP++ L  ++   F++     F +    VG I KIRI  D +G  +SWYLDRV +TD+K P  RY+F C NWLSK  GD    R++  + + M +    +Y+I  YT +  GAG+ AD++I IFGE G++    ++N KD F++G+  + TL    LG L KI VG+ N G    WFL+K+II D+   R ++FP  +WL+  + +G +++ + V           Y + + TG+   A T S+ Y+++ G           +++ KI++E   F  G TD+  ++L   LSPL+ +  G    G N+ W+ + +VI CP TGI+Q+F C NWL   +     E  L E +S RK +      +  W + ++T+D+K A TNS + + +YG  G+TD+I++ P +     G + +FR EL  +G  YK+RA HD     S W+LEK+ +   +N D+Y F CNRWL  + +D   VRE+ A GP + +   + +Y+V + TG    AGTDANV++ ++G+ GDTG+R L +   NT+ FEKG  DEF IE+V +  + ++++ HD K +GSGW++D+V++ EE  P S++V F C  W D  + DG  VREL  +     L    Y + VKTG V GA TDS V+I+++G+  DT    L  S  N K+ FE G  D F +E  +IG I  + I HD TG  + WF+  + + VP+ G +Y F  N+WLD       LE +L PS++ +I K + Y+I ++TGDV  AGT S+VF+QIYG++ KT+ L L S+S  F+RG++D+F++ A DVG I KIR+GH G+  G  WF+D V
Sbjct:   24 LNYDSEDGEDELEHEYYKA--KVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSKSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGG--AETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGN-------KNSGKIFLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKR----LKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQLEAVDVGEIYKIRLGHTGEGFGPSWFVDTV 896          

HSP 3 Score: 490.345 bits (1261), Expect = 5.915e-140
Identity = 317/962 (32.95%), Postives = 507/962 (52.70%), Query Frame = 1
Query: 2116 FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPA--DSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGD-EYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRE-LTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGD--TGNVQLKTSMTNKNKFEFGATDLFKIE-AEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLE-------YDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE----SDEYLFPCFSWLATNKDGGHLSKDIFPANP-AMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK-----FESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKL-QTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANK 4926
            +    + V   T D++ A T++ V + L+G+NG +  + + +  +S  +  +V  FR     VG+ YK+R +HDN+G N+SW L+++++T        Y F CN WLS    D    R++ A+   +  P    KY++++YTG+ + AGTDA+VFINI+GE GDTG+R L +   N   FEKG  D+F ++A  LG + KI +GH++K   +GWF+ K+II E+        F  N W    E DG   R+ L G      +TY V V TG ++GAGT S +++ ++G  G+  +G + L+  +     F+ G TD+F I+ A  +  +  + I H + G    W+ +++ ++ P  G++  F  + WLD K  +       Y++   +  ++ K  P+ + V+T D+  AGT+S +FIQIYGK  +TD++ L   +  F+ G  + F++   D+G   KIR  HD + PGSGW                                                      L +++     N D+Y F CNRWL ++EDDN IVRE+  T E       +   +Y V V TG   G+GTDANV+L +FG  GD+GER L N  +N+ + FE+ + D+F I+++ +  + ++++RHD    G+ WYLD VLV +E    SD   FPC  WL  +KD G L +++ P++  A  K+++                   +++ V T     A TD+ V+I LYGE +D+    +KQ L  S+      FE G  DEF ++  ++G + ++ IGHD++G +A W L  V+I   + G+ + FP N W+ K++ DG LE ELYP   + + K   + YEI   T +  GAGT + V++Q+YG    TE   L   S +SK+   G  D+F +   DV + I KIR+GH  +G G +W ++ V ++ L+  +
Sbjct:   40 YKAKVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSKSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRG-NKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN---FEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIII-EDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRL-KKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGW-----------------------------------------------------HLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREM--TAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNT-DLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNATLKNFR-------------------YHISVKTGDVSGASTDSRVYIKLYGEKSDT----IKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKL--VHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFL---SSRSKVFDRGSKDIFQLEAVDVGE-IYKIRLGHTGEGFGPSWFVDTVWLRHLVVQE 905          

HSP 4 Score: 382.104 bits (980), Expect = 4.036e-106
Identity = 268/862 (31.09%), Postives = 424/862 (49.19%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGE--TNDSGIIPLKQSLTHSNKFESGNCDEFQVK-CCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNET--YLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKN--LKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKL 6249
            RY+F CN WL+  E D    R+LL +    +P+   +  KY + V TG+  G+GTDA+VF+ IFG+ GD+GER L+N  DN    FE+ + DKF + A DLG L KI + H+N  G A W+L  +++ D  ++  Y FP   WLA ++D G + +DI                         E     + V V+T     AGT + +++++YG     +SG I L+  +     F+ G  D F +     L  L ++ IGH N G N  W+  KV I     G    FPC+ W+ + K DG +ER+LY  +SL   +  K  + +   T++ K AGTN+ ++IQ+YG+   T++  LN   +    + G  + F + + D+     KIR  HD +  GS WHLEK+ +   + NK+K   Y F CNRWL  +E+D  I RE           M A G ++ ++  +A       Y + V TG     GT+ANV+L ++G+ GD+GER L + + +TD FEK N DEF  E+V + KV ++ +RHD  G     W+L ++ + ++   E+    F C RWL K KDD ++ R L                                           +D N T +     Y I++ TG      +    +++LYG K+  +K  ++       +YF  G  +  ++E  ++  I ++ I ++     + W+L S+ I +P +GK Y      WL K   + +      +    +  + K + Y I + TGDV   GT S +F+Q++G +G + +  L      F+RG +D F+LE  DVG+I KIR+ + G G  P WF++ +
Sbjct:  137 RYYFNCNNWLSKVEGDRQWCRDLLAS---FDPMDMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN----FEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGA--------------------ETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLN--PNNKWFKPGIIEKFRMELPDL-GRFYKIRAWHDRQNPGSGWHLEKMTLMNTI-NKDK---YNFNCNRWLDANEDDNEIVRE-----------MTAEGPTVRRIMGMAR------YRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKG-SGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVREL-----------------------------------------LPSDSNATLKN--FRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLE--VELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQLEAVDVGEIYKIRLGHTGEGFGPSWFVDTV 896          

HSP 5 Score: 377.096 bits (967), Expect = 1.339e-104
Identity = 352/1335 (26.37%), Postives = 576/1335 (43.15%), Query Frame = 1
Query:  865 FTCNHWLSLYKEDGKVSRELFAFKSVRTK---YEIVVITGDLDDSGTDSKVFISLCGR----TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR------------------------TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPV-ELNEKLSPLTEIIAGINVG----GKNQDWFLD--DIVIFCPQT-GIEQ-SFICGNWLSPSRPGCQTEVSLV----------EDLSKRKLKTVIDFTENT--WMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVR---EIPATG---PGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKID-----KTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSD--TFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG------AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQL 4614
            F  N WL+  KED ++  EL        +   YE+ VITG++  +GTD+ V++++ G     TG  P  +  K N   F++GQT  F I A  +G ++KIRIR D +G++  W+LDRV ITD+ N E  Y+F C+ WL+ +  D    RE+    E   + S                         T + ++  T +K  AG+ A+++I +FG    + +  +K    N D F+  SI   T+    LG L K+++G+ N G  P WF++ V ++     +   FPCG+WL+  + +G  +  +   +     Y  +  YE+ + T +   A T +  ++++ G        D + +  K    N + ++ F +         +L  + EII  I +G    G N  W     DI    P+  G E  +F C  WL+ S    +T   LV          +D S R++   ++   +   + V I+T ++  A T++KV + +YGD G T +  +       +K + G+   F  E A +G+ YK++ +HDN+   + W +EK+ +    N DE+ FLC RWLS   ED    R   E   TG        PA   +  +     +  MA  D +       +    G     + +  T K ++   D      +         +G D +     W            P     F C    +   G GL V    G     +V YE+ V TG V G GTDSN+F+ ++G  G T  VQL      K +FE    D F +E  DI     +RI  D  G+   WF+++I +     G   +F+   WL  K  +  L       ID     +   Y ++V T D++ AGTD+ VFI I+G++  +  L LK  ++   FER N D F   +   +G + K+R+ HD K    GW                                                      LS +  ++ +  + + F C+ WL+  E D   +R+    + +      L+E  Y + ++TGN  G  T  NV+L + G+   S E  ++N+  +    F + + D F   +I LG +  + + H              W++  + + +    + Y F C   +   +                +K ++  K  +S     Q      + V V T  +  AGTDANV + ++G   D+G   LKQ +   N FE G+ D F ++  +LGEL+K+R+ HD+SG  + W + KVE+     G + +F C  W+ KS+ DG   REL+P +
Sbjct:  996 FDVNRWLARGKEDNELVVELVPAGQSGPEPNTYEVQVITGNVPKAGTDANVYLTIYGEEYGDTGERPLKKSDKSNK--FEQGQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNN-ETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYG-------CDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIAL-----SSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLL---------IGEDDECTNRIWL---------DYPQGKRGFSCGSVEEFYVG-GLDV----GIIKKIEVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKK---KARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGW-----------------------------------------------------HLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLRDFACANNE--IRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENS--SRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKR------------KRKYFKVFEVTKTTESFASKIQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGVATIFSCGRWLDKSRGDGLTWRELFPSV 2216          

HSP 6 Score: 370.933 bits (951), Expect = 1.233e-102
Identity = 289/1010 (28.61%), Postives = 474/1010 (46.93%), Query Frame = 1
Query: 2890 TYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVI-VPKLGLKYIFFLNKWLD--------SKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNG--DSGERALKNTVDNSVNKFEEKSLDKFLIK-AIDLGTLEKIKIRHDNSNGGAAWYLDYV--LVNDESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGR-NDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGETG--TNANVFLKVYGENGDSGERQLVDSKTHT-DKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSI 5865
             YEV   TG V+GAGTD+NVFI +FG+ G +  + L +   +++ FE    D+F++   ++G I  IRI HD+TG  ++W++D++ V  + +  L+Y F  N WL          + L    DP  + + +K   Y+I V+TGDV+ AGTD+ VFI I+G+   T +  L+++ D FE+G ED F ++A D+G + KI +GH+ K   +GWF                                                     LS+I  ++  N  +Y F  NRWLA DEDD  I R++L    +   ++      Y+V V TG+  G+GT + ++L ++G  G  +SG+  L+  V      F+    D F I  A+ L  L ++ I H N      WY + V  L      +  FPC +WL   K  G + + ++              L K + K Y       +++ V+TT    AGT++ + I +YG+   +  I L     ++  F+ G  ++F+++  DLG   KIR  HD   P + WHL K+ +        + F CN W+  ++ D  + RE+  +           +Y +T  T   +GAGT+ANVY+ ++G   D  E+   N  ++    + G  D F +    +          HD KG GS W+L++VLV+     + +S   EFPC RWL +D++DG + RELLP                   DS A  L+   Y I V TG  +G  T++ V++K+YGE  D+ ++ L+ S  +  D FE+  +DEF  E +++G + ++ I HD++G     WFL  ++I      + Y F   RWL K++ D +++  LY           PS             ++ QK                      + Y I I TG     G++   ++++YG +  KT ++ L    +  F  GSK++  +EA DV  I ++ + + G     SW+++++
Sbjct:   44 VYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSK--SESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRGNK---YEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWF-----------------------------------------------------LSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAIT------YIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV------FDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEM----------VSLRKKRLKKYP------WSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNP---NNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVR-HDGKGSGSGWYLDRVLVRE--EGQPESDNVEFPCLRWLDKDKDDGQLVRELLPS------------------DSNAT-LKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTG-MHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELY-----------PS-----------EVVEIQK---------------------LVHYEIEIWTGDVGGAGTTSRVFVQIYGEEG-KTEVLFLSS-RSKVFDRGSKDIFQLEAVDVGEIYKIRLGHTGEGFGPSWFVDTV 896          

HSP 7 Score: 358.221 bits (918), Expect = 1.087e-98
Identity = 274/960 (28.54%), Postives = 458/960 (47.71%), Query Frame = 1
Query: 4648 YEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVE-APDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWL----SKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKK----TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRS--WKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDK---FIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNL 7479
            YE+ T T + +GAGT+ANV+I ++G N  + K +L + S+ S  +    DVF V   +V   I KIRI HDN GL ++W+L++V+V  +   K   + Y F CN WL++ E D    R+LL               S D +D    + +   Y I+VYTG     GT+A+VF+ ++GE GD+GER+L + K   D FEK   D+F  +A DLG++ KI++ H+N G     WFL KI I D  +   Y F   RWL+  +DD KIQR + + G                                             A+T  I Y +T+ TG  +  G+    ++ +YG +  K +      LE   F  G  ++  ++ A  +  + +V I +  +     WY   + I  P  G      C  WL    +  + ER+   + S++ K +    KK  + + V T D+ + GTNS +F+Q++G +G +    L+ N   F+ G  + F++E+ D+G+  KIR  +D       W LEK+ + N    + Y F  N +L  N    + +    A    +++      Y+V V T  ++ AGT + V +  +G+ GD+G+  L     N   F+    DEF   + +++  + R +V H+  G  S W+L+ + ++E     S   +FPC +WL    DD Q+ REL+    P+ +  +     Y ++V TGD   A     V+   YGEK+ + K    + +NN+  +  F R   D+  +  + +G +  + +G     ++       WF   V ++     K Y F    W++ ++     + E++           + V E++K  +V YEI + TG   G GT + VF+ ++GE  ++    L  + + +F++G +D F LE VD+G+I KI++ H    F   WF+D V +++L
Sbjct:   45 YEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSKSE-SAFEKANVDVFRVRTNNVG-LIYKIRIEHDNTGLNASWYLDRVIVTDM---KRPHLRYYFNCNNWLSKVEGDRQWCRDLLA--------------SFDPMD----MPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEK---DNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGG-SAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGG---------------------------------------------AETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIF--LEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRL----KKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTI-ESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELL----PSDSNATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNL--KDYFERGRVDEFTLETLNIGTINRLVIG-----HDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELY----------PSEVVEIQK--LVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSK-VFDRGSKDIFQLEAVDVGEIYKIRLGHTGEGFGPSWFVDTVWLRHL 901          

HSP 8 Score: 347.821 bits (891), Expect = 1.369e-95
Identity = 258/965 (26.74%), Postives = 461/965 (47.77%), Query Frame = 1
Query: 1690 ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIF-CPQTGIEQSFICGNWLSP---SRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD-SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGD--TGDRFLTHSTTNTNKFEKGQMDEFLIE-AVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVRELTGTT-----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK------TLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVN--DESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKV 4506
            E Y+   YE+  +TG+   A T +  ++ L G   ++ +  K+  T+K     + F++   DV  V  N  +  + +I    +  G N  W+LD +++    +  +   F C NWLS     R  C+  ++  + +   +         N + + +YT D+  A T++ V + ++G+ G T +  +  +    + G+  +F  +   +G   K+   H+N G ++ W L KI++    N  +Y F  NRWL+   +D    R+I   G           Y V ++TG+   AGT + +++ +YG +G+  +G  FL         F++G+ D F I+ AV L  +S++ +GH +     GW+ +KV+I     P   +  TF C+ W D  + DGL  R+L          L K  + + V T  ++ AGT+S +FI+I+G+ G T  + L     N   F+ G  + F++E  D+G    IR  HD    GS W ++++ ++      KY F  N+WLD+         E   +   + +I     Y++TV TG++  AGTD+ V++ ++G    T +  L   ++ +D FE+GN D F I +  +  ++++R+ HDGK  GSGW+LD+VL                                                   + E+ +   D   F C RWL  D+DD  +VRELLP+D      + LK  +Y + VKTG+  G+ TD+ V++ ++G+  D+ ++ L  + +N  + FE   +D+F ++ +++GT+ ++ I HD++   A W+L  V +    +  +Y FP   WL  N+  G L  +++P+                  ++ +  KL ++ ++++T     AGT + V + +YGE   + ++ L    + S  F+ G+ D FQ++  D+GE+ KIR+GH   G    W +  V
Sbjct:   38 EYYKAKVYEVVTATGDVRGAGTDANVFITLFG---ENGLSPKLHLTSK---SESAFEKANVDVFRVRTN-NVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPR--------GNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGA----ETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVI---LCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNP---NNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVL---------------------------------------------------VREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSN----ATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPS------------------EVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLS---SRSKVFDRGSKDIFQLEAVDVGEIYKIRLGHTGEGFGPSWFVDTV 896          

HSP 9 Score: 342.428 bits (877), Expect = 6.116e-94
Identity = 261/895 (29.16%), Postives = 438/895 (48.94%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFA-FKSVRT----KYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL-EKIL--PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIK-DKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI----PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVRE-IPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQI 3144
            +Y+V   T DV+GAGT   ++I++ G+    P++ L          +       +  +F +R +++G +  I IEHD      SW L  V + +++   + + F CN+WLS  + D +  R+L A F  +      KYEI V TGD+  +GTD+ VFI++ G  G + + +L  E    F++G   KF + A  +G + KI +  +  G  + W+L ++ I D+ N   +Y F    WL+ D  D    R+I  G  E   I     Y ++ +T +  GAG+ + IY+ ++G  G  +   I     F EG +F+       H      L  L ++ +G+ N G    W+  KV+I      + Q+    FPC  WL + K +GL E+ L   V    +R +KY + + + T +   A T S  ++ + G + + D+IL  +   NK W     FK G  +   +EL + L    +I A  +       W L+ + +       + +F C  WL  +    + +  +V +++              + V++ T +++ A T++ V L L+GD G T + ++          + G+  EF  E   +    ++R +HD  G+ S W L+++L+ +      D  +F C RWL    +D   VRE +P+     +K     +Y + + TG+   A TD+ V+I +YGEK DT  + L  S  N  + FE+G++DEF +E + +G I+++ +GHDS    +GWF+  V I          TF  N W D ++ DG    EL  + ++     V YE+E+ TG V GAGT S VF++I+G+ G T  + L    +    F+ G+ D+F++EA D+GEI  IR+ H   G G +WFVD +
Sbjct:   44 VYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHL-------TSKSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN-FEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKR-KYDFPLNRWLALDEDDGKIQRDILVGGAETTAIT----YIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKI-----FLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQT----FPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEIL--LNPNNK-W-----FKPGIIEKFRMELPD-LGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDAN----EDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNATLKN---FRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQI-RVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLS---SRSKVFDRGSKDIFQLEAVDVGEIYKIRLGHTGEGFGPSWFVDTV 896          

HSP 10 Score: 340.502 bits (872), Expect = 3.047e-93
Identity = 270/966 (27.95%), Postives = 460/966 (47.62%), Query Frame = 1
Query: 3817 YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESD---EYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGC-----TDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHD--NSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGP-KNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNV--TCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNS---SLYPLDKN-EDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAP--INDIKK-TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEV 6648
            Y V   TG+  G+GTDANVF+T+FG+NG S +  L +    S + FE+ ++D F ++  ++G + KI+I HDN+   A+WYLD V+V D       Y F C +WL+  +      +D+                  + F      +   + +KVYT   + AGTDA+V I ++GE  D+G   L+      + FE G  D+F +   DLG+L KI +GH+N G +A W L+K+ IE     + + FP N W++  + DG ++R++    + T      I Y +T  T + +GAGT + +Y+ +YG          N  S K  L+ G      TD+F++ +  +  P+ ++ IGH N G+   W+ EKV++          I   FPC+ WL   + DG IER+L     +R+                   L+K  +++ V+T    + GTN+ +F+++YG+ G + E  L     +   F+   +++F  E  DLG+ +KI   HD  N G     W L+K+ +++  + + Y F+C RWL  ++DD +I R +   G    R     G +R                                      Y +T+ TG  +  G+    ++ L+G   +    ++   +  T+ F  G+ +  ++E+  +  +++V + ++G    S WYL+ + +    + +  NV   C  WL K   + +  R     D   T   K   Y ISV TGDV    T+S ++++L+G + ++    L   D N +D FERG  D F LE  ++G I ++ I +D  G    WFL  + I      + Y F  N +L KN     +L ++L P  + +I+K   Y++ + T +V  AGT+S V V+ YGE G +  L L +    +K F     D F   + + +G++ + ++ H   GF   W ++ + ++ +
Sbjct:   45 YEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTS---KSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLL-----------------ASFDPMDMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLEN---EKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTA----ITYIVTVFTGDIRGAGTKSKIYLVMYGARG-------NKNSGKIFLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFT----GIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKR-----------------LKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILL---NPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPG---SGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRI---MGMAR--------------------------------------YRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNAT--LKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQAD-GRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSS---RSKVFDRGSKDIFQL-EAVDVGEIYKIRLGHTGEGFGPSWFVDTVWLRHL 901          

HSP 11 Score: 326.635 bits (836), Expect = 4.586e-89
Identity = 267/965 (27.67%), Postives = 460/965 (47.67%), Query Frame = 1
Query: 4237 EDKLEN--FNVKVY-----TTKKMYAGTDANVHIILYGETNDSGIIP-LKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEI-EAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWE-AVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSS---LYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYN--EFLSKNVGQKKKLAIDLAPIND---IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKP-FKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLAT 7068
            ED+LE+  +  KVY     T     AGTDANV I L+GE   +G+ P L  +    + FE  N D F+V+  ++G + KIRI HDN+G NA W+L +V + + ++    + F CN W+SK + D    R+L          R   KYEI   T +  GAGT+A+V+I ++G    T +  L N  +K   + G  D F +   D+   + KI +GH+NKG  + W L K++++  + NK K   Y+FP NRWLA DE+DG I+R++L                +   ++ A       Y + V+TG     GT + ++L +YG  G+    ++         F++   D F  + AV L  + ++ I H N G   + W+ +K+ I+  F      F C  WL + K D  I+R LY            S R + +                                +   +++ + T   K  G++ P ++++YG K  +T+ I L      +F PG  E   +E PD+    ++   ++  +  S W+L  +++        YN  C  WL     + +  R  + +   +  +     Y ++V TG+++  GT++ ++L LFG  G++    LY    N D FE+G+ D F +E   + K++++R+++DG G    W+L+++ +  E   ES   E+    +L K+     +L  +L P +    +K   Y + VKT +V  A T S V +K YGE  D+    L   + N K  F+  ++DEF   + L++G ++R  + H+++G  + W L  ++++  +  + + FP N+WL     D ++  EL     P+     +    YE+ + TGD   AG    V+   YGE+  ++   + +   + K+F R S+D  ++  V +GE+  I+LG   +  E +  S  WF + V +++L  
Sbjct:   32 EDELEHEYYKAKVYEVVTATGDVRGAGTDANVFITLFGE---NGLSPKLHLTSKSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRGN-KYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLEN--EKDNFEKGAEDKFTLDAPDLGQ-LMKINVGHNNKGGSAGWFLSKIIIED-IGNKRK---YDFPLNRWLALDEDDGKIQRDIL----------------VGGAETTA-----ITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIF---LEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIG-VNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLY---------EMVSLRKKRL--------------------------------KKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKG-RTDEILLNP-NNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKD-KDDGQLVRELLPSDSNATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTL-ETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELY----PSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSS---RSKVFDRGSKDIFQLEAVDVGEIYKIRLG---HTGEGFGPS--WFVDTVWLRHLVV 903          

HSP 12 Score: 297.745 bits (761), Expect = 3.092e-80
Identity = 285/1043 (27.33%), Postives = 452/1043 (43.34%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK-------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLF----KENTQCFQRGQTSKFVIPATCVGP-ISKIRIRQDESGSKSSWYLDRVCITDL---KNPEWRYFFQCKNWLSKDHGDHATVREI-----------------RGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIF---GENGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKV-IINDLDQSRVFEFPCGQWLSDVKGEG-LEKIL--------------------------------------PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFT------------DVVPVELNEKLSPLTEIIAGINVGG-------------------------------KNQDWFLDDIVIFCPQTGIE----------QSFICGNWLSPSRPGCQTEVSLVEDLSKRKLK--------TVIDFTE----NTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS---KLDSGSVVEFR-TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKV-IIWE-------EQNPSNSVTFRCNCWFD-SSEGDGLTVRELTGTT--------LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLD 3204
            + V + T D K AGT   ++I++ G + N     LK  K ++ K         S +IF +   DLGDL  + I HD       W +  VE+      +   F C  WL+  ++DG + R+LF    ++T+       YEI + T D+  +GTD+ +FI + G   +  + +      +E    F+R   S+F++    VG  I KIRI  D +G    W+   V I  L   K+      F C  WL+    D  T+RE+                 +  KE+        Y +  +T N PGAG+ A +YI I+   G+ GE  +   +N+ + F++G+     +    LG + KIK+ + N      W++ KV I ND ++   F F CG+WLS  K +G LE++                                       P+    +      Y + ++TG    A+T SRA+V+L G +         E TN+IW++  + K GF+            DV  ++  E L  +T +  G  VGG                               +  D F+ +I+   P T +           + F+    L     G  T     + LS++K K         VID  E     ++ VS+ TSDI  A T++ V ++++G+NG +  + +   +   K +  +   F  +++  +G   KLR  HDN G    W+L  + +      + ++F C+ WLS S  D  T+R+       I        Y++ I TGN     T  NV++ + G K  + + FL  +++    F KG  D F  +++ LG I+ + +GH   LA    F+ K  ++W        E    N   F C+C      +     V E+T TT         L  V YEV V TG   GAGTD+NVF+ IFG  GDTG  +LK  M  +N FE G+TD F +E  ++GE++ +R+ HD +G  S W V+++ V     G+  IF   +WLD
Sbjct: 1182 FSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDK-----FERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLF-HAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYGCDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTNEDE-FLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGED--------DECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIEVLYEMT-VWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLRDFACANNEIRDELEETTYEIVIETGNG--GETRENVWLILEGRKNRSKE-FLVENSSRQRAFRKGTTDTFEFDSIFLGDIASLCVGH---LAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKIQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGVATIFSCGRWLD 2200          

HSP 13 Score: 276.174 bits (705), Expect = 1.355e-73
Identity = 271/1057 (25.64%), Postives = 469/1057 (44.37%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAF-----------------------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCG---RTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAK-EIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----------NKDGFKEGSIFEHTLPLRQLG-TLKKIKVGNKNNGPQPRWFLNKVIINDL----DQSRVFEFPCGQWL--SDVKGEGLEKILPVKKLPERYQK-------YK----------YEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKN----QDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKV-ILVLYGDNGKTDDIVIPADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELT----GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKI-EAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTL-EYDLDPSKI-DKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKINAADVGVIQKIRIGH 3468
            Y+V V T +V  AGT   +Y++I G++      R        K     K   G T  F I   DLG L  I I HD    +  W L  V+I +V N+  + F C  WL++ ++DG++SREL                                K   T + + + TGD  ++GTD+ VFI+L G     G++  ++  K N+  F+R     F +    +G + K+RI  D +G    W++D V + D  +      F C  WL+K+  D + VR++  A+ +         Y+I+ YT +   AG+ A+I+I I+G     D +  +           K  F+  S     + L  +G  ++KI++G+ N G  P W  + V I  L    D +    FPC +WL  S+   + + +++P     E+Y K       YK          Y ++I TGN   A T ++ Y+ + G   +  ++ L K E+         KF++G  D   +E  +       +I  I +   N     DW+++ + I+      E  F+CG WLS  +   + E    E        +      + W +++ +S + +   ++    +V Y  +G     VIP    + +G       E A     + L    D+  TN  W    +   Q   G    F C      S E+F     +     GI+K   +  Y++ ++TG+ +  GTD+N+F+ +YG  G T +  L        +FE+ Q D F++E + +   +K+++  D   +   WF++++++ +  N  +   F    W    +G    V E+     G  ++   +Y V VKT  + GAGTD+NVFI IFG+ GD+G + LK S  N NKFE   TD F   +   +G +  +R+ HD+ G    W +  + V        + F  + WL     D +TL ++    ++I D++++T  Y+I + TG+     T   V++ + G+  ++ +  ++  S+   F +G  D F+ ++  +G I  + +GH
Sbjct: 1028 YEVQVITGNVPKAGTDANVYLTIYGEEYGDTGER-----PLKKSDKSNKFEQGQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMT-LLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEV-DAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYG----CDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTN------KFEKGTADTFIIEAAD-----LGVIYKIKLRHDNTKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIAL-SSKMADVDIDTVTGPMVDYVQDGP----VIPYYVSVTTGK----HKEAATDSRAFVLLIGEDDECTNRIW----LDYPQGKRG----FSCG-----SVEEFY----VGGLDVGIIKKIEVL-YEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKA---RFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILL-KNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQS-ANWNKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLRDFACANNEIRDELEETT-YEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENSSRQRAFRKGTTDTFEFDSIFLGDIASLCVGH 2027          

HSP 14 Score: 262.692 bits (670), Expect = 1.390e-69
Identity = 211/727 (29.02%), Postives = 334/727 (45.94%), Query Frame = 1
Query: 1228 RYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE----NGESDVIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS--DVKGEGLEKILPVKK------------------------LPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKI-LDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVIPADSK-----LDSGSVVEFRTELAIVG-IPYKLRAQHDNSGTNSSWNLEKI----LMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPA----------------TGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTG--------------------------TTLLGK----------VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDT 3111
            +Y F    WL++   D+  V E+  A +  G    T Y++   T N P AG+ A++Y+ I+GE     GE  +      + F++G     T+    LG L KI++ + N G +P WFL++V I D++    + FPC +WL+  +  G+   ++LPV +                        L ++ +   + + I TG++ +A T +  ++ L G +  + + L K   TN     + KF+    ++  VE  + L  L ++  G +  GK   WF+D + +  P  G   +F CG WL+ +    + + S+V DL   +L+T +      + +++YTSD+  A T++ + +V+YG D   T    +  + +      +  S   F  EL  VG I  K+R  HDN+G N  W+   +    L+ +    +   F C+RWL+ S +D  T+RE+                      + +P  I  Y VQI+TGN   AGTDA V+I IYG+ GDTG+R+L  S   TNKFEKG  D F+IEA  LG I KIKL HD+    + W+V+KV IW + N  +   F C  W    + DG   R     E TG                           T+ G           + Y V V TGK + A TDS  F+ + G+  +  N         K  F  G+ + F +   D+G IK I + ++ T
Sbjct:  993 QYKFDVNRWLARGKEDNELVVELVPAGQ-SGPEPNT-YEVQVITGNVPKAGTDANVYLTIYGEEYGDTGERPLKKSDKSNKFEQGQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTN-----SDKFERDSIEIFTVETLD-LGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKN----EDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYGCDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTN-EDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIEVLYEMT 1706          

HSP 15 Score: 258.84 bits (660), Expect = 2.181e-68
Identity = 210/774 (27.13%), Postives = 363/774 (46.90%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF--AFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIP-ATCVGPISKIRIRQDESGSKSSWYLDRVCI----TDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISF----YTENKPGAGSHADIYIQIFGENGESDVIDIK-NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWL------SDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQS----FICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKT-DDIVIPADSKL----DSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKV----IIWEEQN 2784
            Y++ V T DV GAGT   ++I+I G+  +    RL+  K +           G+   F +   DLG L  I + H+       W L  + I ++ NKR + F  N WL+L ++DGK+ R++     ++    Y + V TGD+  +GT SK+++ + G  G     ++F E    F RG+T  F I  A  + P+S++ I     G    WY ++V I    T ++       F C NWL +   D    R++    E++ +  +   K  +    +T +   AG+++ I+IQI+G+ G +D I +  N   FK G I +  + L  LG   KI+  +    P   W L K+ + +      + F C +WL      +++  E   +   V+++       +Y + + TG    A T +  Y+ L G   +  +++L    +   +      F++G  D   +E +  +  +  +    +  G    W+LD +++   + G  +S    F C  WL   +   Q    L+   S   LK         + +S+ T D+  AST+S+V + LYG+   T   +++ +D+ L    + G V EF  E   +G   +L   HD++G ++ W L  + +     G +Y F  NRWL  +  D     E+      +V+   +  Y+++I+TG+   AGT + VF+ IYGE+G T   FL   ++ +  F++G  D F +EAV +G I KI+LGH  +  G  WFVD V    ++ +E+N
Sbjct:  174 YEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN--------FEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEG-GVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQT-----FPCSNWLDEKKADGLIERQLY---EMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRI---MGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDL------FEKGNADEFTIE-SVTMRKVRRVRVRHDGKGSGSGWYLDRVLV--REEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNATLKNF------RYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRL--EVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFL---SSRSKVFDRGSKDIFQLEAVDVGEIYKIRLGHTGEGFGPSWFVDTVWLRHLVVQEEN 907          

HSP 16 Score: 255.758 bits (652), Expect = 2.243e-67
Identity = 215/841 (25.56%), Postives = 396/841 (47.09%), Query Frame = 1
Query: 5092 QKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIID-KFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDV-GKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLAIDLAPIND--IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPT-KTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKT--YVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNL---FEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI---LTPSE 7563
            + K Y +   TG     GT+ANVF+ ++GENG S +  L  SK+ +  FEK N+D F     ++G ++KI I HDN+G     W+L ++ + D K  +  Y F+C  WLSK + D++  R L +A +  +  + P G                                         Y I + TG     G+    ++ ++G     T   RL+  E + F  G+++  +++APD+  + ++ + +      + W+L+ I IE     + Y+     WL+    + K  R   +     T     ITY+++V TGD+   GT S ++L ++G +GN +   +      F+RG  D F +++  +   + ++ I +   G    W+ EK+ I    T     F  + +L   K  G  ++   ++  +    +KK  + + V T+++K AGT+S + ++ YG+ G + ++ L     NNK FK   +++F   ++  LG   + + WH+     S WHLE + +     +  + F CN+WL   +DD +I RE+  E    PT +       Y VTV TG+ + AG   +V+   +G+   + + ++ N  +   LF + + D+  +  V + +++      V  +++       W+ + V V+     ++    F    W++  +     DG++  +  ++   + A ++  +      Y I V TG  +G  TD+ V+I L+GE S++ K+ L+    NL   FE+G+ D+F LE +++G I ++ I HD +   + WFL  VQ++     K + +P N WL K++   ++   L PSE
Sbjct:   41 KAKVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLT-SKSES-AFEKANVDVFRVRTNNVGLIYKIRIEHDNTGL-NASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDL-LASF--DPMDMPRGNK---------------------------------------YEIKVYTGDVIGAGTDADVFINIFGEYG-DTGERRLEN-EKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETT----AITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLN---PNNKWFKPGIIEKFRM-ELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEG---PTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVR-----RVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKD----DGQL--VRELLPSDSNATLKNFR------YHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSE 806          

HSP 17 Score: 219.164 bits (557), Expect = 3.090e-56
Identity = 187/677 (27.62%), Postives = 307/677 (45.35%), Query Frame = 1
Query: 5581 DENDTAQTEYI---AYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISI-EMPTKGKLYNVTCGVWLSKFMGERKTSR-IFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL--VQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQV----QNLSTNKIWKYPCNEWLSKSKG---LWKILTPSE 7563
            D  D  + EY     Y +   TG  +  G+    ++ L+G   L   +    K E+  F   + +V  V   +V  I ++ I ++     +SWYL+ + + +M      Y   C  WLSK  G+R+  R + +  D M  ++ +   Y I V TGDV   GT++ +F+ +FG  G++    L+  +DNFE+G  D F L+  D+G++ KI + ++  G    WFL K+ I +      Y F  N +L+ +    K     L    +     Y V V T +++ AGT S + +  YG  G  +SG + L+        F   + D F     + L  LSR  + H N G +  W+ E + +    T     FPC+ WL     D  I R+L      +  K    +  + + V T D K AG    ++   YG+K  +D+ ++  N    K F     +K ++    LG    I+       ++  +    W   ++ + N      Y F    W++ +E   E   E+       E P   R+      G+ +Y + V TG+  G GTDANV++ LFG+  ++G+R L   +   +LFE+G  D+F +E V + K+ ++++ HD     S W+LDRV V    Q  S N   ++PC  WL K K    L + L PS+
Sbjct:   30 DGEDELEHEYYKAKVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSKSESA-FEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPM--DMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLE-----GGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLY--EMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPN---NKWFKPGIIEKFRMELPDLGRFYKIRAW-----HDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREM-----TAEGPTVRRI-----MGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNV--EFPCLRWLDKDKDDGQLVRELLPSD 676          

HSP 18 Score: 202.601 bits (514), Expect = 3.197e-51
Identity = 206/800 (25.75%), Postives = 335/800 (41.88%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVF--ISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKN--WLSKDHGDHA----TVREIRGAKEIMGIASRTR--YKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK---LDSGSVVEFRTELAIVG------IPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED-----FSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT--FRCNCWFDSSEGDGLTVREL 2862
            D +LY V + T +V GAGT   +YI+I GD  +     L K +    K        G+   F I  +DLG +  I + HD  +    W ++ VEI N  N+  +LF C  WLSL KEDG++ R LF  K           TGD   + +    F  I+L  +        +        Q G    + +  T          +  E+ + S  ++  +   D          +C N  WL    G       +V E       +GI  +    Y+++ +T +  G G+ ++I++ ++G NG ++ + + K K  F+        + +  +    K+++     G +P WFL ++++ +++   +  F  G WLS  KG+   + +I  V    E  +   Y + + T +   A T +  ++I+ G       L   +S N  W    KF+   TD         L  L ++    +  G    W L  + +          F C  WLS S    QT    + D +    +   +  E T+ + I T +     T   V L+L G   ++ + ++   S+      G+   F  +   +G      + +  R           W+++ I +T+   G+ Y F C+  +    +      F   +   +    I    P+ KY+V + TG +  AGTDANVF+ I+G  GDTG R L     N   FE+G  D F +E ++LG + K++L HDS    SGW V+KV   E  N S  V   F C  W D S GDGLT REL
Sbjct: 1463 DIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNK-----FEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLER-LFYEKEY---------TGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTG--------KHKEAATDSRAFVLLIGEDD----------ECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIEVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSAN--W---NKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQT----LRDFACANNEIRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENSSRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKIQSLVPV-KYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL--FERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKV---EVTNTSTGVATIFSCGRWLDKSRGDGLTWREL 2212          

HSP 19 Score: 96.2857 bits (238), Expect = 5.705e-19
Identity = 73/293 (24.91%), Postives = 132/293 (45.05%), Query Frame = 1
Query:  466 DCYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEH----DGLEPKDS--WLLQGVEIMNVENKRIWLFTCNHWLSL-----YKEDGKVSRELFAFKS-----VRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            DC+ S  + ++  LR  +          +E  Y++ + T +  G  T   +++ + G K       ++   +            G+T  F      LGD+ S+ + H    D   PK    W ++ + I  +E   ++ F C+  + L     Y +  +V++   +F S     V  KYE++V TG    +GTD+ VF+++ G  G + + +L ++    F+RG T +F +    +G + K+R+  D SG  S W +++V +T+         F C  WL K  GD  T RE+
Sbjct: 1929 DCWLSKSEGDRQTLRDFACANNEIRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENSSRQRA------FRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKIQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGV-ATIFSCGRWLDKSRGDGLTWREL 2212          

HSP 20 Score: 61.2326 bits (147), Expect = 2.309e-8
Identity = 38/124 (30.65%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+V VTT    GAGT   ++++I G   +  +  LK+  ++           GST  F +   +LG+L  + +EHD       WL++ VE+ N       +F+C  WL   + DG   RELF
Sbjct: 2097 VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL-------FERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGVATIFSCGRWLDKSRGDGLTWRELF 2213          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Mouse
Match: Rp1 (retinitis pigmentosa 1 (human) [Source:MGI Symbol;Acc:MGI:1341105])

HSP 1 Score: 221.09 bits (562), Expect = 3.707e-57
Identity = 153/521 (29.37%), Postives = 250/521 (47.98%), Query Frame = 1
Query: 1336 RYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG----FKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPER-YQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGC---QTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK--LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVII-WEEQNPSNSVTFRCNCWFDSSEGDGLTVREL 2862
            ++K+   T N    G+ A++ + ++G  G +  I +  KD     F  G   E  + LR +G + KI++G+   G QP W L +V + ++   +   F     LS  + +G +   LPV K  E  +   +Y + + TG    A T S   + L G E  D  L  +  +N       +F+ G  D   +E    L  L + +       K+Q W+ + I++  P +  E  F C  W+     G    + E+   E       K   +  +  W V++ T D++NA T + V L +YG+   +  I++ +         S   F+  L  +G  YK+R  HDNSG +  W +E++++      D      + W+S+S +D  T +E+P T      P P+  YK+ I+TG K  A T++NVFIN+ G  GD+G R L  S +    F++GQ+D F I+AV LG + K+ + HD    G+GWF++ +I+ +EE      V F C+ W D  + DG T REL
Sbjct:  858 KWKVLVVTGN---TGTQANVTLWVYGYEGVTGPISL-TKDSQEKLFLPGQTDEFQVVLRGIGEIYKIRIGHDGTGGQPEWTLQRVTMENVKSKKTLHFVANVCLSRNQADGDIVCELPVMKEGEPVFPLVRYHVDVYTGQLKQAKTESEVSLCLYG-ERGDSGLRLLHRSNM----PVRFQRGQIDAFQIEA-VSLGNLQKALLHCEASDKSQYWYCEKIIVKDPGSSSESIFTCERWIPFMSEGLMHSEIELYCQEMQINHPPKIQEEANDGDWKVTVVTGDLENAGTTATVSLCVYGEARCSGPIILGSGKHHLFKPNSADIFKIHLTDIGEIYKIRIGHDNSGDDPRWYVEEVILENMATSDLLCLTVDSWISESEDDGDTWKEVP-TVRAHRGPLPVVTYKIHIHTGTKPGAETESNVFINLIGTNGDSGKRRLHQSGSRKAMFQRGQVDIFSIKAVSLGNLKKVLISHDGTGPGNGWFLENIIVKYEEDGSCPEVLFPCHRWLDEYQEDGKTEREL 1367          

HSP 2 Score: 215.698 bits (548), Expect = 1.659e-55
Identity = 162/584 (27.74%), Postives = 259/584 (44.35%), Query Frame = 1
Query: 2116 FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK---LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPA-PICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFD-SSEGDGLTVRELTGTTL-----------LGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFL-------------NKWLDSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK---SKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLP 3771
              E  W V + T    N  T + V L +YG  G T  I +  DS+      G   EF+  L  +G  YK+R  HD +G    W L+++ M    +     F+ N  LS +  D   V E+P    G  +P  P+ +Y V +YTG    A T++ V + +YGE+GD+G R L H +    +F++GQ+D F IEAV LG + K  L  ++      W+ +K+I+ +  + S S+ F C  W    SEG   +  EL    +                ++V V TG ++ AGT + V + ++G+   +G + L +     + F+  + D+FKI   DIGEI  IRI HD++G    W+V++  VI+  +    +  L             + W +  T+     P  +      + Y+I + TG    A T+S VFI + G +  + +  L    S+   F+RG  D+F I A  +G ++K+ I HDG  PG+GWFL+ ++                                                   +  +E+ +     F C+RWL   ++D    RELLP
Sbjct:  854 LLEEKWKVLVVTG---NTGTQANVTLWVYGYEGVTGPISLTKDSQEKLFLPGQTDEFQVVLRGIGEIYKIRIGHDGTGGQPEWTLQRVTMENVKSKKTLHFVANVCLSRNQADGDIVCELPVMKEG--EPVFPLVRYHVDVYTGQLKQAKTESEVSLCLYGERGDSGLRLL-HRSNMPVRFQRGQIDAFQIEAVSLGNLQKALLHCEASDKSQYWYCEKIIVKDPGSSSESI-FTCERWIPFMSEGLMHSEIELYCQEMQINHPPKIQEEANDGDWKVTVVTGDLENAGTTATVSLCVYGEARCSGPIILGSG--KHHLFKPNSADIFKIHLTDIGEIYKIRIGHDNSGDDPRWYVEE--VILENMATSDLLCLTVDSWISESEDDGDTWKEVPTVRAHRGPLPV------VTYKIHIHTGTKPGAETESNVFINLIGTNGDSGKRRLHQSGSRKAMFQRGQVDIFSIKAVSLGNLKKVLISHDGTGPGNGWFLENII---------------------------------------------------VKYEEDGSCPEVLFPCHRWLDEYQEDGKTERELLP 1369          

HSP 3 Score: 211.46 bits (537), Expect = 3.402e-54
Identity = 161/521 (30.90%), Postives = 260/521 (49.90%), Query Frame = 1
Query: 6013 ISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPL--DKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKP--FKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLS-MTDDDRQIFRELICE----NAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKG--RNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQV---QNLSTNKIWKYPCNEWL 7521
            + V+TG+    GT + + L ++G +G +    L  D  E  F  G  D F++ +  +G+I KIRI +DG G +P W L+++ + N  + ++  F  N  LS+N      +  +L  + +         Y V V T  +K A T S V++  YGE GDSG   L+   ++N P  F+  Q+D F   + +SLG+L +  +    S  S  W+ E I +K+  +     F C +W+  M++       EL C+    N P   +   N+  ++VTV+TGD +NAG    V    YGE   S   I+ +   K  LF  +S D  K+    +GE+  I++G     ++   D  +W+  EV ++N+AT       + SWI   E     DG+ +     V    +A    L    VV Y+I + TG   G  T++NVFI L G N +SGKR L Q G  + +F++GQ D F ++ V LG ++K+ I HD +   + WFL+ + V   ++ S  ++  +PC+ WL
Sbjct:  861 VLVVTGNT---GTQANVTLWVYGYEGVTGPISLTKDSQEKLFLPGQTDEFQVVLRGIGEIYKIRIGHDGTGGQPEWTLQRVTMENVKSKKTLHFVANVCLSRNQAD-GDIVCELPVMKEGEPVFPLVRYHVDVYTGQLKQAKTESEVSLCLYGERGDSG---LRLLHRSNMPVRFQRGQIDAFQI-EAVSLGNLQKALLHCEASDKSQYWYCEKIIVKDPGSSSESIFTCERWIPFMSEGLMHSEIELYCQEMQINHPPKIQEEANDGDWKVTVVTGDLENAGTTATVSLCVYGEARCSGPIILGSG--KHHLFKPNSADIFKIHLTDIGEIYKIRIG-----HDNSGDDPRWYVEEVILENMATSDLLCLTVDSWISESED----DGDTWKEVPTV----RAHRGPLP---VVTYKIHIHTGTKPGAETESNVFINLIGTNGDSGKRRLHQSGSRKAMFQRGQVDIFSIKAVSLGNLKKVLISHDGTGPGNGWFLENIIVKYEEDGSCPEVL-FPCHRWL 1354          

HSP 4 Score: 209.534 bits (532), Expect = 1.254e-53
Identity = 143/441 (32.43%), Postives = 228/441 (51.70%), Query Frame = 1
Query: 3706 FICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVND--ESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNA-SDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDK 5019
            F+ N  L+ ++ D  IV EL P  ++G P+  L  ++Y VDV TG    + T++ V L ++G+ GDSG R L  +  N   +F+   +D F I+A+ LG L+K  +  + S+    WY + ++V D   S E +F C  W+        +S+ +  +   +Y   ++ +++    KI +E    ++ V V T     AGT A V + +YGE   SG I L     H   F+  + D F++   D+GE+ KIRIGHDNSG +  W++ +V +E            + WIS+S+ DG+  +E+ P +       P + Y+I   T  + GA T +NV+I + G N  + K  L+ + S K+  Q G  D+F +    + + ++K+ I HD  G G+ W LE ++VK             FPC+RWL   +EDG  ERELLP K
Sbjct:  951 FVANVCLSRNQADGDIVCEL-PVMKEGEPVFPL--VRYHVDVYTGQLKQAKTESEVSLCLYGERGDSGLRLLHRS--NMPVRFQRGQIDAFQIEAVSLGNLQKALLHCEASDKSQYWYCEKIIVKDPGSSSESIFTCERWIP------FMSEGLMHSEIELY--CQEMQINHPP-KIQEEANDGDWKVTVVTGDLENAGTTATVSLCVYGEARCSGPIILGSGKHH--LFKPNSADIFKIHLTDIGEIYKIRIGHDNSGDDPRWYVEEVILENMATSDLLCLTVDSWISESEDDGDTWKEV-PTVRAHRGPLPVVTYKIHIHTGTKPGAETESNVFINLIGTNGDSGKRRLHQSGSRKAMFQRGQVDIFSIKAVSLGN-LKKVLISHDGTGPGNGWFLENIIVK--YEEDGSCPEVLFPCHRWLDEYQEDGKTERELLPRK 1371          

HSP 5 Score: 205.297 bits (521), Expect = 2.497e-52
Identity = 176/564 (31.21%), Postives = 269/564 (47.70%), Query Frame = 1
Query: 3802 LKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLV-NDESDEYL-FPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWIS-KSKVDGNLERELYPQLSLTMTKRPKIKYE-------ITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKL-QTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGETG--TNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNET--YLFHCERWLSKSKDDKKIQRTL 5448
            L E K+ V V TGN   +GT ANV L ++G  G +G  +L  T D+    F     D+F +    +G + KI+I HD + G   W L  V + N +S + L F     L+ N+  G    DI    P M       K  +  F + +      ++V VYT +   A T++ V + LYGE  DSG+  L +S     +F+ G  D FQ++   LG L+K  +  + S  +  W+  K+ ++        +F C  WI   S+   + E ELY Q  + +   PKI+ E       +T VT + + AGT A V + VYG   C+    L   S K  L +    D+F + + D+ + I KIRIGHDN G    W++E+V+    L N   S       + W++  E+DG   +E+ P     RG +  +                  Y I ++TG + G  T +NVF+ + G NGDSG+R+L  S +    F++  +D F  +AV LG + K+ I HD +G     WFL+ I +  + D      LF C RWL + ++D K +R L
Sbjct:  854 LLEEKWKVLVVTGN---TGTQANVTLWVYGYEGVTGPISL--TKDSQEKLFLPGQTDEFQVVLRGIGEIYKIRIGHDGTGGQPEWTLQRVTMENVKSKKTLHFVANVCLSRNQADG----DIVCELPVM-------KEGEPVFPLVR------YHVDVYTGQLKQAKTESEVSLCLYGERGDSGLRLLHRS-NMPVRFQRGQIDAFQIEAVSLGNLQKALLHCEASDKSQYWYCEKIIVKDPGSSSESIFTCERWIPFMSEGLMHSEIELYCQ-EMQINHPPKIQEEANDGDWKVTVVTGDLENAGTTATVSLCVYGEARCSGPIIL--GSGKHHLFKPNSADIFKIHLTDIGE-IYKIRIGHDNSGDDPRWYVEEVI----LENMATSDLLCLTVDSWISESEDDGDTWKEV-PTVRAHRGPLPVV-----------------TYKIHIHTGTKPGAETESNVFINLIGTNGDSGKRRLHQSGSRKAMFQRGQVDIFSIKAVSLGNLKKVLISHDGTG-PGNGWFLENIIVKYEEDGSCPEVLFPCHRWLDEYQEDGKTEREL 1367          

HSP 6 Score: 173.711 bits (439), Expect = 1.343e-42
Identity = 96/247 (38.87%), Postives = 141/247 (57.09%), Query Frame = 1
Query: 2131 WMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPA--DSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPA-PICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVREL 2862
            W VSI TSD  NA T+S++ +VLYG    +  I +     ++   G    F   +  +G P+K+R  H NSG + SW+ ++I +    +G+++     RWL+   ED    RE P    G  +P  P+  YKV I TG    +GT ANV+++IYGEKGDTG R L  S  N++KF +GQ+D F +EAV LG + KI +GHD    G+GWF++ V++  +   ++   F C+ W D  E DG  VRE+
Sbjct:  279 WKVSINTSDFPNAGTSSQIYIVLYGHCRSSAPIYLYGRDGTRFQDGHEDNFTIMVGDIGTPFKIRVGHTNSGHSPSWHCKRIELQNMNSGEKFYIPVQRWLAQEQEDGEICREFPILCKG--QPVLPVTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRS-KNSSKFLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQGNGWFLEDVVV-RDPTTNHEYAFFCHRWLDEGEDDGKIVREM 521          

HSP 7 Score: 150.599 bits (379), Expect = 1.223e-35
Identity = 95/278 (34.17%), Postives = 143/278 (51.44%), Query Frame = 1
Query: 4624 MTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLY 5451
            + KR    ++++  TS+   AGT++ +YI +YG    +    L    D ++ Q G  D F + + D+  P  KIR+GH N G   +WH +++     L N N    +  P  RWLA+++EDG I RE     ++ +G                 +L    Y + + TG    +GT ANV+L +YGE GD+G R+L  SK ++ KF +  +D F  EAV+LG + KI I HD  G     WFL+ + + D   N  Y F C RWL + +DD KI R +Y
Sbjct:  271 IEKRKSGNWKVSINTSDFPNAGTSSQIYIVLYGHCRSSAPIYLY-GRDGTRFQDGHEDNFTIMVGDIGTPF-KIRVGHTNSGHSPSWHCKRIE----LQNMNSGEKFYIPVQRWLAQEQEDGEICREF---PILCKGQ---------------PVLPVTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRSK-NSSKFLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQ-GNGWFLEDVVVRDPTTNHEYAFFCHRWLDEGEDDGKIVREMY 522          

HSP 8 Score: 149.058 bits (375), Expect = 4.351e-35
Identity = 94/295 (31.86%), Postives = 144/295 (48.81%), Query Frame = 1
Query: 4165 PANPAMYKDWKDNKLDKSQFKIYQEDKLE-------NFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-DKVI 5025
            P N  + K     KL     +++Q+ K +       N+ V + T+    AGT + ++I+LYG    S   P+        +F+ G+ D F +   D+G   KIR+GH NSG +  WH  ++E++    G+ F  P   W+++ + DG + RE +P L       P   Y++   T     +GT ANVY+ +YG    T    L  + + SK   G  D F++   ++ D + KI IGHD  G G+ W LE V+V+    N      Y F C+RWL   E+DG I RE+   DK I
Sbjct:  242 PGNYDIQKYLLPAKLPGISHRVHQKGKAKIEKRKSGNWKVSINTSDFPNAGTSSQIYIVLYGHCRSSA--PIYLYGRDGTRFQDGHEDNFTIMVGDIGTPFKIRVGHTNSGHSPSWHCKRIELQNMNSGEKFYIPVQRWLAQEQEDGEICRE-FPILCKGQPVLPVTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRSKNSSKFLRGQVDTFFLEAVNLGD-LCKIVIGHDGLGQGNGWFLEDVVVRDPTTNHE----YAFFCHRWLDEGEDDGKIVREMYARDKTI 528          

HSP 9 Score: 147.902 bits (372), Expect = 8.136e-35
Identity = 143/566 (25.27%), Postives = 246/566 (43.46%), Query Frame = 1
Query: 5077 VANILQKKAYTIRVYTGGETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGE-RKTSRIFSIQDKMMTNVSKKIT-------YLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN-FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQK---KKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMK--EVKTRRSWKFPCNKWLSMTDDDRQIFRELI 6732
            +  +L ++ + + V TG  TGT ANV L VYG  G +G   L    +    F     DEF+     +G+++KI I HD +G  + +W L+++ + +    +T  F     LS+++ D  I   L +   +GE           +Y+G      ++ + S                          + G   D G      +RL    N+    +R Q+        G  +   +EA  + N+++  +  E  D+   WY   I ++ P        TC  W+  FM E    S I     +M  N   KI        + ++V+TGD++  GT +T+ L ++G    S    L   + + F+    D FK+ + D+G+I KIRI +D +GD P W++E++ + N +T++      + ++S++       K++    A    +    YK+ + T     A T S V +   G  GDSG   L         F+  Q+D F     +SLG+L +  + H+ +G  + W LE I +K  E  +     FPC++WL    +D +  REL+
Sbjct:  850 IETLLLEEKWKVLVVTG-NTGTQANVTLWVYGYEGVTGPISLTKD-SQEKLFLPGQTDEFQVVLRGIGEIYKIRIGHDGTGG-QPEWTLQRVTMENVKSKKTLHFVANVCLSRNQADGDIVCELPVM-KEGEPVFPLVRYHVDVYTGQLKQAKTESEVS------------------------LCLYGERGDSG------LRLLHRSNMP---VRFQR--------GQIDAFQIEAVSLGNLQKALLHCEASDKSQYWYCEKIIVKDPGSSSESIFTCERWIP-FMSEGLMHSEIELYCQEMQINHPPKIQEEANDGDWKVTVVTGDLENAGTTATVSLCVYGEARCSGPIILGSGKHHLFKPNSADIFKIHLTDIGEIYKIRIGHDNSGDDPRWYVEEVILENMATSDLLCLTVDSWISESEDDGDTWKEVPTVRAHRGPLPVVTYKIHIHTGTKPGAETESNVFINLIGTNGDSGKRRLHQSGSRKAMFQRGQVDIFSI-KAVSLGNLKKVLISHDGTGPGNGWFLENIIVKYEEDGSCPEVLFPCHRWLDEYQEDGKTERELL 1368          

HSP 10 Score: 137.502 bits (345), Expect = 1.496e-31
Identity = 121/478 (25.31%), Postives = 212/478 (44.35%), Query Frame = 1
Query:  715 PGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVR-----TKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQC-FQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLS--KDHGDHATVR------EIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG--FKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVK--GEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVI------FCPQTGIEQSFICGNWLSPSRPGCQTEVSLV 2076
            PG T  F +    +G++  I I HDG   +  W LQ V + NV++K+   F  N  LS  + DG +  EL   K         +Y + V TG L  + T+S+V + L G  G S    L + N    FQRGQ   F I A  +G + K  +  + S     WY +++ + D  +      F C+ W+    +   H+ +       +I    +I   A+   +K++  T +   AG+ A + + ++GE   S  I + +     FK  S     + L  +G + KI++G+ N+G  PRW++ +VI+ ++  S +       W+S+ +  G+  +++  V+          Y++ I TG +  A T S  ++ L G    D    ++  +       A F+ G  D+  ++    L  L +++   +  G    WFL++I++       CP    E  F C  WL   +   +TE  L+
Sbjct:  901 PGQTDEFQVVLRGIGEIYKIRIGHDGTGGQPEWTLQRVTMENVKSKKTLHFVANVCLSRNQADGDIVCELPVMKEGEPVFPLVRYHVDVYTGQLKQAKTESEVSLCLYGERGDSGLRLLHRSNMPVRFQRGQIDAFQIEAVSLGNLQKALLHCEASDKSQYWYCEKIIVKDPGSSS-ESIFTCERWIPFMSEGLMHSEIELYCQEMQINHPPKIQEEANDGDWKVTVVTGDLENAGTTATVSLCVYGEARCSGPIILGSGKHHLFKPNSADIFKIHLTDIGEIYKIRIGHDNSGDDPRWYVEEVILENMATSDLLCLTVDSWISESEDDGDTWKEVPTVRAHRGPLPVVTYKIHIHTGTKPGAETESNVFINLIGTN-GDSGKRRLHQSGS---RKAMFQRGQVDIFSIKA-VSLGNLKKVLISHDGTGPGNGWFLENIIVKYEEDGSCP----EVLFPCHRWLDEYQEDGKTERELL 1368          

HSP 11 Score: 135.191 bits (339), Expect = 6.138e-31
Identity = 107/387 (27.65%), Postives = 182/387 (47.03%), Query Frame = 1
Query: 6379 YKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSD-KFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIE-VHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSK 7533
            +KV+V T N    GT + VT+  YG  G +G + L T +   K F   Q DEF    +  +G++ + ++ H+ +G    W L+ + M+ VK++++  F  N  LS    D  I  EL       P         Y V V TG  K A    +V    YGE+  S  + +  +N+     F R   D  ++  V LG L+   L       E    S+ W+C ++ VK+  +    +F  + WI  + E +  ++ E++     +  P K  ++E    G   +++ VVTG     GT A V + ++GE   SG   L     +LF+    D F +   D+G+I KI+I HD+S     W+++ V ++N++T+ +     + W+S+S+
Sbjct:  859 WKVLVVTGN---TGTQANVTLWVYGYEGVTGPISL-TKDSQEKLFLPGQTDEFQVV-LRGIGEIYKIRIGHDGTGGQPEWTLQRVTMENVKSKKTLHFVANVCLSRNQADGDIVCELPVMKEGEPVFPL---VRYHVDVYTGQLKQAKTESEVSLCLYGERGDSGLRLLHRSNMPVR--FQRGQIDAFQIEAVSLGNLQKALLHC-----EASDKSQYWYCEKIIVKDPGSSSESIFTCERWIPFMSEGLMHSEIELYCQEMQINHPPK--IQEEANDG--DWKVTVVTGDLENAGTTATVSLCVYGEARCSGPIILGSGKHHLFKPNSADIFKIHLTDIGEIYKIRIGHDNSGDDPRWYVEEVILENMATSDLLCLTVDSWISESE 1226          

HSP 12 Score: 129.028 bits (323), Expect = 4.844e-29
Identity = 126/530 (23.77%), Postives = 232/530 (43.77%), Query Frame = 1
Query:  949 KYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQ-CFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKD---GFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGL-----------EKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAK---FKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGD--EYQFLCNRWLSDSHEDFSTVREI 2466
            K++++V+TG+   +GT + V + + G  G++  I L K++ +  F  GQT +F +    +G I KIRI  D +G +  W L RV + ++K+ +  +F      LS++  D   V E+   KE   +    RY +  YT     A + +++ + ++GE G+S +  +   +    F+ G I    +    LG L+K  +  + +     W+  K+I+ D   S    F C +W+     EGL            +I    K+ E      +++ + TG+  +A TT+   + + G         +   +  I + + K   FK    D+  + L + +  + +I  G +  G +  W+++++++    T         +W+S S     T   +    + R    V+     T+ + I+T     A T S V + L G NG +    +       +    G V  F  +   +G   K+   HD +G  + W LE I++    +G   E  F C+RWL +  ED  T RE+
Sbjct:  858 KWKVLVVTGN---TGTQANVTLWVYGYEGVTGPISLTKDSQEKLFLPGQTDEFQVVLRGIGEIYKIRIGHDGTGGQPEWTLQRVTMENVKSKKTLHFV-ANVCLSRNQADGDIVCELPVMKEGEPVFPLVRYHVDVYTGQLKQAKTESEVSLCLYGERGDSGLRLLHRSNMPVRFQRGQIDAFQIEAVSLGNLQKALLHCEASDKSQYWYCEKIIVKDPGSSSESIFTCERWIP-FMSEGLMHSEIELYCQEMQINHPPKIQEEANDGDWKVTVVTGDLENAGTTATVSLCVYG---------EARCSGPIILGSGKHHLFKPNSADIFKIHLTD-IGEIYKIRIGHDNSGDDPRWYVEEVILENMATSDLLCLTVDSWISESEDDGDTWKEVPTVRAHRGPLPVV-----TYKIHIHTGTKPGAETESNVFINLIGTNGDSGKRRLHQSGSRKAMFQRGQVDIFSIKAVSLGNLKKVLISHDGTGPGNGWFLENIIVKYEEDGSCPEVLFPCHRWLDEYQEDGKTEREL 1367          

HSP 13 Score: 128.257 bits (321), Expect = 8.750e-29
Identity = 115/528 (21.78%), Postives = 234/528 (44.32%), Query Frame = 1
Query: 5617 YTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNED--NFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQF---EYNEFLSKNVGQK------KKLAIDLAP--INDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENA---PNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVK--NLATLKTYVFKIQSWIEVHEKIREADGEIF 7146
            + + +VTG   + G+     + +YG + +   I   +  +   F PG  +   V    +  I ++ I ++G   +  W L  +++E     K  +    V LS+   +        +  K    V   + Y + V TG + Q  T S + L L+G +G+S L  L ++     F+RG  D F++E   +G ++K  +  + +    +W+ EK+ + +  ++    F    +  F+S+ +         +++ I+  P    +    D+KV V T ++++AGT++ V++  YGE   SG + L + + +   FK N  D F    +  +G++ + ++ H+NSG   RW++E + ++ + T        + W+S ++DD   ++E+    A   P P  T      Y++ + TG K  A    +V+    G    S K  +  +  ++ +F R   D   +  V LG LK + +      ++       WF   + VK     +    +F    W++ +++  + + E+ 
Sbjct:  859 WKVLVVTG---NTGTQANVTLWVYGYEGVTGPISLTKDSQEKLFLPGQTDEFQVVLRGIGEIYKIRIGHDGTGGQPEWTLQRVTMENVKSKKTLHFVANVCLSRNQADGDIVCELPVM-KEGEPVFPLVRYHVDVYTGQLKQAKTESEVSLCLYGERGDSGLRLLHRSNMPVRFQRGQIDAFQIEAVSLGNLQKALLHCEASDKSQYWYCEKIIVKDPGSSSESIFTCERWIPFMSEGLMHSEIELYCQEMQINHPPKIQEEANDGDWKVTVVTGDLENAGTTATVSLCVYGEARCSGPIILGSGKHHL--FKPNSADIFKI-HLTDIGEIYKIRIGHDNSGDDPRWYVEEVILENMATSDLLCLTVDSWISESEDDGDTWKEVPTVRAHRGPLPVVT------YKIHIHTGTKPGAETESNVFINLIGTNGDSGKRRLHQSGSRKAMFQRGQVDIFSIKAVSLGNLKKVLI-----SHDGTGPGNGWFLENIIVKYEEDGSCPEVLFPCHRWLDEYQEDGKTERELL 1368          

HSP 14 Score: 122.479 bits (306), Expect = 5.724e-27
Identity = 96/397 (24.18%), Postives = 172/397 (43.32%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAF--------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN----KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFE--FPCGQWLSDVKGEGL--EKILPVK 1680
            + Y V V T  +K A T   + + + G++ +   +RL        +        G    F I    LG+L+  L+  +  +    W  + + + +  +    +FTC  W+    E G +  E+  +              ++    +++ V+TGDL+++GT + V + + G    S  I L       F+      F I  T +G I KIRI  D SG    WY++ V + ++   +        +W+S+   D  T +E+   +   G      YKI  +T  KPGA + ++++I + G NG+S    +      K  F+ G +   ++    LG LKK+ + +   GP   WFL  +I+   +     E  FPC +WL + + +G    ++LP K
Sbjct:  983 VRYHVDVYTGQLKQAKTESEVSLCLYGERGD-SGLRLLHRSNMPVR-----FQRGQIDAFQIEAVSLGNLQKALLHCEASDKSQYWYCEKIIVKDPGSSSESIFTCERWIPFMSE-GLMHSEIELYCQEMQINHPPKIQEEANDGDWKVTVVTGDLENAGTTATVSLCVYGEARCSGPIILGSGKHHLFKPNSADIFKIHLTDIGEIYKIRIGHDNSGDDPRWYVEEVILENMATSDL-LCLTVDSWISESEDDGDTWKEVPTVRAHRGPLPVVTYKIHIHTGTKPGAETESNVFINLIGTNGDSGKRRLHQSGSRKAMFQRGQVDIFSIKAVSLGNLKKVLISHDGTGPGNGWFLENIIVKYEEDGSCPEVLFPCHRWLDEYQEDGKTERELLPRK 1371          

HSP 15 Score: 120.168 bits (300), Expect = 2.661e-26
Identity = 72/235 (30.64%), Postives = 118/235 (50.21%), Query Frame = 1
Query: 2512 YKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELT----GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLD 3204
            +KV I T +   AGT + ++I +YG    +   +L     +  +F+ G  D F I    +G   KI++GH +      W   ++ + +  N           W    + DG   RE      G  +L   TY+V + TG++  +GT +NV++ I+G+ GDTG+ +L  S  N +KF  G  D F +EA ++G++  I I HD  G G+ WF++ + V  P    +Y FF ++WLD
Sbjct:  279 WKVSINTSDFPNAGTSSQIYIVLYGHCRSSAPIYLY--GRDGTRFQDGHEDNFTIMVGDIGTPFKIRVGHTNSGHSPSWHCKRIEL-QNMNSGEKFYIPVQRWLAQEQEDGEICREFPILCKGQPVLPVTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRS-KNSSKFLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQGNGWFLEDVVVRDPTTNHEYAFFCHRWLD 509          

HSP 16 Score: 114.775 bits (286), Expect = 1.065e-24
Identity = 66/245 (26.94%), Postives = 132/245 (53.88%), Query Frame = 1
Query: 6013 ISVITGDVDQGGTNSTLFLQLFG-TQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKN-----VGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFREL 6729
            +S+ T D    GT+S +++ L+G  + ++ +Y   ++   F+ GH D+F + + D+G   KIR+ +  +G  P W  +++++ N ++ E +      +L++      + ++  +     P+  +  T YKV + T  + ++GT + V +  YGE GD+G  +L    +N+  F   Q+D F F + ++LGDL +  + H+  G  + W LE + +++  T   + F C++WL   +DD +I RE+
Sbjct:  281 VSINTSDFPNAGTSSQIYIVLYGHCRSSAPIYLYGRDGTRFQDGHEDNFTIMVGDIGTPFKIRVGHTNSGHSPSWHCKRIELQNMNSGEKFYIPVQRWLAQEQEDGEICREFPILCKGQPV--LPVTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFR-SKNSSKFLRGQVDTF-FLEAVNLGDLCKIVIGHDGLGQGNGWFLEDVVVRDPTTNHEYAFFCHRWLDEGEDDGKIVREM 521          

HSP 17 Score: 104.76 bits (260), Expect = 1.265e-21
Identity = 77/280 (27.50%), Postives = 133/280 (47.50%), Query Frame = 1
Query: 3817 YMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYV-LVNDESDE-YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMY-AGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIK 4647
            + V + T +   +GT + +++ ++G    S    L         +F++   D F I   D+GT  KI++ H NS    +W+   + L N  S E +  P   WLA  ++ G + ++     P + K      L  + +K+Y             TT +++ +GT ANV++ +YGE  D+G   L +S  +S+KF  G  D F ++  +LG+L KI IGHD  G    W L  V +        + F C+ W+ + + DG + RE+Y +     + R K++
Sbjct:  279 WKVSINTSDFPNAGTSSQIYIVLYGHCRSSAPIYLYG---RDGTRFQDGHEDNFTIMVGDIGTPFKIRVGHTNSGHSPSWHCKRIELQNMNSGEKFYIPVQRWLAQEQEDGEICREF----PILCKG--QPVLPVTTYKVY------------ITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRS-KNSSKFLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQGNGWFLEDVVVRDPTTNHEYAFFCHRWLDEGEDDGKIVREMYARDKTISSMRKKLE 536          

HSP 18 Score: 101.679 bits (252), Expect = 9.995e-21
Identity = 64/238 (26.89%), Postives = 113/238 (47.48%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGES---DVIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG 1656
            +++ + T D  ++GT S+++I L G    S  I L+  +   FQ G    F I    +G   KIR+    SG   SW+  R+ + ++ + E +++   + WL+++  D    RE     +   +   T YK+   T     +G+ A++Y+ I+GE G++    +   KN   F  G +    L    LG L KI +G+   G    WFL  V++ D   +  + F C +WL + + +G
Sbjct:  279 WKVSINTSDFPNAGTSSQIYIVLYGHCRSSAPIYLYGRDGTRFQDGHEDNFTIMVGDIGTPFKIRVGHTNSGHSPSWHCKRIELQNMNSGE-KFYIPVQRWLAQEQEDGEICREFPILCKGQPVLPVTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRSKNSSKFLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQGNGWFLEDVVVRDPTTNHEYAFFCHRWLDEGEDDG 515          

HSP 19 Score: 100.138 bits (248), Expect = 2.942e-20
Identity = 81/315 (25.71%), Postives = 136/315 (43.17%), Query Frame = 1
Query: 2893 YEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDL--DPSKIDKIDKTIP---YQITVFTGDVMHAGTDSKVFIQIYGK--DKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELK 3816
            ++V + T     AGT S ++I ++G    +  + L     +  +F+ G  D F I   DIG    IR+ H ++G   +W   +I +     G K+   + +WL  +  + ++  +   + K    +P   Y++ + TG++ ++GT + V++ IYG+  D  + +L     S  F RG  D F + A ++G + KI IGHDG   G+GWFL+ V                                        + R P+       +  E A      F C+RWL   EDD  IVRE+   D+  + +    ELK
Sbjct:  279 WKVSINTSDFPNAGTSSQIYIVLYGHCRSSAPIYLYGR--DGTRFQDGHEDNFTIMVGDIGTPFKIRVGHTNSGHSPSWHCKRIELQNMNSGEKFYIPVQRWLAQEQEDGEICREFPILCKGQPVLPVTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRSKNSSKFLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQGNGWFLEDV----------------------------------------VVRDPT-------TNHEYA------FFCHRWLDEGEDDGKIVREMYARDKTISSMRKKLELK 538          

HSP 20 Score: 99.3673 bits (246), Expect = 5.492e-20
Identity = 73/252 (28.97%), Postives = 118/252 (46.83%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVR-----TKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFK-ENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITD-LKNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            +KV++ T+D   AGTS  IYI + G   +   I L     +           G    F I   D+G    I + H       SW  + +E+ N+ +   +      WL+  +EDG++ RE       +     T Y++ + TG+L +SGT + V++S+ G  G +   +LF+ +N+  F RGQ   F + A  +G + KI I  D  G  + W+L+ V + D   N E+ +F  C  WL +   D   VRE+
Sbjct:  279 WKVSINTSDFPNAGTSSQIYIVLYGHCRSSAPIYLYGRDGTR-------FQDGHEDNFTIMVGDIGTPFKIRVGHTNSGHSPSWHCKRIELQNMNSGEKFYIPVQRWLAQEQEDGEICREFPILCKGQPVLPVTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRSKNSSKFLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQGNGWFLEDVVVRDPTTNHEYAFF--CHRWLDEGEDDGKIVREM 521          

HSP 21 Score: 98.2117 bits (243), Expect = 1.125e-19
Identity = 74/263 (28.14%), Postives = 130/263 (49.43%), Query Frame = 1
Query: 6766 RNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQ-KGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKIL 7551
            R   +++V++ T D  NAG    ++ V YG    S    +    D  + F    ED   +    +G    I++G   + N  +S S  W C  + ++N+ + + +   +Q W+   ++    DGEI       E P   + + +    V  Y++ + TG+    GT ANV+++++GE  ++G R L + K  + F +GQ D F LE V+LG + KI I HD     + WFL+ V V++ +TN  + + C+ WL + +   KI+
Sbjct:  274 RKSGNWKVSINTSDFPNAGTSSQIYIVLYGHCRSSAPIYLYGR-DGTR-FQDGHEDNFTIMVGDIGTPFKIRVG---HTNSGHSPS--WHCKRIELQNMNSGEKFYIPVQRWLAQEQE----DGEICR-----EFPILCKGQPVLP--VTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRSKNSSKFLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQGNGWFLEDVVVRDPTTNHEYAFFCHRWLDEGEDDGKIV 518          

HSP 22 Score: 94.7449 bits (234), Expect = 1.485e-18
Identity = 78/275 (28.36%), Postives = 125/275 (45.45%), Query Frame = 1
Query: 6304 LSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLS---RCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRE--LICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEK--NYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIE 7107
            +S  V QK K     A I   K  ++KV + TS+  +AGTSS + +  YG    S  + L    ++   F+    D F     + +GD+    + +V H NSG S  WH + IE++ + +   +  P  +WL+   +D +I RE  ++C+  P         T+Y+V + TG+  N+G   +V+   YGEK    S K     N  K   F R   D   +  V LG+L  I +G     ++       WF  +V V++  T   Y F    W++
Sbjct:  259 ISHRVHQKGK-----AKIEKRKSGNWKVSINTSDFPNAGTSSQIYIVLYGHCRSSAPIYLYG--RDGTRFQDGHEDNF----TIMVGDIGTPFKIRVGHTNSGHSPSWHCKRIELQNMNSGEKFYIPVQRWLAQEQEDGEICREFPILCKGQP-----VLPVTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRSKNSSK---FLRGQVDTFFLEAVNLGDLCKIVIG-----HDGLGQGNGWFLEDVVVRDPTTNHEYAFFCHRWLD 509          

HSP 23 Score: 78.5666 bits (192), Expect = 1.226e-13
Identity = 58/232 (25.00%), Postives = 108/232 (46.55%), Query Frame = 1
Query: 5617 YTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPL--DKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFL 6306
            + ++I T    + G+S   ++ LYG     +  I L   +   F  G ++  ++   D+    ++ + +       SW+   I ++    G+ + +    WL++   + +  R F I  K    V    TY + + TG++   GT + ++L ++G +G++    L   KN   F RG  D F LE  ++G + KI I +DG G    WFLE + + + +TN  Y F  + +L
Sbjct:  279 WKVSINTSDFPNAGTSSQIYIVLYG-HCRSSAPIYLYGRDGTRFQDGHEDNFTIMVGDIGTPFKIRVGHTNSGHSPSWHCKRIELQNMNSGEKFYIPVQRWLAQEQEDGEICREFPILCKGQP-VLPVTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRSKNSSKFLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQGNGWFLEDVVVRDPTTNHEYAFFCHRWL 508          

HSP 24 Score: 69.3218 bits (168), Expect = 8.765e-11
Identity = 59/290 (20.34%), Postives = 116/290 (40.00%), Query Frame = 1
Query: 5134 TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKI 6003
             GT++ +++ +YG    S    L        +F+  + D F     D+G  FKI + H NSG     W  K+IE+ +    E +    +RWL++ ++D +I R   I   +G+                                                Y + I TG   + G+    ++ +YG K    +    +   ++ F  G  +   +EA ++ ++ ++ I ++G+ + + W+L  + +  PT    Y   C  WL +   + K  R    +DK ++++ KK+
Sbjct:  291 AGTSSQIYIVLYGHCRSSAPIYLYGRDG--TRFQDGHEDNFTIMVGDIGTPFKIRVGHTNSGH-SPSWHCKRIELQNMNSGEKFYIPVQRWLAQEQEDGEICREFPIL-CKGQ-----------------------------------------PVLPVTTYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRSKNSSKFLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQGNGWFLEDVVVRDPTTNHEYAFFCHRWLDEGEDDGKIVREMYARDKTISSMRKKL 535          

HSP 25 Score: 68.5514 bits (166), Expect = 1.358e-10
Identity = 65/268 (24.25%), Postives = 117/268 (43.66%), Query Frame = 1
Query: 1690 ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWI---ENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKR-KLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI---PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPA 2472
            E+ +   +++ I+T +  +A T+S+ Y++L G            S+  I++   +  +F++G  D   + + +  +P  +I  G    G +  W    I +    +G +       WL+      Q +  +  +     K + V+  T  T+ V I T ++ N+ T + V L +YG+ G T    +      SK   G V  F  E   +G   K+   HD  G  + W LE +++       EY F C+RWL +  +D   VRE+ A
Sbjct:  272 EKRKSGNWKVSINTSDFPNAGTSSQIYIVLYG---------HCRSSAPIYLYGRDGTRFQDGHEDNFTIMVGDIGTPF-KIRVGHTNSGHSPSWHCKRIELQNMNSGEKFYIPVQRWLAQE----QEDGEICREFPILCKGQPVLPVT--TYKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRSKNSSKFLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQGNGWFLEDVVVRDPTTNHEYAFFCHRWLDEGEDDGKIVREMYA 523          

HSP 26 Score: 68.5514 bits (166), Expect = 1.478e-10
Identity = 45/137 (32.85%), Postives = 72/137 (52.55%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFA----FKSVRTKYEI 960
            YKV +TT ++  +GT   +Y+SI G+K +    +L + K S+K         G    F +   +LGDL  I+I HDGL   + W L+ V + +      + F C+ WL   ++DGK+ RE++A      S+R K E+
Sbjct:  407 YKVYITTGELWNSGTIANVYLSIYGEKGDTGSRKLFRSKNSSK------FLRGQVDTFFLEAVNLGDLCKIVIGHDGLGQGNGWFLEDVVVRDPTTNHEYAFFCHRWLDEGEDDGKIVREMYARDKTISSMRKKLEL 537          

HSP 27 Score: 61.6178 bits (148), Expect = 1.695e-8
Identity = 34/128 (26.56%), Postives = 65/128 (50.78%), Query Frame = 1
Query: 7150 ISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSK 7533
            IS+ V    KA++E+ +K G   +++ + T      GT + ++I L+G    S    L  +    F+ G ED F +   D+G   KI++ H +S     W   R+++QN+++ + +  P   WL++ +
Sbjct:  259 ISHRVHQKGKAKIEK-RKSG--NWKVSINTSDFPNAGTSSQIYIVLYGHCRSSAPIYLYGRDGTRFQDGHEDNFTIMVGDIGTPFKIRVGHTNSGHSPSWHCKRIELQNMNSGEKFYIPVQRWLAQEQ 383          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. Ensembl Mouse
Match: Pkdrej (polycystin (PKD) family receptor for egg jelly [Source:MGI Symbol;Acc:MGI:1338786])

HSP 1 Score: 71.633 bits (174), Expect = 1.499e-11
Identity = 38/103 (36.89%), Postives = 52/103 (50.49%), Query Frame = 1
Query: 7219 YEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECV-DLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLS 7524
            Y + + TG   G GT ANVFI L G    S    L         +G  + F+L    DLG I  I++ HD+S     W+L R++V+NL   +IW + C  WLS
Sbjct: 1116 YLVTIFTGSRWGSGTRANVFIQLMGTEGTSDVHCLSHPYFKTLYRGSINTFLLTTKNDLGDIHSIRVWHDNSGEAPSWYLSRIKVENLFNKRIWLFVCRRWLS 1218          

HSP 2 Score: 67.3958 bits (163), Expect = 3.328e-10
Identity = 42/128 (32.81%), Postives = 68/128 (53.12%), Query Frame = 1
Query: 4648 YEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRR 5031
            Y +T  T +R G+GT ANV+IQ+ G    ++   L++   K+ L  G  + F ++ ++    I  IR+ HDN G   +W+L ++ V+ L    NK I + F C RWL+ D    A      PD+ ++R
Sbjct: 1116 YLVTIFTGSRWGSGTRANVFIQLMGTEGTSDVHCLSHPYFKT-LYRGSINTFLLTTKNDLGDIHSIRVWHDNSGEAPSWYLSRIKVENLF---NKRI-WLFVCRRWLSVDTTLDATFSVTNPDEPLKR 1238          

HSP 3 Score: 65.4698 bits (158), Expect = 1.320e-9
Identity = 37/110 (33.64%), Postives = 61/110 (55.45%), Query Frame = 1
Query: 3811 LKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAI-DLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATN 4131
            L Y+V + TG+ +GSGT ANVF+ + G  G S    L +    ++ +    S++ FL+    DLG +  I++ HDNS    +WYL  + V +  ++  +LF C  WL+ +
Sbjct: 1114 LCYLVTIFTGSRWGSGTRANVFIQLMGTEGTSDVHCLSHPYFKTLYR---GSINTFLLTTKNDLGDIHSIRVWHDNSGEAPSWYLSRIKVENLFNKRIWLFVCRRWLSVD 1220          

HSP 4 Score: 63.929 bits (154), Expect = 3.934e-9
Identity = 37/132 (28.03%), Postives = 67/132 (50.76%), Query Frame = 1
Query: 6001 ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNE-DNFERGHRDHFKLEME-DVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVI 6390
            + YL+++ TG     GT + +F+QL GT+G S ++ L         RG  + F L  + D+G I  IR+ +D +G+ P W+L ++ + N      + F    +LS +       ++   P   +K+TD+ +I
Sbjct: 1114 LCYLVTIFTGSRWGSGTRANVFIQLMGTEGTSDVHCLSHPYFKTLYRGSINTFLLTTKNDLGDIHSIRVWHDNSGEAPSWYLSRIKVENLFNKRIWLFVCRRWLSVDTTLDATFSVT-NPDEPLKRTDFFMI 1244          

HSP 5 Score: 63.1586 bits (152), Expect = 6.679e-9
Identity = 32/103 (31.07%), Postives = 59/103 (57.28%), Query Frame = 1
Query: 1339 YKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNK--DGFKEGSIFEHTLPLRQ-LGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS 1638
            Y ++ +T ++ G+G+ A+++IQ+ G  G SDV  + +        GSI    L  +  LG +  I+V + N+G  P W+L+++ + +L   R++ F C +WLS
Sbjct: 1116 YLVTIFTGSRWGSGTRANVFIQLMGTEGTSDVHCLSHPYFKTLYRGSINTFLLTTKNDLGDIHSIRVWHDNSGEAPSWYLSRIKVENLFNKRIWLFVCRRWLS 1218          

HSP 6 Score: 61.2326 bits (147), Expect = 2.649e-8
Identity = 35/107 (32.71%), Postives = 56/107 (52.34%), Query Frame = 1
Query: 5101 AYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAV-DLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLS 5412
             Y + ++TG    +GT ANVF+++ G  G S    L  S  +     + +++ F      DLG +  I + HDNSG     W+L +I++ + F+   +LF C RWLS
Sbjct: 1115 CYLVTIFTGSRWGSGTRANVFIQLMGTEGTSDVHCL--SHPYFKTLYRGSINTFLLTTKNDLGDIHSIRVWHDNSGE-APSWYLSRIKVENLFNKRIWLFVCRRWLS 1218          

HSP 7 Score: 59.6918 bits (143), Expect = 7.198e-8
Identity = 39/112 (34.82%), Postives = 53/112 (47.32%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATC-VGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHAT 1284
            Y + + TG    SGT + VFI L G  G S    L     +   RG  + F++     +G I  IR+  D SG   SWYL R+ + +L N    + F C+ WLS D    AT
Sbjct: 1116 YLVTIFTGSRWGSGTRANVFIQLMGTEGTSDVHCLSHPYFKTLYRGSINTFLLTTKNDLGDIHSIRVWHDNSGEAPSWYLSRIKVENLFNKR-IWLFVCRRWLSVDTTLDAT 1226          

HSP 8 Score: 58.5362 bits (140), Expect = 1.710e-7
Identity = 36/115 (31.30%), Postives = 52/115 (45.22%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRC-SDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSL 891
            D + Y V + T    G+GT   ++I + G +                      L  GS   F +   +DLGD+ SI + HD      SW L  +++ N+ NKRIWLF C  WLS+
Sbjct: 1112 DTLCYLVTIFTGSRWGSGTRANVFIQLMGTEGT-------SDVHCLSHPYFKTLYRGSINTFLLTTKNDLGDIHSIRVWHDNSGEAPSWYLSRIKVENLFNKRIWLFVCRRWLSV 1219          

HSP 9 Score: 55.4546 bits (132), Expect = 1.328e-6
Identity = 32/106 (30.19%), Postives = 53/106 (50.00%), Query Frame = 1
Query: 6379 YKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSM 6696
            Y V + T +   +GT + V ++  G  G S    L  P    K      ++ F+      LGD+   +VWH+NSG +  W+L  I+++ +  +R W F C +WLS+
Sbjct: 1116 YLVTIFTGSRWGSGTRANVFIQLMGTEGTSDVHCLSHPY--FKTLYRGSINTFLLTTKNDLGDIHSIRVWHDNSGEAPSWYLSRIKVENLFNKRIWLFVCRRWLSV 1219          

HSP 10 Score: 54.6842 bits (130), Expect = 2.644e-6
Identity = 32/109 (29.36%), Postives = 53/109 (48.62%), Query Frame = 1
Query: 2887 VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT 3213
            + Y V + TG   G+GT +NVFI++ G  G T +V   +    K  +             D+G+I SIR+ HD++G   +W++ +I V        ++F   +WL   T
Sbjct: 1114 LCYLVTIFTGSRWGSGTRANVFIQLMGTEG-TSDVHCLSHPYFKTLYRGSINTFLLTTKNDLGDIHSIRVWHDNSGEAPSWYLSRIKVENLFNKRIWLFVCRRWLSVDT 1221          

HSP 11 Score: 53.9138 bits (128), Expect = 3.578e-6
Identity = 35/116 (30.17%), Postives = 59/116 (50.86%), Query Frame = 1
Query: 4255 FNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHS--NKFESGNCDEFQVKC-CDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLE 4593
            + V ++T  +  +GT ANV I L G    S +      L+H        G+ + F +    DLG++  IR+ HDNSG    W+L+++++E     + ++F C  W+S   VD  L+
Sbjct: 1116 YLVTIFTGSRWGSGTRANVFIQLMGTEGTSDV----HCLSHPYFKTLYRGSINTFLLTTKNDLGDIHSIRVWHDNSGEAPSWYLSRIKVENLFNKRIWLFVCRRWLS---VDTTLD 1224          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|C8YR32|LOXH1_MOUSE (Lipoxygenase homology domain-containing protein 1 OS=Mus musculus OX=10090 GN=Loxhd1 PE=2 SV=1)

HSP 1 Score: 927.161 bits (2395), Expect = 0.000e+0
Identity = 669/2164 (30.91%), Postives = 1073/2164 (49.58%), Query Frame = 1
Query:  883 LSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELTGT---TLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT----LEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFK-----INAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRS--PSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDES--DEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK------FESGNCDEFQVKCCDLGE-LKKIRIGHDNSGPNADWHLAKVEIE---AEKLG-QSFVFPCNEWISKSKVDGNLERELYPQLSLT--------------MTKRPK--IKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKS-KLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMN----------ALGESIDQVD------SVANILQKK---AYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERK-TSRIFSIQD--KMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDK--NEDNFERGHRDHFKL-EMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIN-----DIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWH--NNSGFSSR----WHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDR--QIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIE 7107
            L+   EDG+   E   +K+    YE+V  TGD+  +GTD+ VFI+L G  G+SP++ L  ++   F++     F +    VG I KIRI  D +G  +SWYLDRV +TD+K P  RY+F C NWLSK  GD    R++  + + M +    +Y+I  YT +  GAG+ AD++I IFGE G++    ++N KD F++G+  + TL    LG L KI VG+ N G    WFL+K+II D+   R ++FP  +WL+  + +G +++ + V           Y + + TG+   A T S+ Y+++ G           +++ KI++E   F  G TD+  ++L   LSPL+ +  G    G N+ W+ + +VI CP TGI+Q+F C NWL   +     E  L E +S RK +      +  W + ++T+D+K A TNS + + +YG  G+TD+I++ P +     G + +FR EL  +G  YK+RA HD     S W+LEK+ +   +N D+Y F CNRWL  + +D   VRE+ A GP + +   + +Y+V + TG    AGTDANV++ ++G+ GDTG+R L +   NT+ FEKG  DEF IE+V +  + ++++ HD K +GSGW++D+V++ EE  P S++V F C  W D  + DG  VREL  +     L    Y + VKTG V GA TDS V+I+++G+  DT    L  S  N K+ FE G  D F +E  +IG I  + I HD TG  + WF+  + + VP+ G +Y F  N+WLD       LE +L PS++ +I K + Y+I ++TGDV  AGT S+VF+QIYG++ KT+ L L S+S  F+RG++D+F+     I A D+G + KIRI HD      GWFLD+V                     +  Y       + ++D   + R   P  +S    SE EE                  D+N +    L   +K    S        V +KTG++  +GTDANVF+T+FG   ++G   LK++  NS +KFE  S++ F ++ +DLG L K++I HDN+     W++D+V V+  S      FPC  WLA N+D G + +D+F A              + Q ++Y       + + +YT+    AGTDAN+ I++YG       +  +Q    +NK      FE  +   F V+  D+GE ++KIRIGHDN+G N  WH + V+I     EK G ++  FPC+ W++ S+ D    REL P    T                + P   + Y +   T N  GAGT+A VYI +YG    T +  L  + +++ K + G  D F +   D+   I KI++ HDN    + W++EKV +     N      + F C RWL+  +EDG +ER     +     S N          AL   +  VD       + + +Q      Y + V TG   E  T++  F+ + GE+ +   R  +D       F   +++EF    +D+G + KI++ HD +   +  W ++++ +        Y   C  WL+K + D    R                           + LD+                      + + Y +T+ TG     G+    +M LYG  N  T  ++L K +   F     +   +E  D+    ++ I  +G+     W+L  I ++    G L     G WLS+  G++     I ++ D  +MM   S    Y +SV T D+   GT++ +F+ +FG  G+S    L +  N + FER + D F   +M  +G + K+R+ +D  G  P W L  +D+ + S +E+++F+ + +LSK+ G ++ L  D A  N     ++++T Y+++++T N     T   V +   G    S +  ++   +  + F+    D F F D + LGD++   V H      F  +    WH++ I + E++    + F C+  + +    +  ++F       +      S     YEV V TG +  AG   +V+   +G    + K  ++  +    LF R S D+  +  + LGEL+ ++L    + +  YS    W   +V V N +T    +F    W++
Sbjct:   24 LNYDSEDGEDELEHEYYKA--KVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSKSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGG--AETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGN-------KNSGKIFLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKR----LKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRV-------------DITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEG-------------GGQGDNNPLDNLALEQKDKSTTFS--------VTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNS-DKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHA--------------ELQTRLYT--PFVPYEITLYTSDVFAAGTDANIFIVIYG----CDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADL-GVIYKIKLRHDNTKWCADWYVEKVEI----WNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGAS-PESCWLVEELCLAVPTQGTKYTLRCNCWLAKDRGDGVTSRVF-------------------------DLLDAMV----------------VNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGI-NGSTEEVQLDKKKAR-FEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTS----YTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLR-DFACANNEIRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENSSR-QRAFRKGTTDTFEF-DSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKIQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEH--DSSGYYS---GWLVEKVEVTNTSTGVATIFSCGRWLD 2052          

HSP 2 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 475/1323 (35.90%), Postives = 740/1323 (55.93%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSL---DKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKD---------NKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNLNNASDKSKL--QTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-----DKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERS-NAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNY-FAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAG-MPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK-KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTPS 7560
            +Y F  NRWL  ++ D  +  EL P++     +   K + Y +++ TG+  G+GT + VF+ I+G+ G +    L  +  + V     K +   D F I AIDLG L KI+IRHDN+     W+LD V + D ++E  Y FPC  WLA  +D G LS+++ P + +     +D         N LD     + Q+DK   F+V + T  K  AGTDANV I L+G  +++G+  LK S T+S+KFE  + + F V+  DLG+L K+RIGHDN+G    W +  VE++A  LG+   FPC  W++K++ DG++ R+L+     T    P + YEIT  TS+   AGT+AN++I +YG +  CT +  L     + KL  +      F V +EDV + IEKIRIGHDN G+   WH   V ++RLL  K+ +    FPC+RWLA  E+D    REL+P     +K ++ GS+  + + +++       L    Y+++++TG     GT+A V++ +YG+ GD+GER L  S+  T+KFEK   D F  EA DLG ++KI +RHDN+ +   DW+++K+EI +  + + +LF C RWLS  K+D +++R  Y   Y G+RS N  S       + S+   D   D   G    +  D         I Y +++ TG  K+  +    ++ L G  +  TN I L   +    F+ GS E   V   DV  IK++E+ ++G   ES W +  + + +PT+G  Y + C  WL+K  G+  TSR+F + D M+ N+ KK+ Y ++V TGDV  GGT+S +F+ L+G  G++    LDK +  FER   D F +E+ D+    K+RI+ DG G RP WFLE++ + N +T +   F Y ++LS+  G KK L  ++  + D    ++ T Y V VKTS++  AGT + V +  +GE GDSG L LK     NK F+ N  D F F DMLSLG L + +VWH+N G    WHL Y+++K+     +++F C+ WLS ++ DRQ  R+  C N  N  +    ET+YE+ + TG   N G    +VW +  G KN S +F++EN+  +++ F + + D  +   ++LG++ ++ +G +  ++      +  W    + +  +     Y F     I +  K +    ++F+++   E    ++++ L     VKYE++V TG   G GTDANVF+T+FG N ++GKR L QK RNLFE+G  D+F LE ++LG++ K+++EHD S + S W +++V+V N ST     + C  WL KS+G    W+ L PS
Sbjct:  780 QYTFPANRWLDKNQADGRLEVELYPSE----VVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKT--EVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLD--NLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYGCDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEP------LDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCA-DWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQD------GPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAMVVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKG-KKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLRDFACAN--NEIRDELEETTYEIVIETG---NGGETRENVWLILEGRKNRSKEFLVENS-SRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYF--KVFEVTKTTE-SFASKIQSLVP---VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGVATIFSCGRWLDKSRGDGLTWRELFPS 2067          

HSP 3 Score: 482.256 bits (1240), Expect = 7.194e-137
Identity = 397/1473 (26.95%), Postives = 649/1473 (44.06%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK----YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRG-----QTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR------------------------TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPV-ELNEKLSPLTEIIAGINVG----GKNQDWFLD--DIVIFCPQT-GIEQ-SFICGNWLSPSRPGCQTEVSLV----------EDLSKRKLKTVIDFTENT--WMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI---------------PA-------------------TGPGI--VKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR--ELTGTTLLG---KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKID-----KTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSD--TFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG------AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQL 4614
            Y ++V T DV GA T   +YI + G+K++  +  L     + K +       G    F +   ++G +  ++I HD       W L  V+I      + + F  N WL   + DG++  EL+  + V  +    YEI + TGD+  +GT S+VF+ + G  G   ++      ++ F RG     QT  F I A  +G ++KIRIR D +G++  W+LDRV ITD+ N E  Y+F C+ WL+ +  D    RE+    E   + S                         T + ++  T +K  AG+ A+++I +FG    + +  +K    N D F+  SI   T+    LG L K+++G+ N G  P WF++ V ++     +   FPCG+WL+  + +G  +  +   +     Y  +  YE+ + T +   A T +  ++++ G        D + +  K    N + ++ F +         +L  + EII  I +G    G N  W     DI    P+  G E  +F C  WL+ S    +T   LV          +D S R++   ++   +   + V I+T ++  A T++KV + +YGD G T +  +       +K + G+   F  E A +G+ YK++ +HDN+   + W +EK+ +    N DE+ FLC RWLS   ED    R                 PA                   TGP +  V+  P+  Y V + TG    A TD+  F+ + GE  +  +R           F  G ++EF +  + +G I KI+LGHD     S W V+++ +          T RCNCW     GDG+T R  +L    ++    KV YE+ V TG V G GTDSN+F+ ++G  G T  VQL      K +FE    D F +E  DI     +RI  D  G+   WF+++I +     G   +F+   WL  K  +  L       ID     +   Y ++V T D++ AGTD+ VFI I+G++  +  L LK  ++   FER N D F   +   +G + K+R+ HD K    GW                                                      LS +  ++ +  + + F C+ WL+  E D   +R+    + +      L+E  Y + ++TGN  G  T  NV+L + G+   S E  ++N+  +    F + + D F   +I LG +  + + H              W++  + + +    + Y F C   +   +                +K ++  K  +S     Q      + V V T  +  AGTDANV + ++G   D+G   LKQ +   N FE G+ D F ++  +LGEL+K+R+ HD+SG  + W + KVE+     G + +F C  W+ KS+ DG   REL+P +
Sbjct:  686 YHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDY----FERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEG-KTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNN-ETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYG-------CDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCL-AVPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAMVVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKK---KARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGW-----------------------------------------------------HLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQTLRDFACANNE--IRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENS--SRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKR------------KRKYFKVFEVTKTTESFASKIQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGVATIFSCGRWLDKSRGDGLTWRELFPSV 2068          

HSP 4 Score: 432.18 bits (1110), Expect = 4.756e-121
Identity = 328/1106 (29.66%), Postives = 520/1106 (47.02%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIM--------NVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRT----KYEIVVITGDLDDSGTDSKVFISLCG-RTGISPQIQLFKENT--QCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG-FKEGS--IFE---HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS--DVKGEGLEKILPVKK------------------------LPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKI-LDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVIPADSK-----LDSGSVVEFRTELAIVG-IPYKLRAQHDNSGTNSSWNLEKI----LMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPA----------------TGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTG--------------------------TTLLGK----------VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLE-YDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVL 3513
            Y+V V T +++GAGT   +Y+ + GD  +     L   + +           G+   F I    +  +  + + HDG      W L  V +         NVE      F C  WL   K+DG++ REL    S  T    +Y I V TGD+  + TDS+V+I L G ++    Q+ L  +N     F+RG+  +F +    +G I+++ I  D +G  + W+L  V I   +  + +Y F    WL K+  D     E+    E++ I     Y+I  +T +  GAG+ + +++QI+GE G+++V+ + ++   F  GS  IF+    T+    LG L KI++ + N G +P WFL++V I D++    + FPC +WL+  +  G+   ++LPV +                        L ++ +   + + I TG++ +A T +  ++ L G +  + + L K   TN     + KF+    ++  VE  + L  L ++  G +  GK   WF+D + +  P  G   +F CG WL+ +    + + S+V DL   +L+T +      + +++YTSD+  A T++ + +V+YG D   T    +  + +      +  S   F  EL  VG I  K+R  HDN+G N  W+   +    L+ +    +   F C+RWL+ S +D  T+RE+                      + +P  I  Y VQI+TGN   AGTDA V+I IYG+ GDTG+R+L  S   TNKFEKG  D F+IEA  LG I KIKL HD+    + W+V+KV IW + N  +   F C  W    + DG   R     E TG                           T+ G           + Y V V TGK + A TDS  F+ + G+  +  N         K  F  G+ + F +   D+G IK I + HD     S W V+++C+ VP  G KY    N WL     D  T   +DL  + +  I K + Y++TV+TGDV+  GTDS +F+ +YG +  T+++ L  K   FER   D F +   D+    K+RI  DG      WFL+++L
Sbjct:  555 YRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDL-----FEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVE------FPCLRWLDKDKDDGQLVRELLPSDSNATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGK-QYTFPANRWLDKNQADGRLEVELY-PSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTN-----SDKFERDSIEIFTVETLD-LGDLWKVRIGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKN----EDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYGCDAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTN-EDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAMVVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERIL 1636          

HSP 5 Score: 417.542 bits (1072), Expect = 1.825e-116
Identity = 328/1077 (30.45%), Postives = 527/1077 (48.93%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDL-GDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRG----AKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQ--SRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAK--FKEGFTDVVPVE-LNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKL-DSGSVVEFRTELAIV-----GIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPA------------PI-----------CKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPS--NSVTFRCNCWFDSSEGDGLTVRELTGTTLLGK-----VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNK----FEFGATDLFKIEAEDIGEI-KSIRISHDDTGAGSAWFVDQICV--IVP-KLGLKYIFF-LNKWL-----DSKTLE----YDLDPSK-------------IDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            I Y V V T D++GAGT   IY+ + G + N    ++                 G T IF I  + L   L  + I H  +     W  + V I+         F C++WL   K DG + R+L+   S+R K      + + V T DL  +GT+S +FI + G+ G + +I L   N + F+ G   KF +    +G   KIR   D     S W+L+++ + +  N + +Y F C  WL  +  D+  VRE+       + IMG+A   RY+++  T    GAG+ A++Y+ +FG+    GE  + + +N  D F++G+  E T+    +  +++++V +   G    W+L++V++ +  Q  S   EFPC +WL   K +G  + ++LP        + ++Y + + TG+ + AST SR Y+ L G +      D I+    +   N K  F+ G  D   +E LN  +  +  ++ G +  G +  WFL  + I  P+ G + +F    WL  ++   + EV L         K V       + + I+T D+  A T S+V + +YG+ GKT+ + + + SK+ D GS   F+T+   +     G   K+R +HDN+G    W L+++ +T   N   Y F C RWL+   +D    RE+       V P+            P+             + V I TG+K  AGTDANVFI ++G + + G   L  S TN++KFE+  ++ F +E + LG + K+++GHD+     GWFVD V   E   PS    +TF C  W   +E DG  VR+L    L  +     V YE+ + T  V  AGTD+N+FI I+G   D    + K   TNK +    FE  +   F +E ED+GEI + IRI HD+TG    W    + +  ++P K G + + F  ++WL     D KT+     YD+   K             +++    + Y + +FTG+V  AGTD+KV+I IYG    T +  L   +++++ FE+G  D F I AAD+GVI KI++ HD  K  + W+++KV
Sbjct:  296 ITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV--------FDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEI-LLNPNNKWFKPGIIEKFRMELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKD-KYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMA---RYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDS-NATLKNFRYHISVKTGDVSGASTDSRVYIKLYGEKS-----DTIKQVLLVSDNNLKDYFERGRVDEFTLETLN--IGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLV------HYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWV---EVDAPSLGKCMTFPCGRWLAKNEDDGSIVRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIVIYGC--DAVCTRQKFLCTNKREQKLFFERKSASRFIVELEDVGEIIEKIRIGHDNTGINPGWHCSHVDIRRLLPEKDGTETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKV 1340          

HSP 6 Score: 392.504 bits (1007), Expect = 1.143e-108
Identity = 303/1051 (28.83%), Postives = 504/1051 (47.95%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFA-FKSVRT----KYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL-EKIL--PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIK-DKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI----PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVRE-IPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQL--KTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPS-------------------------KIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK---SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            +Y+V   T DV+GAGT   ++I++ G+    P++ L          +       +  +F +R +++G +  I IEHD      SW L  V + +++   + + F CN+WLS  + D +  R+L A F  +      KYEI V TGD+  +GTD+ VFI++ G  G + + +L  E    F++G   KF + A  +G + KI +  +  G  + W+L ++ I D+ N   +Y F    WL+ D  D    R+I  G  E   I     Y ++ +T +  GAG+ + IY+ ++G  G  +   I     F EG +F+       H      L  L ++ +G+ N G    W+  KV+I      + Q+    FPC  WL + K +GL E+ L   V    +R +KY + + + T +   A T S  ++ + G + + D+IL  +   NK W     FK G  +   +EL + L    +I A  +       W L+ + +       + +F C  WL  +    + +  +V +++              + V++ T +++ A T++ V L L+GD G T + ++          + G+  EF  E   +    ++R +HD  G+ S W L+++L+ +      D  +F C RWL    +D   VRE +P+     +K     +Y + + TG+   A TD+ V+I +YGEK DT  + L  S  N  + FE+G++DEF +E + +G I+++ +GHDS    +GWF+  V I          TF  N W D ++ DG    EL  + ++     V YE+E+ TG V GAGT S VF++I+G+ G T  + L  ++ + ++   +   TD F I A D+G +  IRI HD+TG    WF+D++ +        Y F   +WL    D   L  +L P                           +++ DK+  + +T+ TGD  +AGTD+ VFI ++G         LKS    SD FER + ++F +   D+G + K+RIGHD      GWF+D V
Sbjct:   44 VYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHL-------TSKSESAFEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPMDMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN-FEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKR-KYDFPLNRWLALDEDDGKIQRDILVGGAETTAIT----YIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKI-----FLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQT----FPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEIL--LNPNNK-W-----FKPGIIEKFRMELPD-LGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDAN----EDDNEIVREMTAEGPTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSNATLKNF---RYHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQI-RVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEIEIWTGDVGGAGTTSRVFVQIYGEEGKTEVLFLSSRSKVFDRGSKDIFQTDTFTIYAIDLGALTKIRIRHDNTGNRPGWFLDRVDITDVNNETTYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPSEDEEGGGQGDNNPLDNLALEQKDKSTTFSVTIKTGDKKNAGTDANVFITLFGTQDNNGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRIGHDNTGKAPGWFVDWV 1055          

HSP 7 Score: 256.529 bits (654), Expect = 8.305e-67
Identity = 215/841 (25.56%), Postives = 396/841 (47.09%), Query Frame = 1
Query: 5092 QKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIID-KFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDV-GKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLAIDLAPIND--IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPT-KTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKT--YVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNL---FEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI---LTPSE 7563
            + K Y +   TG     GT+ANVF+ ++GENG S +  L  SK+ +  FEK N+D F     ++G ++KI I HDN+G     W+L ++ + D K  +  Y F+C  WLSK + D++  R L +A +  +  + P G                                         Y I + TG     G+    ++ ++G     T   RL+  E + F  G+++  +++APD+  + ++ + +      + W+L+ I IE     + Y+     WL+    + K  R   +     T     ITY+++V TGD+   GT S ++L ++G +GN +   +      F+RG  D F +++  +   + ++ I +   G    W+ EK+ I    T     F  + +L   K  G  ++   ++  +    +KK  + + V T+++K AGT+S + ++ YG+ G + ++ L     NNK FK   +++F   ++  LG   + + WH+     S WHLE + +     +  + F CN+WL   +DD +I RE+  E    PT +       Y VTV TG+ + AG   +V+   +G+   + + ++ N  +   LF + + D+  +  V + +++      V  +++       W+ + V V+     ++    F    W++  +     DG++  +  ++   + A ++  +      Y I V TG  +G  TD+ V+I L+GE S++ K+ L+    NL   FE+G+ D+F LE +++G I ++ I HD +   + WFL  VQ++     K + +P N WL K++   ++   L PSE
Sbjct:   41 KAKVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLT-SKSES-AFEKANVDVFRVRTNNVGLIYKIRIEHDNTGL-NASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDL-LASF--DPMDMPRGNK---------------------------------------YEIKVYTGDVIGAGTDADVFINIFGEYG-DTGERRLEN-EKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETT----AITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLEGGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLN---PNNKWFKPGIIEKFRM-ELPDLGRFYKIRAWHDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREMTAEG---PTVRRIMGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVR-----RVRVRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKD----DGQL--VRELLPSDSNATLKNFR------YHISVKTGDVSGASTDSRVYIKLYGEKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGTINRLVIGHDSTGMHAGWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSE 806          

HSP 8 Score: 249.98 bits (637), Expect = 8.674e-65
Identity = 220/836 (26.32%), Postives = 362/836 (43.30%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF---------------------AFKSVRTKYEIVVITGDLDD---------------------SGTDSKVFISLCGRTG-ISPQIQL-FKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR--EIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK---LDSGSVVEFRTELAIVG------IPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED-----FSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT--FRCNCWFDSSEGDGLTVREL 2862
            D +LY V + T +V GAGT   +YI+I GD  +     L K +    K        G+   F I  +DLG +  I + HD  +    W ++ VEI N  N+  +LF C  WLSL KEDG++ R  +                     A  S     +I  +TG + D                     + TDS+ F+ L G     + +I L + +  + F  G   +F +    VG I KI +  D +  +S W ++ +C+  +     +Y  +C  WL+KD GD  T R  ++  A  ++ I  +  Y+++ +T +  G G+ ++I++ ++G NG ++ + + K K  F+        + +  +    K+++     G +P WFL ++++ +++   +  F  G WLS  KG+   + +I  V    E  +   Y + + T +   A T +  ++I+ G       L   +S N  W    KF+   TD         L  L ++    +  G    W L  + +          F C  WLS S    QT    + D +    +   +  E T+ + I T +     T   V L+L G   ++ + ++   S+      G+   F  +   +G      + +  R           W+++ I +T+   G+ Y F C+  +    +      F   +   +    I    P+ KY+V + TG +  AGTDANVF+ I+G  GDTG R L     N   FE+G  D F +E ++LG + K++L HDS    SGW V+KV   E  N S  V   F C  W D S GDGLT REL
Sbjct: 1253 DIVLYSVQIFTGNVPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNK-----FEKGTADTFIIEAADLGVIYKIKLRHDNTKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDIDTVTGPMVDYVQDGPVIPYYVSVTTGKHKEAATDSRAFVLLIGEDDECTNRIWLDYPQGKRGFSCGSVEEFYVGGLDVGIIKKIELGHDGASPESCWLVEELCLA-VPTQGTKYTLRCNCWLAKDRGDGVTSRVFDLLDAM-VVNIGKKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEVQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGMGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQKKGKKTLVCEICAVIDGEEMMEWTSYTVSVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSAN--W---NKFERNNTDTFNFSDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFRFQCDCWLSKSEGDRQT----LRDFACANNEIRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENSSRQRAFRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKIQSLVPV-KYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL--FERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKV---EVTNTSTGVATIFSCGRWLDKSRGDGLTWREL 2064          

HSP 9 Score: 219.55 bits (558), Expect = 1.245e-55
Identity = 187/677 (27.62%), Postives = 307/677 (45.35%), Query Frame = 1
Query: 5581 DENDTAQTEYI---AYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISI-EMPTKGKLYNVTCGVWLSKFMGERKTSR-IFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL--VQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQV----QNLSTNKIWKYPCNEWLSKSKG---LWKILTPSE 7563
            D  D  + EY     Y +   TG  +  G+    ++ L+G   L   +    K E+  F   + +V  V   +V  I ++ I ++     +SWYL+ + + +M      Y   C  WLSK  G+R+  R + +  D M  ++ +   Y I V TGDV   GT++ +F+ +FG  G++    L+  +DNFE+G  D F L+  D+G++ KI + ++  G    WFL K+ I +      Y F  N +L+ +    K     L    +     Y V V T +++ AGT S + +  YG  G  +SG + L+        F   + D F     + L  LSR  + H N G +  W+ E + +    T     FPC+ WL     D  I R+L      +  K    +  + + V T D K AG    ++   YG+K  +D+ ++  N    K F     +K ++    LG    I+       ++  +    W   ++ + N      Y F    W++ +E   E   E+       E P   R+      G+ +Y + V TG+  G GTDANV++ LFG+  ++G+R L   +   +LFE+G  D+F +E V + K+ ++++ HD     S W+LDRV V    Q  S N   ++PC  WL K K    L + L PS+
Sbjct:   30 DGEDELEHEYYKAKVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLHLTSKSESA-FEKANVDVFRVRTNNVGLIYKIRIEHDNTGLNASWYLDRVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFDPM--DMPRGNKYEIKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDKFTLDAPDLGQLMKINVGHNNKGGSAGWFLSKIIIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDIRGAGTKSKIYLVMYGARGNKNSGKIFLE-----GGVFDRGRTDIFHIDLAVLLSPLSRVSIGHGNIGVNRGWYCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLY--EMVSLRKKRLKKYPWSLWVWTTDLKKAGTNSPIFIQIYGKKGRTDEILLNPN---NKWFKPGIIEKFRMELPDLGRFYKIRAW-----HDRQNPGSGWHLEKMTLMNTINKDKYNFNCNRWLDANEDDNEIVREM-----TAEGPTVRRI-----MGMARYRVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRKVRRVRVRHDGKGSGSGWYLDRVLVREEGQPESDNV--EFPCLRWLDKDKDDGQLVRELLPSD 676          

HSP 10 Score: 95.9005 bits (237), Expect = 4.761e-18
Identity = 73/293 (24.91%), Postives = 132/293 (45.05%), Query Frame = 1
Query:  466 DCYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEH----DGLEPKDS--WLLQGVEIMNVENKRIWLFTCNHWLSL-----YKEDGKVSRELFAFKS-----VRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            DC+ S  + ++  LR  +          +E  Y++ + T +  G  T   +++ + G K       ++   +            G+T  F      LGD+ S+ + H    D   PK    W ++ + I  +E   ++ F C+  + L     Y +  +V++   +F S     V  KYE++V TG    +GTD+ VF+++ G  G + + +L ++    F+RG T +F +    +G + K+R+  D SG  S W +++V +T+         F C  WL K  GD  T RE+
Sbjct: 1781 DCWLSKSEGDRQTLRDFACANNEIRDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLVENSSRQRA------FRKGTTDTFEFDSIFLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKIQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGV-ATIFSCGRWLDKSRGDGLTWREL 2064          

HSP 11 Score: 61.2326 bits (147), Expect = 1.655e-7
Identity = 38/124 (30.65%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+V VTT    GAGT   ++++I G   +  +  LK+  ++           GST  F +   +LG+L  + +EHD       WL++ VE+ N       +F+C  WL   + DG   RELF
Sbjct: 1949 VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL-------FERGSTDRFFLETLELGELRKVRLEHDSSGYYSGWLVEKVEVTNTSTGVATIFSCGRWLDKSRGDGLTWRELF 2065          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q8IVV2|LOXH1_HUMAN (Lipoxygenase homology domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LOXHD1 PE=2 SV=4)

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 473/1329 (35.59%), Postives = 736/1329 (55.38%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSG-----------ERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKD--------NKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRND-CTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-----DKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNY-FAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAG-MPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK-KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG---LWKILTPS 7560
            +Y F  NRWL  ++ D  +  EL P++     +   K + Y V++ TG+  G+GT A V++ I+G+ G +            ERA K+T             D F I AIDLG L KI+IRHDN+   A W+LD + + D ++E  Y FPC  WLA  +D G LS+++ P + +      +        N LD     + Q+DK   F+V + T  K  AGTDANV I L+G  +D+G+  LK S T+S+KFE  + + F V+  DLG+L K+R+GHDN+G    W +  VE++A  LG+   FPC  W++K++ DG++ R+L+     T    P + YEIT  TS+   AGT+AN++I +YG +  CT++  L  N    K   +      F V +EDV + IEKIRIGH+N G+   WH   V ++RLL +K+ +    FPC+RWLA  E+D    REL+P     +K ++ GS+  + + +++       L    Y+++++TG     GT+A V++ +YG+ GD+GER L  S+  T+KFE+   D F  EA DLG ++KI +RHDNS +   DW+++K+EI +  + + +LF C RWLS  K+D +++R  Y   Y G+RS+  S  +       ++ +      +  G  A    E        I Y +++ TG  KD  +    ++ L G  + ++  I L        F+ GS E   V   DV  IK++E+ ++G   ES W +  + + +PT+G  Y + C  WL+K  G+  TSR+F + D M+ N+  K+ Y ++V TGDV  GGT+S +F+ L+G  G++    LDK +  FER   D F +E+ D+    K+RI+ DG G RP WFLE++ + N +T +   F Y ++LS+  G KK L  ++  + D    ++ T Y V VKTS++  AGT + V +  +GE GDSG L LK     NK F+ N  D F FPDMLSLG L + +VWH+N G    WHL Y+++K+     ++ F C+ WLS ++ D Q  R+  C N  N       ET+YE+ + TG   N G    +VW +  G KN S +F+MEN+  +++ F + + D  +   +YLG++ ++ +G +  ++      +  W    + +  +     Y F     I +  K +    ++F+++   E    ++V+ L     VKYE++V TG   G GTDANVF+T+FG N ++GKR L QK RNLFE+G  D+F LE ++LG++ K+++EHD S + S W +++V+V N ST     + C  WL K +G    W+ L PS
Sbjct:  780 QYTFPANRWLDKNQADGRLEVELYPSE----VVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQT----------DTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLD--NLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEP------LDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCA-DWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPI-----IPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKG-KKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACAN--NKICDELEETTYEIVIETG---NGGETRENVWLILEGRKNRSKEFLMENS-SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYF--KVFEVTKTTE-SFASKVQSLVP---VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPS 2066          

HSP 2 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 553/1915 (28.88%), Postives = 920/1915 (48.04%), Query Frame = 1
Query: 2116 FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK--LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGD-EYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRE-LTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGD--TGNVQLKTSMTNKNKFEFGATDLFKIE-AEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLE-------YDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE----SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENF--NVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNK-----FESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNAS---DKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP---DKVIRRGSMNALGESIDQVDSVANILQKK----AYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRL---QKLETNYFAPGSKEVISVEAPDV-ENIKQVEICNEGVDRESSWYLNSISIE--MPTKGKLYNVT--CGVWLSKFMGERKTSR------IFS---IQDKMMTNVSKK-------ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN---FERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLA------------------------------IDLA----PINDIKK----TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGD-SGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKL-FSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGR-NLFEQGQEDKF-ILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            +    + V   T D++ A T++ V + L+G+NG +  + + + SK   + G+V  FR     VG+ YK+R +HDN+G N+SW L+ +++T        Y F CN WLS    D    R++ A+   +  P    KY+V++YTG+ + AGTDA+VFINI+GE GDTG+R L +   N   FEKG  D F+++A  LG + KI +GH++K   +GWF+ +++I E+        F  N W    E DG   R+ L G      +TY V V TG V+GAGT S +++ ++G  G+  +G + L+  +     F+ G TD+F IE A  +  +  + + H + G    WF +++ ++ P  G++  F  + WLD K  +       Y++   +  ++ K  P+ + V+T D+  AGT+S +FIQIYG+  +TD++ L   +  F+ G             +I+K RI    + P  G F    +                                        + S S   L +++     N D+Y F CNRWL ++EDDN IVRE+  T E       +   +Y V V TG   G+GTDANV+L +FG  GD+GER L N  +N+ + FE+ + D+F I+++ +  + +++IRHD    G+ WYLD VLV +E    SD   FPC  WL  +KD G L +++ P++ +                      L+NF  ++ + T     A TD+ V+I LYG+ +D+    +KQ L  S+      FE G  DEF ++  ++G + ++ IGHD++G +A W L  V+I   + G+ + FP N W+ K++ DG LE ELYP   + + K   + YE+   T +  GAGT+A VY+Q+YG    TE   L++ S   +++   T  TD F +   D+   + KIRI HDN G  + W L+++ +     + N  I Y FPC RWLA +E+DG + RELLP     V+ +      G   + +D++A  L++K     +++ + TG     GT+ANVF+ ++G   D+G   L  SKT++DKFE+++++ F  E +DLG ++K+ + HDN+G     WF+  +E+      +   F C RWL+K++DD  I R L+ A  Q             +Y                              T ++ Y IT+ T      G+    ++ +YG   + T    L   ++ +  +F   S     VE  DV E I+++ I +        W+ + + I   +P K     +T  C  WL+    ++KT R      IF+   ++D  +  V K+       + Y + + TG++   GT++ +++ ++G  G++    L K+E+    FERG  D F +E  D+G I KI++++D +     W++EK++I N++  + + F    +LS  K  G+ ++L                               +D++    P+ D  +      Y V V T   K A T S   +   GE  + S  + L  P +  + F    ++EF +   L +G + + ++ H+ +   S W +E + +        +   CN WL+    D    R     +A       +    YE+TV TGD    G   +++   YG    ++    E  +DK+K  F R   D   +  + +     +++     + +      +WF   + +KN+ T    +F    W+   +  +    E+            A ++E +      Y + V T    G GTDANVFI +FGEN +SG   L Q    N FE+   D F   + + LG + K+++ HD+      W L  V V++ S ++ + + C+ WLSKS+G
Sbjct:   40 YKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRG-NKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN---FEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVI-EDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRL-KKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPNNKWFKPG-------------IIEKFRI----ELPDLGRFYKIRVWHDK------------------------------------RSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREM--TAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNT-DLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSA--------------------TLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDT----IKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKL--VHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQTDTFTIYAIDL-GALTKIRIRHDNTGNRAGWFLDRIDI----TDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLA--LEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTG-KAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQ-----------TRLY------------------------------TPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYP-RGKRGFSRGSVEEF-YVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVK--VLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTE----EMQLDKKKARFEREQNDTFIMEILDIAPFTKMRI-----RIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMC-----------AVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEG 1788          

HSP 3 Score: 612.068 bits (1577), Expect = 6.437e-180
Identity = 330/870 (37.93%), Postives = 507/870 (58.28%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNP-SNSVTFRCNCWFDSSEGDGLTVRELT---GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTN-KNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT----LEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFK-----INAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            YE+V  TGD+  +GTD+ VFI+L G  G+SP++QL  ++   F++G    F +    VG I K+RI  D +G  +SWYLD V +TD+K P  RY+F C NWLSK  GD    R++  +   M +    +Y++  YT +  GAG+ AD++I IFGE G++    ++N KD F++G+     L    LG L KI VG+ N G    WFL++++I D+   R ++FP  +WL+  + +G +++ + V           Y + + TG+   A T S+ Y+++ G           +++ KI++E   F  G TD+  +EL   LSPL+ +  G    G N+ WF + +VI CP TGI+Q+F C NWL   +     E  L E +S RK +      +  W + ++T+D+K A TNS + + +YG  G+TD+I++ P +     G + +FR EL  +G  YK+R  HD   + S W+LE++ +   +N D+Y F CNRWL  + +D   VRE+ A GP + +   + +Y V + TG    AGTDANV++ ++G+ GDTG+R L +   NT+ FEKG  DEF IE+V +  + ++++ HD K +GSGW++D+V++ EE  P S++V F C  W D  + DG  VREL     +  L    Y + +KTG V GA TDS V+I+++G   DT    L  S  N K+ FE G  D F +E  +IG I  + I HD TG  ++WF+  + + VP+ G +Y F  N+WLD       LE +L PS++ +I K + Y++ ++TGDV  AGT ++V++QIYG+  KT+ L L S+S  FER ++D F+     I A D+G + KIRI HD     +GWFLD++
Sbjct:   45 YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAET--TAITYIVTVFTGDVRGAGTKSKIYLVMYGARGN-------KNSGKIFLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKR----LKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRI 901          

HSP 4 Score: 608.216 bits (1567), Expect = 1.330e-178
Identity = 543/2062 (26.33%), Postives = 917/2062 (44.47%), Query Frame = 1
Query: 1690 ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIF-CPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD-SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGD--TGDRFLTHSTTNTNKFEKGQMDEFLIE-AVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSV--TFRCNCWFDSSEGDGLTVRELTGTT-----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK------TLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVN--DESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQ-----VKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYP-----------------------QLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKS-KLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDK--FEKNNMDEFEWEAVDLGKVF-KIDIRHDNSGFFKKDWFLKKIEI----IDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLE--TNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIF----------------------SIQDKM-----------MTNVSKK---ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSL-----YPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVG----QKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNE-TSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVT-CVYLGELKNIKLGAVVNKNELYSDSK----KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRN-LFEQGQEDKFILECVDLGKIEKIKIEH--DDSRF----RSDWFLDRVQVQNLSTNKIWKYPCN 7512
            E Y+   YE+  +TG+   A T +  ++ L G   ++ +  K++ T+K     + F++G  DV  V  N  +  + ++    +  G N  W+LD +++    +  +   F C NWLS      Q    L+   +   +        N + V +YT D+  A T++ V + ++G+ G T +  +  +    + G+   F  +   +G   K+   H+N G ++ W L +I++    N  +Y F  NRWL+   +D    R+I   G           Y V ++TG+   AGT + +++ +YG +G+  +G  FL         F++G+ D F IE AV L  +S++ +GH +     GWF +KV+I     P   +  TF C+ W D  + DGL  R+L          L K  + + V T  ++ AGT+S +FI+I+GQ G T  + L     N   F+ G  + F+IE  D+G    IR+ HD   +GS W ++++ ++      KY F  N+WLD+         E   +   + +I     Y +TV TG++  AGTD+ V++ ++G    T +  L   ++ +D FE+GN D F I +  +  ++++RI HDGK  GSGW+LD+VL                                                   + E+ +   D   F C RWL  D+DD  +VRELLP+D      + LK  +Y + +KTG+  G+ TD+ V++ ++G   D+ ++ L  + +N  + FE   +D+F ++ +++G + ++ I HD++   A+W+L  V +    +  +Y FP   WL  N+  G L  +++P+                  ++ +  KL ++ V+++T     AGT A V++ +YGE   + ++ L    + S  FE  + D FQ     +   DLG L KIRI HDN+G  A W L +++I       ++ FPC  W++  + DG L REL P                        L+L   K     + +T  T  +K AGT+ANV+I ++G  D T  T L ++   S K +    ++F V   D+ D + K+R+GHDN G    W ++ V V      K       FPC RWLA++E+DG+I R+L   ++  R     +                  Y I +YT      GT+AN+F+ +YG +    +++ + +     K  FE+ +   F  E  D+G++  KI I H+N+G     W    ++I     DK   ET  F C+RWL+ S+DDKK  R L       E+     G  R +Y      LD                         + Y++ I TG     G+    ++ +YG     T    L K E  TN F  G+ +   +EA D+  I ++++ ++     + WY+  + I   T    +   CG WLS    + +  R+F                      ++  KM           M +  ++   I Y +SV TG      T+S  F+ L G     S      YP  K    F RG  + F +   DVG IKKI + +DG      W +E+L +   +    Y    N +L+K+ G     +    +D   +N   K  Y++ V T +V   GT S + +  YG  G + +++L   ++    F+  Q D FI  ++L +   ++ ++  +  G    W LE I +K + T     F    WLS     R+  + L+CE      +    E TSY V V T D   AG   +V+ + +GE   S    ++ + +  K F R++ D       + LG L  ++         ++ D+K     W  + V VK+ +  +T+ F+   W+       E DG+   + +     NK   +EL++     YEI++ T  GNG  T  NV++ L G  + S +  +    R   F +G  D F  + + LG I  + + H   + RF       W +  + +  +    ++ + C+
Sbjct:   38 EYYKARVYEVVTATGDVRGAGTDANVFITLFG---ENGLSPKLQLTSK---SKSAFEKGNVDVFRVRTN-NVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPR-----GNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGA----ETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV-----FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVI---LCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNP---NNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVL---------------------------------------------------VREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSS----ATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPS------------------EVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLS---SRSKVFERASKDTFQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQ-KDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGD-LWKVRLGHDNTGKAPGWFVDWVEVDAPSLGK----CMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFV-----------------PYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTG-MNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKY-MKDGSLRQVYKEVEEPLD------------------------IVLYSVQIFTGNIPGAGTDAKVYITIYGDLG-DTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKR--GFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQL---DKKKARFEREQNDTFIM-EILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQ----RKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNK-FERNNTDTFNFPDMLSLGHLCKLR---------VWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKS----EGDGQT--VRDFACANNKI-CDELEE---TTYEIVIET--GNGGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCD 1914          

HSP 5 Score: 480.715 bits (1236), Expect = 1.949e-136
Identity = 395/1474 (26.80%), Postives = 650/1474 (44.10%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK----YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRG-----QTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR-----------------------TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKY-KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGF-----TDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLD--DIVIFCP-QTGIEQ-SFICGNWLSPSRPGCQTEVSLV----------EDLSKRKLKTVIDFTENT--WMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPAD----SKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREI---------------PA-------------------TGP--GIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTF--RCNCWFDSSEGDGLTVR--ELTGTTLLG---KVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKIDKT-----IPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSD--TFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGG------AAWYLDYVLVNDE--SDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQL 4614
            Y +++ T DV GA T   +YI + GDK++  +  L     + K +       G    F +   ++G++  ++I HD      SW L  V+I      + + F  N WL   + DG++  EL+  + V  +    YE+ + TGD+  +GT ++V++ + G  G   ++      ++ F+R      QT  F I A  +G ++KIRIR D +G+++ W+LDR+ ITD+ N E  Y+F C+ WL+ +  D    RE+    E   +                          T + ++  T  K  AG+ A+++I +FG   ++ +  +K    N D F+  SI   T+    LG L K+++G+ N G  P WF++ V ++     +   FPCG+WL+  + +G  +  +   +     Y  +  YE+ + T +   A T +  ++I+ G        D + +  K    N + ++ F          VEL +    + +I  G N  G N  W     DI    P + G E  +F C  WL+ S    +T   LV          +D S R++   ++   +   + V I+T +I  A T++KV + +YGD G T +  +       +K + G+   F  E A +G+ YK++ +HDNS   + W +EK+ +    N DE+ FLC RWLS   ED    R                 PA                   TGP    V+  PI  Y V + TG    A TD+  FI + GE  +   R           F +G ++EF +  + +G I KI+LGHD     S W V+++ +     P+    +   CNCW     GDG+T R  +L    ++    KV YE+ V TG V G GTDSN+F+ ++G  G T  +QL      K +FE    D F +E  DI     +RI  D  G+   WF+++I +     G   +F+   WL  +  +  L       ID+        Y + V T D++ AGTD+ VFI I+G++  +  L LK  ++   FER N D F   +   +G + K+R+ HD K    GW                                                      LS +  ++ +  + + F C+ WL+  E D   VR+    + K      L+E  Y + ++TGN  G  T  NV+L + G+   S E  ++N+  +    F + + D F   +I LG +  + + H             AW++  + + +    + Y F C   +   +   +            +K ++  K  +S     Q      + V V T  +  AGTDANV + ++G   D+G   LKQ +   N FE G+ D F ++  +LGEL+K+R+ HD+SG  + W + KVE+     G + +F C  W+ K + DG   R+L+P +
Sbjct:  686 YHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDY----FERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKG-KTEVLFLSSRSKVFERASKDTFQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNN-EITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYG-------CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCL---AVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKK---KARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGW-----------------------------------------------------HLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNK--ICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENS--SRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKY------------FKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPSV 2067          

HSP 6 Score: 431.795 bits (1109), Expect = 7.512e-121
Identity = 331/1076 (30.76%), Postives = 529/1076 (49.16%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDL-GDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRG----AKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGE---NGESDVIDIKNK-DGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQ--SRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAK--FKEGFTDVVPVE-LNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKL-DSGSVVEFRTELAIV-----GIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPA-----------PI-----------CKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPS--NSVTFRCNCWFDSSEGDGLTVRELTGTTLLGK-----VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNK----FEFGATDLFKIEAEDIGEI-KSIRISHDDTGAGSAWFVDQICV--IVP-KLGLKYIFF-LNKWL-----DSKTLE----YDLDPSK-------------IDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPL---KSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            I Y V V T DV+GAGT   IY+ + G + N    ++                 G T IF I  + L   L  + + H  +     W  + V I+         F C++WL   K DG + R+L+   S+R K      + + V T DL  +GT+S +FI + G+ G + +I L   N + F+ G   KF I    +G   KIR+  D+  S S W+L+R+ + +  N + +Y F C  WL  +  D+  VRE+       + IMG+A   RY ++  T    GAG+ A++Y+ +FG+    GE  + + +N  D F++G+  E T+    +  ++++++ +   G    W+L++V++ +  Q  S   EFPC +WL   K +G  + ++LP        + ++Y + + TG+ + AST SR Y+ L G +      D I+    +   N K  F+ G  D   +E LN  +  +  ++ G +  G +  WFL  + I  P+ G + +F    WL  ++   + EV L         K V       + V I+T D+  A T+++V + +YG+ GKT+ + + + SK+ +  S   F+T+   +     G   K+R +HDN+G  + W L++I +T   N   Y F C RWL+   +D    RE+       V P            P+             + V I TG K  AGTDANVFI ++G + DTG   L  S TN++KFE+  ++ F +E + LG + K++LGHD+     GWFVD V   E   PS    +TF C  W   +E DG  +R+L    L  +     V YE+ + T  V  AGTD+N+FI I+G   D    Q K   TNK +    FE  +   F +E ED+GEI + IRI H++TG    W    + +  ++P K G + + F  ++WL     D KT+     YD+   K             +++    + Y + +FTG++  AGTD+KV+I IYG    T +  L   +++++ FERG  D F I AAD+GVI KI++ HD  K  + W+++KV
Sbjct:  296 ITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGV--------FDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEI-LLNPNNKWFKPGIIEKFRIELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKD-KYNFNCNRWLDANEDDNEIVREMTAEGPTVRRIMGMA---RYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDS-SATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKS-----DTIKQVLLVSDNNLKDYFERGRVDEFTLETLN--IGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLV------HYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWV---EVDAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYG--CDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKV 1339          

HSP 7 Score: 425.246 bits (1092), Expect = 8.628e-119
Identity = 317/1107 (28.64%), Postives = 515/1107 (46.52%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIM--------NVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRT----KYEIVVITGDLDDSGTDSKVFISLCG-RTGISPQIQLFKENT--QCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN---------KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS--DVKGEGLEKILPVKK-----------------------LPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVIPADSK-----LDSGSVVEFRTELAIVG-IPYKLRAQHDNSGTNSSWNLEKI----LMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPA----------------TGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-----ELTG--------------------------TTLLGK----------VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDS------KTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVL 3513
            Y V V T +++GAGT   +Y+ + GD  +     L   + +           G+   F I    + ++  + I HDG      W L  V +         NVE      F C  WL   K+DG++ REL    S  T    +Y I + TGD+  + TDS+V+I L G ++    Q+ L  +N     F+RG+  +F +    +G I+++ I  D +G  +SW+L  V I   +  + +Y F    WL K+  D     E+    E++ I     Y++  +T +  GAG+ A +Y+QI+GE G+++V+ + +         KD F+  +    T+    LG L KI++ + N G +  WFL+++ I D++    + FPC +WL+  +  G+   ++LPV +                       L ++ +   + + I TG + +A T +  ++ L G +  D  +  ++S+      + KF+    ++  VE  + L  L ++  G +  GK   WF+D + +  P  G   +F CG WL+ +    + + S++ DL   +L+T +      + +++YTSD+  A T++ + +++YG D   T    +  + +      +  S   F  EL  VG I  K+R  H+N+G N  W+   +    L+      +   F C+RWL+ S +D  T+RE+                      + +P  I  Y VQI+TGN   AGTDA V+I IYG+ GDTG+R+L  S   TNKFE+G  D F+IEA  LG I KIKL HD+    + W+V+KV IW + N  +   F C  W    + DG   R     E TG                          +T+ G           + Y V V TGK + A TDS  FI + G+  +            K  F  G+ + F +   D+G IK I + HD     S W V+++C+ VP  G KY+   N WL         +  +DL  + +  I   + Y++TV+TGDV+  GTDS +F+ +YG +  T+++ L  K   FER   D F +   D+    K+RI  DG      WFL+++L
Sbjct:  555 YHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDL-----FEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVE------FPCLRWLDKDKDDGQLVRELLPSDSSATLKNFRYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGK-QYTFPANRWLDKNQADGRLEVELY-PSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQTDTF---TIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQ-DDTGMTLLKSSK---TNSDKFERDSIEIFTVETLD-LGDLWKVRLGHDNTGKAPGWFVDWVEVDAPSLGKCMTFPCGRWLAKN----EDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTN-EDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERIL 1635          

HSP 8 Score: 392.504 bits (1007), Expect = 1.464e-108
Identity = 300/1053 (28.49%), Postives = 507/1053 (48.15%), Query Frame = 1
Query:  559 LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFA-FKSVRT----KYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIR-GAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDGFKEGSIFE-------HTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVII----NDLDQSRVFEFPCGQWLSDVKGEGL-EKIL--PVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIK-DKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI----PADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQ--AVNGDEYQFLCNRWLSDSHEDFSTVRE-IPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNT-NKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLL---GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKT-----SMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPS------------------------KIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK---SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV 3510
            +Y+V   T DV+GAGT   ++I++ G+    P+++L          +      G+  +F +R +++G +  + IEHD      SW L  V + +++   + + F CN+WLS  + D +  R+L A F  +      KYE+ V TGD+  +GTD+ VFI++ G  G + + +L  E    F++G   +F++ A  +G + KI +  +  G  + W+L ++ I D+ N   +Y F    WL+ D  D    R+I  G  E   I     Y ++ +T +  GAG+ + IY+ ++G  G  +   I     F EG +F+       H      L  L ++ VG+ N G    WF  KV+I      + Q+    FPC  WL + K +GL E+ L   V    +R +K+ + + + T +   A T S  ++ + G + + D+IL  +   NK W     FK G  +   +EL + L    +I    +       W L+ + +       + +F C  WL  +    + +  +V +++              + V++ T +++ A T++ V L L+GD G T + ++          + G+  EF  E   +    ++R +HD  G+ S W L+++L+ +      D  +F C RWL    +D   VRE +P+     +K     +Y + + TG+   A TD+ V+I +YG+K DT  + L  S  N  + FE+G++DEF +E + +G I+++ +GHDS    + WF+  V I          TF  N W D ++ DG    EL  + ++     V YEVE+ TG V GAGT + V+++I+G+ G T  + L +        +K+ F+   TD F I A D+G +  IRI HD+TG  + WF+D+I +      + Y F   +WL    D   L  +L P                          +++ DK+  + +T+ TG   +AGTD+ VFI ++G    T    LKS    SD FER + ++F +   D+G + K+R+GHD      GWF+D V
Sbjct:   44 VYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQL-------TSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPMDMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDN-FEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKR-KYDFPLNRWLALDEDDGKIQRDILVGGAETTAIT----YIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKI-----FLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQT----FPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEIL--LNPNNK-W-----FKPGIIEKFRIELPD-LGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDAN----EDDNEIVREMTAEGPTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKDDGQLVRELLPSDSSATLKNF---RYHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQI-RVPRQGKQYTFPANRWLDKNQADGRLEVELYPSEVVEIQKLVHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTFQ---TDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMTLLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWV 1054          

HSP 9 Score: 322.013 bits (824), Expect = 6.543e-87
Identity = 279/1085 (25.71%), Postives = 491/1085 (45.25%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAF----------------------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCGR---TGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAK-EIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI------KNKDGFKEGSIFEHTLPLRQLG-TLKKIKVGNKNNGPQPRWFLNKV----IINDLDQSRVFEFPCGQWL--SDVKGEGLEKILPVKKLPERYQK-------YK----------YEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLS------------------------PSRPGCQTEVSLVEDLSKRKLKTVI----DFTEN----TWMVSIYTSDIKNASTNSKVILVLYG-DNGKTDDIVI--PADSK-LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTT----LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKI-EAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTL-EYDLDPSKI-DKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLK--SKSDTFERGNEDVFKINAADVGVIQKIRIGH 3468
            + Y+V + T DV GAGTS  +Y+ I G+K     + L    K  ++ +        T  F I   DLG L  I I HD    +  W L  ++I ++ N+  + F C  WL++ ++DG++SREL                               K   T + + + TG   ++GTD+ VFI+L G    TG++  ++  K N+  F+R     F +    +G + K+R+  D +G    W++D V + D  +      F C  WL+K+  D + +R++  A+ +         Y+I+ YT +   AG+ A+I+I I+G +              + K  F+  S     + L  +G  ++KI++G+ N G  P W  + V    ++ D D +    FPC +WL  S+   + + +++P     E+Y K       YK          Y ++I TGN   A T ++ Y+ + G   +  ++ L K E+         KF+ G  D   +E  + L  + +I    +      DW+++ + I+      E  F+CG WLS                         S P    E++L   ++   + TV     D+ +      + VS+ T   K+A+T+S+  + L G D+ ++  I +  P   +    GSV EF      VGI  K+   HD +   S W +E++ +     G +Y   CN WL+    D  T R        +V       Y++ ++TG+ +  GTD+N+F+ +YG  G T +  L        +FE+ Q D F++E + +   +K+++  D   +   WF++++++ +  N  +   F    W    +G    V E+        ++   +Y V VKT  + GAGTD+NVFI IFG+ GD+G + LK S  N NKFE   TD F   +   +G +  +R+ HD+ G    W +  + V        + F  + WL     D +T+ ++    +KI D++++T  Y+I + TG+     T   V++ + G+  ++ +  ++  S+   F +G  D F+ ++  +G I  + +GH
Sbjct:  814 VHYEVEIWTGDVGGAGTSARVYMQIYGEKGKTEVLFLSSRSKVFERASKDTF---QTDTFTIYAIDLGALTKIRIRHDNTGNRAGWFLDRIDITDMNNEITYYFPCQRWLAVEEDDGQLSRELLPVDESYVLPQSEEGRGGGDNNPLDNLALEQKDKSTTFSVTIKTGVKKNAGTDANVFITLFGTQDDTGMT-LLKSSKTNSDKFERDSIEIFTVETLDLGDLWKVRLGHDNTGKAPGWFVDWVEV-DAPSLGKCMTFPCGRWLAKNEDDGSIIRDLFHAELQTRLYTPFVPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQFFERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTN------KFERGTADTFIIEAAD-LGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKA---RFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILL-KNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQS-ANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEET-TYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGH 1878          

HSP 10 Score: 293.508 bits (750), Expect = 3.853e-78
Identity = 270/986 (27.38%), Postives = 439/986 (44.52%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDL-ESILIEHDGLEPKDSWLLQGVEIMNV----ENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKY----------------------EIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFK-EN-TQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR----------------------EIRGAKEIMGIASRT---------------RYKISFYTENKPGAGSHADIYIQIFGENGESDV---IDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGL-EKILPV--KKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKG--PEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTE----NTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS---KLDSGSVVEFR-TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSK---------LAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFD-SSEGDGLTVRELTGTT--------LLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSK 3210
            + Y++ + T+DV  AGT   I+I I G  A   + +     K  +K         S   F +   D+G++ E I I H+       W    V+I  +    +      F C+ WL+  ++D K  REL  +     KY                       + + TG++  +GTD+KV+I++ G  G + +  L K EN T  F+RG    F+I A  +G I KI++R D S   + WY+++V I +  N +  + F C  WLS    D    R                      EI  + ++  +   T                Y +S  T     A + +  +I + GE+ E      +D  + K GF  GS+ E  +    +G +KKI++G+    P+  W + ++ +    Q   +   C  WL+  +G+G+  ++  +    +     K  YEM + TG+     T S  ++ L G     ++  LDK         + A+F+    D   +E+ + ++P T++   I+  G   +WFL+ I++    TG    F  G+WLS  R G +T V         ++  VID  E     ++ V++ TSDI  A T++ V ++++G+NG +  + +   +   K +  +   F   ++  +G   KLR  HDN G    W+L  + +      + + F C+ WLS S  D  TVR+       I        Y++ I TGN     T  NV++ + G K  + + FL  +++    F KG  D F  +++ LG I+ + +GH ++         LA   W V K I   E    N   F C+C      +     V E+T TT         L  V YEV V TG   GAGTD+NVF+ IFG  GDTG  +LK  M  +N FE G+TD F +E  ++GE++ +R+ HD +G  S W V+++ V     G+  IF   +WLD K
Sbjct: 1100 VPYEITLYTSDVFAAGTDANIFIIIYGCDAVCTQQKYLCTNKREQKQF---FERKSASRFIVELEDVGEIIEKIRIGHNNTGMNPGWHCSHVDIRRLLPDKDGAETLTFPCDRWLATSEDDKKTIRELVPYDIFTEKYMKDGSLRQVYKEVEEPLDIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNKFERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNED-EFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLAVPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAMVVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDK---------KKARFEREQNDTFIMEILD-IAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLS-QRKGKKTLVC--------EMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETGNG--GETRENVWLILEGRKNRSKE-FLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELA---WHV-KTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKM--RNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKK 2053          

HSP 11 Score: 266.544 bits (680), Expect = 7.180e-70
Identity = 217/847 (25.62%), Postives = 398/847 (46.99%), Query Frame = 1
Query: 5089 LQKKAYTIRVY-----TGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIID-KFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDV-GKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLS--KNVGQKKKLAIDLAPIND--IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPT-KTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKT--YVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNL---FEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI---LTPSE 7563
            L+ + Y  RVY     TG     GT+ANVF+ ++GENG S + QL  SK+ +  FEK N+D F     ++G ++K+ I HDN+G     W+L  + + D K  +  Y F+C  WLSK + D++  R L                       S N +D  +                        Y + + TG     G+    ++ ++G     T   RL+  E + F  G+++   ++APD+  + ++ + +      + W+L+ I IE     + Y+     WL+    + K  R   +     T     ITY+++V TGDV   GT S ++L ++G +GN +   +      F+RG  D F +E+  +   + ++ + +   G    WF EK+ I    T     F  + +L   K  G  ++   ++  +    +KK  + + V T+++K AGT+S + ++ YG+ G + ++ L     NNK FK   +++F   ++  LG   + +VWH+     S WHLE + +     +  + F CN+WL   +DD +I RE+  E    PT +       Y VTV TG+ + AG   +V+   +G+   + + ++ N  +   LF + + D+  +  V +  ++ +++     +++       W+ + V V+     ++    F    W++  +     DG++  +  ++   + A ++  +      Y I + TG  +G  TD+ V+I L+G+ S++ K+ L+    NL   FE+G+ D+F LE +++G I ++ I HD +   + WFL  VQ++     K + +P N WL K++   ++   L PSE
Sbjct:   35 LEHEYYKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLT-SKSKS-AFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGL-NASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLL---------------------ASFNPMDMPRGNK---------------------YEVKVYTGDVIGAGTDADVFINIFGEYG-DTGERRLEN-EKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETT----AITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLEGGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLYEMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLN---PNNKWFKPGIIEKFRI-ELPDLGRFYKIRVWHDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREMTAEG---PTVRRIMGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRI-----RHDGKGSGSGWYLDRVLVREEGQPESDNVEFPCLRWLDKDKD----DGQL--VRELLPSDSSATLKNFR------YHISLKTGDVSGASTDSRVYIKLYGDKSDTIKQVLLVSDNNLKDYFERGRVDEFTLETLNIGNINRLVIGHDSTGMHASWFLGSVQIRVPRQGKQYTFPANRWLDKNQADGRLEVELYPSE 806          

HSP 12 Score: 252.677 bits (644), Expect = 1.075e-65
Identity = 220/836 (26.32%), Postives = 362/836 (43.30%), Query Frame = 1
Query:  550 DEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF---------------------AFKSVRTKYEIVVITGDL---------------------DDSGTDSKVFISLCGRTG-ISPQIQL-FKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR--EIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG--LEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK---LDSGSVVEFR------TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED-----FSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT--FRCNCWFDSSEGDGLTVREL 2862
            D +LY V + T ++ GAGT   +YI+I GD  +     L K +    K        G+   F I  +DLG +  I + HD  +    W ++ VEI N  N+  +LF C  WLSL KEDG++ R  +                     A  S     +I  +TG +                      D+ TDS+ FI L G     S +I L +    + F RG   +F +    VG I KI +  D +  +S W ++ +C+  +     +Y   C  WL+KD GD  T R  ++  A  ++ I  +  Y+++ +T +  G G+ ++I++ ++G NG ++ + + K K  F+        + +  +    K+++     G +P WFL ++++ +++   +  F  G WLS  KG+   + ++  V    E  +   Y + + T +   A T +  ++I+ G       L   +S N  W    KF+   TD         L  L ++    +  G    W L  + +          F C  WLS S    QT    V D +    K   +  E T+ + I T +     T   V L+L G   ++ + ++   S+      G+   F        ++A + + +  R          +W+++ I +T+   G+ Y F C+  +    +      F   +   +    +    P+ KY+V + TG +  AGTDANVF+ I+G  GDTG R L     N   FE+G  D F +E ++LG + K++L HDS    SGW V+KV   E  N S  V   F C  W D   GDGLT R+L
Sbjct: 1252 DIVLYSVQIFTGNIPGAGTDAKVYITIYGDLGDTGERYLGKSENRTNK-----FERGTADTFIIEAADLGVIYKIKLRHDNSKWCADWYVEKVEIWNDTNEDEFLFLCGRWLSLKKEDGRLERLFYEKEYTGDRSSNCSSPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSVEEFYVAGLDVGIIKKIELGHDGASPESCWLVEELCLA-VPTQGTKYMLNCNCWLAKDRGDGITSRVFDLLDAM-VVNIGVKVLYEMTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFLERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGENGDSGTLALKQSAN--W---NKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWLSKSEGDGQT----VRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPV-KYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL--FERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKV---EVTNTSTGVATIFNCGRWLDKKRGDGLTWRDL 2063          

HSP 13 Score: 233.032 bits (593), Expect = 1.053e-59
Identity = 190/680 (27.94%), Postives = 306/680 (45.00%), Query Frame = 1
Query: 5566 FAFETDENDTAQTEYIA--YTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISI-EMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFG--DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL--VQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQV----QNLSTNKIWKYPCNEWLSKSKG---LWKILTPSE 7563
            +A E DE +     Y A  Y +   TG  +  G+    ++ L+G   L   + +L     + F  G+ +V  V   +V  I +V I ++     +SWYL+ + + +M      Y   C  WLSK  G+R+  R        M ++ +   Y + V TGDV   GT++ +F+ +FG  G++    L+  +DNFE+G  D F L+  D+G++ KI + ++  G    WFL ++ I +      Y F  N +L+ +    K     L    +     Y V V T +V+ AGT S + +  YG  G  +SG + L+        F   + D F     + L  LSR  V H N G +  W  E + +    T     FPC+ WL     D  I R+L      +  K    +  + + V T D K AG    ++   YG+K  +D+ ++  N    K F     +K ++    LG    I++      ++  S    W    + + N      Y F    W++ +E   E   E+       E P   R+      G+ +Y + V TG+  G GTDANV++ LFG+  ++G+R L   +   +LFE+G  D+F +E V +  + +++I HD     S W+LDRV V    Q  S N   ++PC  WL K K    L + L PS+
Sbjct:   26 YASEDDEGELEHEYYKARVYEVVTATGDVRGAGTDANVFITLFGENGLSPKL-QLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEGDRQWCRDLLASFNPM-DMPRGNKYEVKVYTGDVIGAGTDADVFINIFGEYGDTGERRLENEKDNFEKGAEDRFILDAPDLGQLMKINVGHNNKGGSAGWFLSQIVIEDIGNKRKYDFPLNRWLALDEDDGKIQRDILVGGAETTAITYIVTVFTGDVRGAGTKSKIYLVMYGARGNKNSGKIFLE-----GGVFDRGRTDIFHIELAVLLSPLSRVSVGHGNVGVNRGWFCEKVVILCPFTGIQQTFPCSNWLDEKKADGLIERQLY--EMVSLRKKRLKKFPWSLWVWTTDLKKAGTNSPIFIQIYGQKGRTDEILLNPN---NKWFKPGIIEKFRIELPDLGRFYKIRVW-----HDKRSSGSGWHLERMTLMNTLNKDKYNFNCNRWLDANEDDNEIVREM-----TAEGPTVRRI-----MGMARYHVTVCTGELEGAGTDANVYLCLFGDVGDTGERLLYNCRNNTDLFEKGNADEFTIESVTMRNVRRVRIRHDGKGSGSGWYLDRVLVREEGQPESDNV--EFPCLRWLDKDKDDGQLVRELLPSD 676          

HSP 14 Score: 93.9745 bits (232), Expect = 2.255e-17
Identity = 51/131 (38.93%), Postives = 77/131 (58.78%), Query Frame = 1
Query: 7147 DISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKI-WKYPCNEWLSKSKG 7536
            ++ N   + ++  +E    K  V YE++  TG   G GTDANVFITLFGEN  S K  L  K ++ FE+G  D F +   ++G I K++IEHD++   + W+LD V V ++    + + + CN WLSK +G
Sbjct:   22 ELLNYASEDDEGELEHEYYKARV-YEVVTATGDVRGAGTDANVFITLFGENGLSPKLQLTSKSKSAFEKGNVDVFRVRTNNVGLIYKVRIEHDNTGLNASWYLDHVIVTDMKRPHLRYYFNCNNWLSKVEG 151          

HSP 15 Score: 93.2041 bits (230), Expect = 3.765e-17
Identity = 71/293 (24.23%), Postives = 132/293 (45.05%), Query Frame = 1
Query:  466 DCYNSSLDAEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEH----DGLEPKD--SWLLQGVEIMNVENKRIWLFTCNHWLSL-----YKEDGKVSRELFAFKS-----VRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI 1296
            DC+ S  + +   +R  +          +E  Y++ + T +  G  T   +++ + G K       ++   +            G+T  F      LGD+ S+ + H    D   PK   +W ++ + I  +E   ++ F C+  + L     Y +  +V++   +F S     V  KYE++V TG    +GTD+ VF+++ G  G + + +L ++    F+RG T +F +    +G + K+R+  D SG  S W +++V +T+         F C  WL K  GD  T R++
Sbjct: 1780 DCWLSKSEGDGQTVRDFACANNKICDELEETTYEIVIETGN--GGETRENVWLILEGRKNRSKEFLMENSSRQRA------FRKGTTDTFEFDSIYLGDIASLCVGHLAREDRFIPKRELAWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTTESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGV-ATIFNCGRWLDKKRGDGLTWRDL 2063          

HSP 16 Score: 58.9214 bits (141), Expect = 9.341e-7
Identity = 37/124 (29.84%), Postives = 59/124 (47.58%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            + Y+V VTT    GAGT   ++++I G   +  +  LK+  ++           GST  F +   +LG+L  + +EHD       WL++ VE+ N       +F C  WL   + DG   R+LF
Sbjct: 1948 VKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNL-------FERGSTDRFFLETLELGELRKVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLF 2064          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|P98161|PKD1_HUMAN (Polycystin-1 OS=Homo sapiens OX=9606 GN=PKD1 PE=1 SV=3)

HSP 1 Score: 73.559 bits (179), Expect = 3.694e-11
Identity = 45/109 (41.28%), Postives = 60/109 (55.05%), Query Frame = 1
Query: 7201 KKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKF-ILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLS 7524
            ++G  KYEILV TG G G GT A+V I L+G +S SG R L   G   F +   D F I     LG + KI++ HD+      WFL  V V++L T +   +  N+WLS
Sbjct: 3114 QRGRFKYEILVKTGWGRGSGTTAHVGIMLYGVDSRSGHRHL--DGDRAFHRNSLDIFRIATPHSLGSVWKIRVWHDNKGLSPAWFLQHVIVRDLQTARSAFFLVNDWLS 3220          

HSP 2 Score: 68.5514 bits (166), Expect = 1.188e-9
Identity = 36/106 (33.96%), Postives = 59/106 (55.66%), Query Frame = 1
Query: 6379 YKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSM 6696
            Y+++VKT   + +GT++ V +  YG    SG   L      ++ F  N LD F      SLG + + +VWH+N G S  W L+++ +++++T RS  F  N WLS+
Sbjct: 3120 YEILVKTGWGRGSGTTAHVGIMLYGVDSRSGHRHL----DGDRAFHRNSLDIFRIATPHSLGSVWKIRVWHDNKGLSPAWFLQHVIVRDLQTARSAFFLVNDWLSV 3221          

HSP 3 Score: 65.4698 bits (158), Expect = 8.669e-9
Identity = 45/128 (35.16%), Postives = 66/128 (51.56%), Query Frame = 1
Query: 3811 LKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAI-DLGTLEKIKIRHDNSNGGAAWYLDYVLVND--ESDEYLFPCFSWLA--TNKDGGHLSKDIFPANPA 4179
             KY + VKTG   GSGT A+V + ++G +  SG R L     +    F   SLD F I     LG++ KI++ HDN     AW+L +V+V D   +    F    WL+  T  +GG + K++  A+ A
Sbjct: 3118 FKYEILVKTGWGRGSGTTAHVGIMLYGVDSRSGHRHL-----DGDRAFHRNSLDIFRIATPHSLGSVWKIRVWHDNKGLSPAWFLQHVIVRDLQTARSAFFLVNDWLSVETEANGGLVEKEVLAASDA 3240          

HSP 4 Score: 64.6994 bits (156), Expect = 1.422e-8
Identity = 42/129 (32.56%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 4630 KRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEE--DGAIERELL 5010
            +R + KYEI   T   +G+GT A+V I +YG +  +   +L+   D++       D+F ++       + KIR+ HDNKGL  AW L+ V+V+ L   ++      F  N WL+ + E   G +E+E+L
Sbjct: 3114 QRGRFKYEILVKTGWGRGSGTTAHVGIMLYGVDSRSGHRHLD--GDRA-FHRNSLDIFRIATPHSLGSVWKIRVWHDNKGLSPAWFLQHVIVRDLQTARSAF----FLVNDWLSVETEANGGLVEKEVL 3235          

HSP 5 Score: 61.2326 bits (147), Expect = 1.945e-7
Identity = 34/112 (30.36%), Postives = 56/112 (50.00%), Query Frame = 1
Query: 2881 GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEA-EDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT 3213
            G+  YE+ VKTG  +G+GT ++V I ++G    +G+  L         F   + D+F+I     +G +  IR+ HD+ G   AWF+  + V   +      F +N WL  +T
Sbjct: 3116 GRFKYEILVKTGWGRGSGTTAHVGIMLYGVDSRSGHRHLD----GDRAFHRNSLDIFRIATPHSLGSVWKIRVWHDNKGLSPAWFLQHVIVRDLQTARSAFFLVNDWLSVET 3223          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q7Z443|PK1L3_HUMAN (Polycystic kidney disease protein 1-like 3 OS=Homo sapiens OX=9606 GN=PKD1L3 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.278e-11
Identity = 43/137 (31.39%), Postives = 71/137 (51.82%), Query Frame = 1
Query: 6322 QKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELI 6732
            QK K+ + LA  +   +  Y + V T   +SA T++ V +  YG  G S    L  P++    F+   LD F+     SLG+L   ++WH+NSG S  W++  + + ++  +R W F CN WL++   D ++ R  I
Sbjct:  727 QKVKVTV-LADNDPSAQFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLCDPQKTV--FERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHFLCNCWLAVDLGDCELDRVFI 860          

HSP 2 Score: 68.1662 bits (165), Expect = 1.463e-9
Identity = 45/167 (26.95%), Postives = 74/167 (44.31%), Query Frame = 1
Query: 7039 NEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILEC-VDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            N V V  LA+L  +      W     K  +AD +   ++ + ++   A+           Y I V TG      T A V ITL+G    S    L    + +FE+G  D F+L     LG +  +++ HD+S     W++ +V V +++  + W + CN WL+   G
Sbjct:  697 NPVGVSLLASLLGFYVITVVWAR---KKDQADMQKVKVTVLADNDPSAQFH---------YLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLCDPQKTVFERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHFLCNCWLAVDLG 851          

HSP 3 Score: 67.0106 bits (162), Expect = 3.120e-9
Identity = 37/117 (31.62%), Postives = 55/117 (47.01%), Query Frame = 1
Query: 2494 PAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEA-VKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGD 2841
            P+    Y +Q+YTG +  A T A V I +YG +G +    L         FE+G +D FL+     LG +  ++L HD+      W+V +VI+  +        F CNCW     GD
Sbjct:  739 PSAQFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLCDPQKTV--FERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVC-DMAVKRKWHFLCNCWLAVDLGD 852          

HSP 4 Score: 65.0846 bits (157), Expect = 1.250e-8
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = 1
Query: 4639 KIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP 5013
            +  Y I   T  R+ A T A V I +YG    +E  +L +   K+  + G  DVF ++       +  +R+ HDN G+  +W++ +V+V   +A K K   + F CN WLA D  D  ++R  +P
Sbjct:  742 QFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLCDP-QKTVFERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCD-MAVKRK---WHFLCNCWLAVDLGDCELDRVFIP 861          

HSP 5 Score: 64.3142 bits (155), Expect = 1.840e-8
Identity = 38/125 (30.40%), Postives = 58/125 (46.40%), Query Frame = 1
Query: 3808 ELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKA-IDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDES--DEYLFPCFSWLATNKDGGHLSKDIFPAN 4173
            +  Y++ V TG    + T A V +T++G  G S    L    D     FE   LD FL+     LG L  +++ HDNS    +WY+  V+V D +   ++ F C  WLA +     L +   P +
Sbjct:  742 QFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHL---CDPQKTVFERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHFLCNCWLAVDLGDCELDRVFIPVS 863          

HSP 6 Score: 63.1586 bits (152), Expect = 4.524e-8
Identity = 34/123 (27.64%), Postives = 66/123 (53.66%), Query Frame = 1
Query: 2080 DLSKRKLKTVID---FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTD--DIVIPADSKLDSGSV-VEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLS 2430
            D+ K K+  + D     +  +++ +YT   ++A+T +KV++ LYG  G+++   +  P  +  + G + V   T    +G  + LR  HDNSG + SW + ++++       ++ FLCN WL+
Sbjct:  725 DMQKVKVTVLADNDPSAQFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLCDPQKTVFERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHFLCNCWLA 847          

HSP 7 Score: 60.077 bits (144), Expect = 3.462e-7
Identity = 37/114 (32.46%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  937 SVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPA-TCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGD 1275
            S +  Y I V TG    + T +KV I+L G  G S    L       F+RG    F++   T +G +  +R+  D SG   SWY+ +V + D+     ++ F C  WL+ D GD
Sbjct:  740 SAQFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLCDPQKTVFERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKR-KWHFLCNCWLAVDLGD 852          

HSP 8 Score: 58.9214 bits (141), Expect = 8.095e-7
Identity = 35/125 (28.00%), Postives = 60/125 (48.00%), Query Frame = 1
Query: 2881 GKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEA-EDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKTLEYDLDPSKIDKI 3252
             +  Y ++V TG  + A T + V I ++G  G +    L      K  FE G  D+F +     +G + S+R+ HD++G   +W+V Q+ V    +  K+ F  N W     L  DL   ++D++
Sbjct:  741 AQFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLCDP--QKTVFERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHFLCNCW-----LAVDLGDCELDRV 858          

HSP 9 Score: 58.5362 bits (140), Expect = 1.105e-6
Identity = 37/120 (30.83%), Postives = 57/120 (47.50%), Query Frame = 1
Query: 4252 NFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKC-CDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYP 4608
            ++ ++VYT  +  A T A V I LYG    S   P          FE G  D F +     LG L  +R+ HDNSG +  W++++V +    + + + F CN W++    D  L+R   P
Sbjct:  744 HYLIQVYTGYRRSAATTAKVVITLYGSEGRSE--PHHLCDPQKTVFERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHFLCNCWLAVDLGDCELDRVFIP 861          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q7Z442|PK1L2_HUMAN (Polycystic kidney disease protein 1-like 2 OS=Homo sapiens OX=9606 GN=PKD1L2 PE=1 SV=5)

HSP 1 Score: 72.7886 bits (177), Expect = 5.429e-11
Identity = 36/107 (33.64%), Postives = 58/107 (54.21%), Query Frame = 1
Query: 7219 YEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECV-DLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            Y + V TG   G  T + V +TL+G + E     L      +FE+G  D F+L  +  LG++  +++ HD+S  R  W++ RV V +L  ++ W + CN WLS + G
Sbjct: 1392 YLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADPDTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVG 1498          

HSP 2 Score: 71.633 bits (174), Expect = 1.099e-10
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 1
Query: 6310 KNVGQKKKLAIDLAPIND-IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDD 6708
            K+   + K+ + +   ND   +  Y V V T + + A TSS VTV  YG  G+     L  P  +   F+   +D F+   +  LG+L   ++WH+NSG    W++  + + ++   R W F CN WLS+   D
Sbjct: 1368 KDAQDQAKVKVTVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADP--DTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVGD 1499          

HSP 3 Score: 69.707 bits (169), Expect = 5.240e-10
Identity = 40/141 (28.37%), Postives = 79/141 (56.03%), Query Frame = 1
Query: 1327 SRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG--FKEGSIFEHTLP-LRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQ-KYKYEMKISTG 1734
            ++  Y ++ YT ++ GA + + + + ++G +GE +   + + D   F+ G++    L  L  LG L+ +++ + N+G +P W++++V++ DL   R + F C  WLS   G+  L+K+ PV    +R Q  + + MK S G
Sbjct: 1388 AQYHYLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADPDTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVGDCVLDKVFPVATEQDRKQFSHLFFMKTSAG 1528          

HSP 4 Score: 69.3218 bits (168), Expect = 5.699e-10
Identity = 42/125 (33.60%), Postives = 65/125 (52.00%), Query Frame = 1
Query: 3802 LKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAI-DLGTLEKIKIRHDNSNGGAAWYLDYVLVND--ESDEYLFPCFSWLATNKDGGHLSKDIFP 4167
              +  Y+V V TG+  G+ T + V +T++G +G   ER   +  D     FE  ++D FL+  +  LG L  +++ HDNS    +WY+  VLV D     ++ F C SWL+ N     L K +FP
Sbjct: 1387 FAQYHYLVTVYTGHRRGAATSSKVTVTLYGLDG---EREPHHLADPDTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVGDCVLDK-VFP 1507          

HSP 5 Score: 66.2402 bits (160), Expect = 5.144e-9
Identity = 41/125 (32.80%), Postives = 68/125 (54.40%), Query Frame = 1
Query: 2074 VEDLSKRKLKTVID---FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTD--DIVIPADSKLDSGSVVEFR-TELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLS 2430
             +D +K K+  + D   F +  ++V++YT   + A+T+SKV + LYG +G+ +   +  P     + G+V  F  + L  +G    LR  HDNSG   SW + ++L+   V   ++ FLCN WLS
Sbjct: 1370 AQDQAKVKVTVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADPDTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLS 1494          

HSP 6 Score: 63.929 bits (154), Expect = 2.667e-8
Identity = 34/107 (31.78%), Postives = 60/107 (56.07%), Query Frame = 1
Query: 6007 YLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPL-DKNEDNFERGHRDHFKLE-MEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVG 6321
            YL++V TG      T+S + + L+G  G    + L D +   FERG  D F L  +  +G+++ +R+ +D +GDRP W++ ++ + +   +  + F  N +LS NVG
Sbjct: 1392 YLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADPDTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVG 1498          

HSP 7 Score: 63.5438 bits (153), Expect = 3.763e-8
Identity = 45/166 (27.11%), Postives = 74/166 (44.58%), Query Frame = 1
Query:  952 YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATC-VGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK 1446
            Y + V TG    + T SKV ++L G  G      L   +T  F+RG    F++     +G +  +R+  D SG + SWY+ RV + DL   + +++F C +WLS + GD    +    A E      R ++   F+ +   G      I+  IF     S    ++
Sbjct: 1392 YLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADPDTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVM-DRKWYFLCNSWLSINVGDCVLDKVFPVATE----QDRKQFSHLFFMKTSAGF-QDGHIWYSIFSRCARSSFTRVQ 1551          

HSP 8 Score: 60.077 bits (144), Expect = 3.851e-7
Identity = 33/121 (27.27%), Postives = 62/121 (51.24%), Query Frame = 1
Query: 4639 KIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIER 5001
            +  Y +T  T +R+GA T++ V + +YG +   E  +L +  D    + G  D F +S       +  +R+ HDN G   +W++ +VLV  L+ ++     + F CN WL+ +  D  +++
Sbjct: 1389 QYHYLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADP-DTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRK----WYFLCNSWLSINVGDCVLDK 1504          

HSP 9 Score: 59.3066 bits (142), Expect = 6.319e-7
Identity = 33/111 (29.73%), Postives = 57/111 (51.35%), Query Frame = 1
Query: 2512 YKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAV-KLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGD 2841
            Y V +YTG++  A T + V + +YG  G+     L  +  +T  FE+G +D FL+  +  LG +  ++L HD+      W+V +V++++         F CN W   + GD
Sbjct: 1392 YLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHL--ADPDTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVM-DRKWYFLCNSWLSINVGD 1499          

HSP 10 Score: 59.3066 bits (142), Expect = 7.538e-7
Identity = 34/105 (32.38%), Postives = 54/105 (51.43%), Query Frame = 1
Query: 2893 YEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAE-DIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLD 3204
            Y V V TG  +GA T S V + ++G  G+     L     +   FE GA D F +     +GE++S+R+ HD++G   +W+V ++ V    +  K+ F  N WL 
Sbjct: 1392 YLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADP--DTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLS 1494          

HSP 11 Score: 58.5362 bits (140), Expect = 1.196e-6
Identity = 35/116 (30.17%), Postives = 59/116 (50.86%), Query Frame = 1
Query: 4252 NFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCC-DLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLER 4596
            ++ V VYT  +  A T + V + LYG   +    P   +   +  FE G  D F +     LGEL+ +R+ HDNSG    W++++V +    + + + F CN W+S +  D  L++
Sbjct: 1391 HYLVTVYTGHRRGAATSSKVTVTLYGLDGERE--PHHLADPDTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVGDCVLDK 1504          

HSP 12 Score: 57.3806 bits (137), Expect = 2.590e-6
Identity = 35/124 (28.23%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 5104 YTIRVYTGGETG--TNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAV-DLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQ 5466
            Y + VYTG   G  T++ V + +YG +G+     L D  T    FE+  +D F    +  LG++  + + HDNSG  +  W++ ++ + D   +  + F C  WLS +  D  + +   +A  Q
Sbjct: 1392 YLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADPDTPV--FERGAVDAFLLSTLFPLGELRSLRLWHDNSGD-RPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVGDCVLDKVFPVATEQ 1512          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. TrEMBL
Match: A0A1S3K257 (lipoxygenase homology domain-containing protein 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106178182 PE=4 SV=1)

HSP 1 Score: 1951.41 bits (5054), Expect = 0.000e+0
Identity = 1048/2467 (42.48%), Postives = 1536/2467 (62.26%), Query Frame = 1
Query:  301 TPYATRSTAGYVGGGAFTPT----KSTTALNYCSLRDPNLEDYFIRKFSRVLSPHLPLRDCYNSSLDAEKLGLRSNSFRKTNYL-------------SNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXL--TPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG-FKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLP-ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS-KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELT--GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVND--ESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLEN------FNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSK--LQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDE--NDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGP-KNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKK--ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPI----NDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGE-KNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK----KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
             PYA R+   + G  A +P     K+    NY S+ DP+L +YF RKF    +P  P              G+R  S R   Y              +   ++LYKVAVTT D K AGTS  +Y+ ++G K  +P+ RL K   S KK   V      G+T IF I+ +D+GDL+S+ IEHDGL  +DSW LQ +E++N  NK+ WLF C+ WLSL++ D ++SREL+  +  +T+YEIV +TGD   +GTD+ V+I++ G++G++P++QL   +  CF+R Q+  F +  +CVGP+ KIRI  D  G    W+LDRV +TD K+P+W+YFF C  WL+KD GD    R++ G+K+ M I    +Y+I+ +T ++ GAG+ A++Y+ +FGE+G++    + N +  F+ G   E  +    LG LK+++VG+ N G    W+L+K+I++DLDQS+V+EFPC +WL+  + +G + + L V   P +      Y++ ++TG+  HA T++R YV + G +  +      E++ KIW+EN KF+ G TD+  VE+   LSPL++++ G +  G    WFL+ +++ CP +G EQ F+CG W +        E +L E  S RK K   D    TW   IYTSDI+ A T++ V +VLYGD GK+D++ +  ++   + G V +F+ EL  VG PYK+R +HD  G+ + W+L K+ +       +Y F C++WL++   D   +RE+PA G  I KP P+  Y V+++TG K  AGTD+NVFIN++GE GDTG+R L  S  N NKFE+G +DEF+++AV L  +SKI++GHD   AG GWF+DKV++ +E +      F CN W  S E DG  VRE+T  G+ +L   TY +  KTG V+GAGTD+NVFI I+G    TG +QLKTS   KNKFE   TD+FK+E   +G+I+ IRI HD  G G+ WF+D + + VP  G  Y F  ++WL    +   +E +L+P++  K D  IPY++T++TGDV  AGTD+ VF+Q+YG+  KT++  L +K++ FE+G  + FKI AAD+G + KIRIGHDG    +GWFLDKVLI+R  +     +K   +  ++              D    +     +    + E E+     YWF+CNRW A  EDD  IVREL+ TDE+G PL +++E++Y V V TG+  G+GTDANVF+ I G+ GD+GERALK++   ++NKFE    D+F++KAIDLG L+K+KIRHDN  GGAAW+LD V V D      Y FPC  WLAT++D G +++D+ P +  +    +     K  F + QE  LE       ++V V T     AGTDANV+++LYGE +D+G + LK S T+ +KFE G  DEF ++  D+GELKKI+IGHDN+G    W L +VEI+A  LG+ + F C   ++  + DG +ERELYPQ   T      + YEITT TS+ +G  T+A+VY+ +YG++ CT++ +L ++  + K     G  D F + +EDV D IEKIRIGHDN G GS WHL KV V+RL      S+ Y FPCNRWLARDE+DGAI REL+ +K+I             ++D+    L+ K Y + VYTG     GT+ANVF+ ++G+ GDSGER+L+ S+T+ DKFE+  +D+F  E VDLGKVFK+ IRHDN+     DW+L K+E+ID+ +NETY FHCERWL+K KDD K++R+LY+ GY G+ S+  +  SR    GS +S+ S    S     +        +  +   I YTI + TG   D G+S   ++++ G  K L T  + L+ ++   F PGS E  SVEA DVE +K++EI ++GV   + W+L  + ++MPTKGK Y   C  WL++  G+ KTSR+FS+QD   + VS K  I   ++V TGD+   GT+S + + +FG+ G +    L+KN + FERG  D  KLE++++G IKK+RI +DG G R  WFLEK+++ N  T +   F+ N++LSKN G   K++ DLA        IKKT+YK+ VKTS+VK AGT + V +  +GE GDSG+L LKT E    PF+ NQ+D F F D+LSLG+L +C+VWH+N GF + WHL+YIE++++ +++ + FPC +WLS  +DD+QI REL C ++P+   + + + +YE+TV T DKK+ G   + W +  GE K  S +F+MEN+  K K+  R   D+ K+T   LG+LK   LGAV  +++   D++     W C+EV V + A+   YVF  +SW+++  +I     +I ++  + E     +V  ++    VKY+I+V TG   G GT+ANVF+TL+G N ++GKR L QK R+LFE+ Q D+F +E +DLG++ K++IEHD+S FR  W L++V+V N +TNK   +PCN+W  K KG
Sbjct:  107 APYAPRTRESFSGSAAGSPMLDYGKTIGIPNYNSICDPHLTEYFQRKFG---APRPPS-------------GIRPRSPRGKQYSYAGRGNKSPRGAKAKKGDVLYKVAVTTGDKKNAGTSAKVYLRLKGTKGKIPKTRLTKKAGSVKKTKAVSFRFNKGTTHIFKIKGADIGDLKSLSIEHDGLTKEDSWFLQEIEVVNTANKKAWLFPCSQWLSLFESDCQLSRELYPRRHTKTEYEIVTVTGDCKGAGTDAHVYITIYGKSGVTPKLQLKNNSKDCFERSQSDIFHVKTSCVGPMEKIRIEHDNLGRAPGWFLDRVVVTDQKHPKWKYFFPCNQWLAKDEGDGLIARDLMGSKDPMAIRKANKYRITVFTADRRGAGTDANVYMTLFGESGDTGERKLDNSNNNFERGQKDEFLIESPNLGPLKRLRVGHDNKGFSAGWYLDKIIVDDLDQSKVYEFPCDRWLAKDEDDGQISRELLVGVGPHDPTPGIPYQIHVTTGDVRHAGTSARVYVEMFGGKGGN------ETSGKIWLENGKFERGRTDIFNVEVLSLLSPLSKLVIGHDNSGSGAGWFLEKVIVICPLSGYEQHFLCGKWFADDEDDGVIERTLYEHESLRKKKKKKD----TWFARIYTSDIRGAGTDANVYMVLYGDKGKSDEVKLDNETDNFEQGQVDKFKIELDEVGKPYKMRIRHDGKGSFAGWHLNKVELENMQTKKKYVFNCDQWLAEDEGDGEIIREMPAEGEDIKKPMPLVTYNVEVHTGKKFGAGTDSNVFINLFGEFGDTGERPLKKSKANMNKFERGNVDEFIVKAVTLKKLSKIRIGHDGSQAGDGWFLDKVVVKQEGSDKYDTVFECNRWLASDEDDGQIVREITAGGSQMLATTTYHIHTKTGDVRGAGTDANVFIWIYGAKNKTGKLQLKTSENYKNKFERAKTDVFKLETTYVGKIERIRIGHDGQGVGAGWFLDGVNIDVPSYGEHYEFSCHRWLAEDEEDGQIEIELEPTETRKGDSLIPYEVTIWTGDVRGAGTDANVFMQMYGETGKTEEYKLDNKTNNFEQGMIEKFKIEAADIGPLVKIRIGHDGAGAFAGWFLDKVLIQRTPAKTSKRNKKLAEKAKTKK-------KVKRKDKNKDEEEDDEQKDDVVDETED-----YWFLCNRWFAKGEDDGQIVRELMATDEQGKPLHDMEEIEYKVKVHTGDIMGAGTDANVFINISGEKGDTGERALKDS--QNINKFERNVTDEFIVKAIDLGKLKKVKIRHDNKGGGAAWFLDSVEVEDVKSKRSYYFPCQRWLATDEDDGQIARDLVPVDKKLMGLNR-----KGSFAVRQEIALETKAAMTTYHVIVVTGNVWGAGTDANVYVVLYGEKDDTGQMFLKVSKTNKDKFERGKTDEFVIEAVDIGELKKIKIGHDNAGGGGAWFLERVEIDAPSLGRKWYFQCGRCLALDEDDGQIERELYPQELATEAYEACVPYEITTYTSDMRGGSTDADVYVVLYGKDSCTQQKSLCSSKRERKQSFNKGAVDKFVLELEDVGDTIEKIRIGHDNSGFGSGWHLSKVEVRRLKDTGKGSVTYVFPCNRWLARDEDDGAIARELVAEKIIEENVKKDGTVKKKELDT-GEKLKNKKYIVNVYTGDVRGAGTDANVFITIFGDKGDSGERKLLHSETNRDKFERKQVDKFILEIVDLGKVFKMKIRHDNANLM-ADWYLDKVEVIDQDENETYTFHCERWLAKGKDDGKLERSLYVKGYDGDMSSMAT-MSRFGSIGSLDSVKSTDPFSKSPRLSRRQSAILENVPEGPTIPYTIKVTTGDGDDNGTSSNVFIKIMGAKKGLHTGQLPLELVQKEKFMPGSIETFSVEAVDVEEVKKIEIGHDGVTPGTGWFLKEVDVDMPTKGKHYYFNCKQWLARDKGDGKTSRVFSLQDGESSMVSYKPMIPCELTVYTGDMQGAGTDSKVSITVFGSTGTTPEIILEKNGERFERGKVDLIKLELDEIGAIKKLRIGHDGKGSRSDWFLEKVELRNMDTGDLTVFKCNDWLSKNKGD-GKISRDLAATVRGKQQIKKTNYKINVKTSDVKGAGTDANVYIILFGENGDSGELHLKTSETYKDPFENNQIDIFTFSDLLSLGELMKCRVWHDNKGFGAAWHLDYIEVEDLGSKKKYIFPCGRWLSTKEDDKQIIRELSC-SSPSTPGSKKKQNTYEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSA-KNKILRRGQTDEFKMTSKNLGKLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSKYVFPCKSWVKIENEIDIDSAKILELKTMEE----GKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLDQKFRDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKG 2518          

HSP 2 Score: 585.874 bits (1509), Expect = 1.331e-166
Identity = 426/1406 (30.30%), Postives = 690/1406 (49.08%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDE---KGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE-SDEY--LFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNK-------------------------------------SIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDG-SHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNI-IRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFG----TQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVG-KIKKIRIQNDGNGDRPHWFLEKLDIT----NESTNESYQFEYNEFLSK-------------------NV---GQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICEN------------------------APNP----TKTSRNETS------------YEVTVITGDKKNAGMPHDVWFVFYGEKN--YSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRP--LVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI 7548
            +Y F C++WLA DE D  I+RE+    E   K  PL     + Y V+V TG +FG+GTD+NVF+ +FG+ GD+GER LK +  N +NKFE  ++D+F++KA+ L  L KI+I HD S  G  W+LD V+V  E SD+Y  +F C  WLA+++D G + ++I      M                        +++   T     AGTDANV I +YG  N +G + LK S  + NKFE    D F+++   +G++++IRIGHD  G  A W L  V I+    G+ + F C+ W+++ + DG +E EL P  + T      I YE+T  T + +GAGT+ANV++Q+YG    TE+  L+N ++    + G  + F +   D+  P+ KIRIGHD  G  + W L+KVL++R  A  +K                                     +  Y F CNRW A+ E+DG I REL+               + D+     + +++  Y ++V+TG     GT+ANVF+ + GE GD+GER L DS+ + +KFE+N  DEF  +A+DLGK+ K+ IRHDN G     WFL  +E+ D     +Y F C+RWL+  +DD +I R L                           +D +  G +  G+FA   +     +     Y + +VTG     G+    ++ LYG K+    + +++ K   + F  G  +   +EA D+  +K+++I ++      +W+L  + I+ P+ G+ +   CG  L+    + +  R    Q+         + Y I+  T D+  G T++ +++ L+G    TQ  S      + + +F +G  D F LE+EDVG  I+KIRI +D +G    W L K+++         + +Y F  N +L++                   NV   G  KK  +D      +K   Y V V T +V+ AGT + V +  +G+ GDSG+ +L   E N   F+  Q+D+FI  +++ LG + + ++ H+N+   + W+L+ +E+ +     ++ F C +WL+   DD ++ R L  +                         + +P     + SR +++            Y + V TGD  + G   +V+    G K   ++ +  +E  V KEK    S E    V  V + E+K I++G     ++  +    WF  EV V      K Y F  + W+   +     DG+   + ++ +D   + V     K ++  E+ V TG   G GTD+ V IT+FG    +G  P  +++K    FE+G+ D   LE  ++G I+K++I HD    RSDWFL++V+++N+ T  +  + CN+WLSK+KG  KI
Sbjct:  803 KYVFNCDQWLAEDEGDGEIIREMPAEGEDIKKPMPL-----VTYNVEVHTGKKFGAGTDSNVFINLFGEFGDTGERPLKKSKAN-MNKFERGNVDEFIVKAVTLKKLSKIRIGHDGSQAGDGWFLDKVVVKQEGSDKYDTVFECNRWLASDEDDGQIVREITAGGSQMLA-------------------TTTYHIHTKTGDVRGAGTDANVFIWIYGAKNKTGKLQLKTSENYKNKFERAKTDVFKLETTYVGKIERIRIGHDGQGVGAGWFLDGVNIDVPSYGEHYEFSCHRWLAEDEEDGQIEIELEP--TETRKGDSLIPYEVTIWTGDVRGAGTDANVFMQMYGETGKTEEYKLDNKTNN--FEQGMIEKFKIEAADIG-PLVKIRIGHDGAGAFAGWFLDKVLIQRTPAKTSKRNKKLAEKAKTKKKVKRKDKNKDEEEDDEQKDDVVDETEDYWFLCNRWFAKGEDDGQIVRELM---------------ATDEQGKPLHDMEEIEYKVKVHTGDIMGAGTDANVFINISGEKGDTGERALKDSQ-NINKFERNVTDEFIVKAIDLGKLKKVKIRHDNKGGGAA-WFLDSVEVEDVKSKRSYYFPCQRWLATDEDDGQIARDLV-------------------------PVDKKLMGLNRKGSFAVRQEIALETKAAMTTYHVIVVTGNVWGAGTDANVYVVLYGEKDDTGQMFLKVSKTNKDKFERGKTDEFVIEAVDIGELKKIKIGHDNAGGGGAWFLERVEIDAPSLGRKWYFQCGRCLALDEDDGQIERELYPQELATEAYEACVPYEITTYTSDMRGGSTDADVYVVLYGKDSCTQQKSLCSSKRERKQSFNKGAVDKFVLELEDVGDTIEKIRIGHDNSGFGSGWHLSKVEVRRLKDTGKGSVTYVFPCNRWLARDEDDGAIARELVAEKIIEENVKKDGTVKKKELDTG--EKLKNKKYIVNVYTGDVRGAGTDANVFITIFGDKGDSGERKLLHSETNRDKFERKQVDKFIL-EIVDLGKVFKMKIRHDNANLMADWYLDKVEVIDQDENETYTFHCERWLAKGKDDGKLERSLYVKGYDGDMSSMATMSRFGSIGSLDSVKSTDPFSKSPRLSRRQSAILENVPEGPTIPYTIKVTTGDGDDNGTSSNVFIKIMGAKKGLHTGQLPLEL-VQKEKFMPGSIE-TFSVEAVDVEEVKKIEIG-----HDGVTPGTGWFLKEVDVDMPTKGKHYYFNCKQWLARDK----GDGKTSRVFSL-QDGESSMVS---YKPMIPCELTVYTGDMQGAGTDSKVSITVFGS---TGTTPEIILEKNGERFERGKVDLIKLELDEIGAIKKLRIGHDGKGSRSDWFLEKVELRNMDTGDLTVFKCNDWLSKNKGDGKI 2115          

HSP 3 Score: 501.13 bits (1289), Expect = 1.974e-139
Identity = 410/1516 (27.04%), Postives = 654/1516 (43.14%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMN-----------------------------------------VENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSV--------RTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLF-KENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGA-KEIMGI-----------------ASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS--DVKGEGLEKILPVKKLPERYQK-YKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDI-VIFCPQTG---IEQSFICGNWLSPSRPGCQTEVSLVED------------LSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS----KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED---------------------------FSTVREIPATGPGIVKP---------------APICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-------ELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT----LEYDLDPSKIDKID-KTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKS---DTFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGD-SGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKI---------KIRHDNSNGGAAWYLDYVLVNDESD--EYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYP 4608
            I Y+V + T DV+GAGT   +++ + G+       +L     +           G  + F I  +D+G L  I I HDG      W L  V I                                           V+    + F CN W +  ++DG++ REL A              +Y++ V TGD+  +GTD+ VFI++ G  G + +  L   +N   F+R  T +F++ A  +G + K++IR D  G  ++W+LD V + D+K+    Y+F C+ WL+ D  D    R++    K++MG+                 A+ T Y +   T N  GAG+ A++Y+ ++GE  ++  + +K    NKD F+ G   E  +    +G LKKIK+G+ N G    WFL +V I+     R + F CG+ L+  +  G+   ++ P +   E Y+    YE+   T +    ST +  YV+L G   KD    +    +        F +G  D   +EL +    + +I  G +  G    W L  + V     TG   +   F C  WL+           LV +            + K++L T        ++V++YT D++ A T++ V + ++GD G + +  +        K +   V +F  E+  +G  +K++ +HDN+   + W L+K+ +      + Y F C RWL+   +D                             ++  + +T P    P                P   Y +++ TG+    GT +NVFI I G K       L        KF  G ++ F +EAV +  + KI++GHD    G+GWF+ +V + +         F C  W    +GDG T R       E +  +    +  E+ V TG +QGAGTDS V I +FG TG T  + L+    N  +FE G  DL K+E ++IG IK +RI HD  G+ S WF++++ +     G   +F  N WL        +  DL  +   K   K   Y+I V T DV  AGTD+ V+I ++G++  + +L LK+     D FE    D+F   +   +G + K R+ HD K  G+ W                                                      L  I  ++  +  +Y F C RWL++ EDD  I+REL        P S  K+  Y + V T ++   GT  N +L + G++   S E  ++N+  N +        D+F + + +LG L++          K   D     A W+   V+V D +   +Y+FPC SW+    +      DI  A     K  ++ K+      + +      + + V T  +  AGT+ANV + LYG   D+G   L Q     + FE    DEF+++  DLGEL K+RI HDNSG    W L KVE+  +   +S +FPCN+W  K K DG L R+L P
Sbjct: 1097 IPYEVTIWTGDVRGAGTDANVFMQMYGETGKTEEYKLDNKTNN--------FEQGMIEKFKIEAADIGPLVKIRIGHDGAGAFAGWFLDKVLIQRTPAKTSKRNKKLAEKAKTKKKVKRKDKNKDEEEDDEQKDDVVDETEDYWFLCNRWFAKGEDDGQIVRELMATDEQGKPLHDMEEIEYKVKVHTGDIMGAGTDANVFINISGEKGDTGERALKDSQNINKFERNVTDEFIVKAIDLGKLKKVKIRHDNKGGGAAWFLDSVEVEDVKSKR-SYYFPCQRWLATDEDDGQIARDLVPVDKKLMGLNRKGSFAVRQEIALETKAAMTTYHVIVVTGNVWGAGTDANVYVVLYGEKDDTGQMFLKVSKTNKDKFERGKTDEFVIEAVDIGELKKIKIGHDNAGGGGAWFLERVEIDAPSLGRKWYFQCGRCLALDEDDGQIERELYPQELATEAYEACVPYEITTYTSDMRGGSTDADVYVVLYG---KDSCTQQKSLCSSKRERKQSFNKGAVDKFVLELEDVGDTIEKIRIGHDNSGFGSGWHLSKVEVRRLKDTGKGSVTYVFPCNRWLARDEDDGAIARELVAEKIIEENVKKDGTVKKKELDTGEKLKNKKYIVNVYTGDVRGAGTDANVFITIFGDKGDSGERKLLHSETNRDKFERKQVDKFILEIVDLGKVFKMKIRHDNANLMADWYLDKVEVIDQDENETYTFHCERWLAKGKDDGKLERSLYVKGYDGDMSSMATMSRFGSIGSLDSVKSTDPFSKSPRLSRRQSAILENVPEGPTIPYTIKVTTGDGDDNGTSSNVFIKIMGAKKGLHTGQLPLELVQKEKFMPGSIETFSVEAVDVEEVKKIEIGHDGVTPGTGWFLKEVDV-DMPTKGKHYYFNCKQWLARDKGDGKTSRVFSLQDGESSMVSYKPMIPCELTVYTGDMQGAGTDSKVSITVFGSTGTTPEIILEK---NGERFERGKVDLIKLELDEIGAIKKLRIGHDGKGSRSDWFLEKVELRNMDTGDLTVFKCNDWLSKNKGDGKISRDLAATVRGKQQIKKTNYKINVKTSDVKGAGTDANVYIILFGENGDSGELHLKTSETYKDPFENNQIDIFTFSDLLSLGELMKCRVWHDNKGFGAAWH-----------------------------------------------------LDYIEVEDLGSKKKYIFPCGRWLSTKEDDKQIIREL-SCSSPSTPGSKKKQNTYEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSAKNKI--LRRGQTDEFKMTSKNLGKLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSKYVFPCKSWVKIENE-----IDIDSAKILELKTMEEGKV-----SVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLDQKF--RDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLLP 2528          

HSP 4 Score: 379.793 bits (974), Expect = 6.487e-102
Identity = 316/1096 (28.83%), Postives = 503/1096 (45.89%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLG-TLEKIKIRHDNSNGGAAWYLDYVLVNDESDE------YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELY-----------------------------------PQLSLTMT-------KRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLN-NASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIEREL-LPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISV-EAPDVENIKQVEICNEGVDRE---SSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKI-TYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN---FERGHRDHFKLEMEDVGKIKKIRIQ---------NDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTD--------------YKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELI 6732
            +++F C R LA DEDD  I REL P +           + Y +   T +  G  TDA+V++ ++GK+  + +++L ++       F + ++DKF+++  D+G T+EKI+I HDNS  G+ W+L  V V    D       Y+FPC  WLA ++D G +++++           KD  + K +    ++ K + + V VYT     AGTDANV I ++G+  DSG   L  S T+ +KFE    D+F ++  DLG++ K++I HDN+   ADW+L KVE+  +   +++ F C  W++K K DG LER LY                                   P+LS   +       + P I Y I   T +    GT++NV+I++ G         L      K K   G  + F V   DV++ ++KI IGHD    G+ W L++V V      K+    Y F C +WLARD+ DG   R   L D           GES     S+ +        + VYTG     GT++ V + V+G  G + E  L   + + ++FE+  +D  + E  ++G + K+ I HD  G  + DWFL+K+E+ +    +  +F C  WLSK+K D KI R L           A + R +                                Q +   Y I + T   K  G+    ++ L+G +N  +  + L+  ET Y  P     I +    D+ ++ ++  C    D +   ++W+L+ I +E     K Y   CG WLS    +++  R  S          KK  TY I+V T D   GGT    +L L G     S   L +N        RG  D FK+  +++GK+K+  +           D  G    W   ++ +T+ ++   Y F    +    V  + ++ ID A I ++K  +              YK+IVKT +   AGT++ V +  YG  GD+G  +L   ++    F+ NQ DEF   ++L LG+L++ ++ H+NSGF   W LE +E+    T +S  FPCNKW      D ++ R+L+
Sbjct: 1510 KWYFQCGRCLALDEDDGQIERELYPQELATEAYEAC--VPYEITTYTSDMRGGSTDADVYVVLYGKDSCTQQKSLCSSKRERKQSFNKGAVDKFVLELEDVGDTIEKIRIGHDNSGFGSGWHLSKVEVRRLKDTGKGSVTYVFPCNRWLARDEDDGAIARELVAEKIIEENVKKDGTVKKKELDTGEKLKNKKYIVNVYTGDVRGAGTDANVFITIFGDKGDSGERKLLHSETNRDKFERKQVDKFILEIVDLGKVFKMKIRHDNANLMADWYLDKVEVIDQDENETYTFHCERWLAKGKDDGKLERSLYVKGYDGDMSSMATMSRFGSIGSLDSVKSTDPFSKSPRLSRRQSAILENVPEGPTIPYTIKVTTGDGDDNGTSSNVFIKIMGAKKGLHTGQLPLELVQKEKFMPGSIETFSVEAVDVEE-VKKIEIGHDGVTPGTGWFLKEVDVDMPTKGKH----YYFNCKQWLARDKGDGKTSRVFSLQD-----------GES-----SMVSYKPMIPCELTVYTGDMQGAGTDSKVSITVFGSTGTTPEIIL---EKNGERFERGKVDLIKLELDEIGAIKKLRIGHDGKGS-RSDWFLEKVELRNMDTGDLTVFKCNDWLSKNKGDGKISRDL-----------AATVRGKQ-------------------------------QIKKTNYKINVKTSDVKGAGTDANVYIILFG-ENGDSGELHLKTSET-YKDPFENNQIDIFTFSDLLSLGELMKCRVWHDNKGFGAAWHLDYIEVEDLGSKKKYIFPCGRWLSTKEDDKQIIRELSCSSPSTPGSKKKQNTYEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSAKNKILRRGQTDEFKMTSKNLGKLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSKYVFPCKSW----VKIENEIDIDSAKILELKTMEEGKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLD--QKFRDLFERNQTDEFEI-EVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLL 2527          

HSP 5 Score: 296.204 bits (757), Expect = 2.406e-76
Identity = 200/602 (33.22%), Postives = 312/602 (51.83%), Query Frame = 1
Query: 3700 YWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVN--DESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVK-CCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELY-PQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSK-LQTGCTDVFYVSMEDVDDPIEKIRIG---------HDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIA 5457
            Y+F C +WLA D+ D    R     D + + +S    +   + V TG+  G+GTD+ V +T+FG  G + E  L+   +    +FE   +D   ++  ++G ++K++I HD     + W+L+ V +   D  D  +F C  WL+ NK  G +S+D+                  +  +  Q+ K  N+ + V T+    AGTDANV+IIL+GE  DSG + LK S T+ + FE+   D F       LGEL K R+ HDN G  A WHL  +E+E     + ++FPC  W+S  + D  + REL     S   +K+ +  YEIT  TS++K  GT  N ++ + G +    K  L   S K+K L+ G TD F ++ +++   +++  +G          D +G  + WH  +V+V    +       Y FPC  W+  + E      ++L  K +  G ++        V S+AN+     Y I V TG E   GTNANVF+ +YG NGD+G+RQL   +   D FE+N  DEFE E +DLG++ K+ I HDNSGF +  W L+K+E+I++  N++ +F C +W  K K D ++ R L  A
Sbjct: 1968 YYFNCKQWLARDKGDGKTSRVFSLQDGESSMVSYKPMIPCELTVYTGDMQGAGTDSKVSITVFGSTGTTPEIILEKNGE----RFERGKVDLIKLELDEIGAIKKLRIGHDGKGSRSDWFLEKVELRNMDTGDLTVFKCNDWLSKNKGDGKISRDL-----------------AATVRGKQQIKKTNYKINVKTSDVKGAGTDANVYIILFGENGDSGELHLKTSETYKDPFENNQIDIFTFSDLLSLGELMKCRVWHDNKGFGAAWHLDYIEVEDLGSKKKYIFPCGRWLSTKEDDKQIIRELSCSSPSTPGSKKKQNTYEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSAKNKILRRGQTDEFKMTSKNLG-KLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSK----YVFPCKSWVKIENEIDIDSAKILELKTMEEGKVSV-------VRSLANV----KYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQL--DQKFRDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGF-RPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLLPA 2529          

HSP 6 Score: 259.61 bits (662), Expect = 3.030e-65
Identity = 203/692 (29.34%), Postives = 328/692 (47.40%), Query Frame = 1
Query:  517 SFRKTNYLSNHDE---ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFK---SVRTKY------EIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVRE----IRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN----KDGFKEGSIFEHTLP-LRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS---DVKGEGLEKILPVKKLP-ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGI---------NVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVE--DLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK--LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVRE-IPAT 2475
            S R++  L N  E   I Y + VTT D    GTS  ++I I G K  L   +L       +K       PGS + F +   D+ +++ I I HDG+ P   W L+ V++      + + F C  WL+  K DGK SR +F+ +   S    Y      E+ V TGD+  +GTDSKV I++ G TG +P+I + ++N + F+RG+     +    +G I K+RI  D  GS+S W+L++V + ++   +    F+C +WLSK+ GD    R+    +RG ++I     +T YKI+  T +  GAG+ A++YI +FGENG+S  + +K     KD F+   I   T   L  LG L K +V + N G    W L+ + + DL   + + FPCG+WLS   D K    E        P  + ++  YE+ ++T ++    TT  A++IL+G + K      +E++ K    N   + G TD   +  ++ L  L     G          +  G+   W   ++V+    +G +  F C +W+            ++E   + + K+  V       + + + T D   A TN+ V + LYG NG T    +    +   +     EF  E+  +G   K+R +HDNSG   +W LEK+ +          F CN+W      D    R+ +PA+
Sbjct: 1856 SRRQSAILENVPEGPTIPYTIKVTTGDGDDNGTSSNVFIKIMGAKKGLHTGQLPLELVQKEK-----FMPGSIETFSVEAVDVEEVKKIEIGHDGVTPGTGWFLKEVDVDMPTKGKHYYFNCKQWLARDKGDGKTSR-VFSLQDGESSMVSYKPMIPCELTVYTGDMQGAGTDSKVSITVFGSTGTTPEI-ILEKNGERFERGKVDLIKLELDEIGAIKKLRIGHDGKGSRSDWFLEKVELRNMDTGDLT-VFKCNDWLSKNKGDGKISRDLAATVRGKQQI----KKTNYKINVKTSDVKGAGTDANVYIILFGENGDSGELHLKTSETYKDPFENNQIDIFTFSDLLSLGELMKCRVWHDNKGFGAAWHLDYIEVEDLGSKKKYIFPCGRWLSTKEDDKQIIRELSCSSPSTPGSKKKQNTYEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSAK----NKILRRGQTDEFKM-TSKNLGKLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSKYVFPCKSWVKIENEIDIDSAKILELKTMEEGKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLDQKFRDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLLPAS 2530          

HSP 7 Score: 256.914 bits (655), Expect = 2.391e-64
Identity = 204/721 (28.29%), Postives = 354/721 (49.10%), Query Frame = 1
Query: 5467 GERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNL--------KTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKN-EDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNE-SYQFEYNEFLSKNVGQKKKLAIDLA----PINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAP-NPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKN---YSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYV--FKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKIL--TPSE 7563
            G R  +P G+  S Y+G  N        S  G  A + D         + Y + + TG +K+ G+S   ++RL G K          K   ++  K  +  F  G+  +  ++  D+ ++K + I ++G+ +E SW+L  I +      K +   C  WLS F  + + SR      ++      K  Y I  +TGD    GT++ +++ ++G  G +    L  N +D FER   D F ++   VG ++KIRI++D  G  P WFL+++ +T++   +  Y F  N++L+K+ G    +A DL     P+   K   Y++ V T++ + AGT + V +  +GE GD+G+ +L   + +N  F+  Q DEF+  +  +LG L R +V H+N GFS+ W+L+ I + ++   + ++FPC++WL+  +DD QI REL+    P +PT        Y++ V TGD ++AG    V+   +G K     S K  +EN       F R   D   +  V +  L +     V+  +   S +  WF  +V V  +  L  Y   F    W    E     +  +++  ++ +   K             +   + T    G GTDANV++ L+G+  +S +  L  +  N FEQGQ DKF +E  ++GK  K++I HD     + W L++V+++N+ T K + + C++WL++ +G  +I+   P+E
Sbjct:  162 GIRPRSPRGKQYS-YAGRGNK-------SPRGAKAKKGD---------VLYKVAVTTGDKKNAGTSAKVYLRLKGTKGKIPKTRLTKKAGSVKKTKAVSFRFNKGTTHIFKIKGADIGDLKSLSIEHDGLTKEDSWFLQEIEVVNTANKKAWLFPCSQWLSLFESDCQLSR------ELYPRRHTKTEYEIVTVTGDCKGAGTDAHVYITIYGKSGVTPKLQLKNNSKDCFERSQSDIFHVKTSCVGPMEKIRIEHDNLGRAPGWFLDRVVVTDQKHPKWKYFFPCNQWLAKDEGDGL-IARDLMGSKDPMAIRKANKYRITVFTADRRGAGTDANVYMTLFGESGDTGERKL---DNSNNNFERGQKDEFLI-ESPNLGPLKRLRVGHDNKGFSAGWYLDKIIVDDLDQSKVYEFPCDRWLAKDEDDGQISRELLVGVGPHDPTPG----IPYQIHVTTGDVRHAGTSARVYVEMFGGKGGNETSGKIWLENGK-----FERGRTD---IFNVEVLSLLSPLSKLVIGHDNSGSGAG-WFLEKVIV--ICPLSGYEQHFLCGKWFADDEDDGVIERTLYEHESLRKKKKKKDT----------WFARIYTSDIRGAGTDANVYMVLYGDKGKSDEVKLDNETDN-FEQGQVDKFKIELDEVGKPYKMRIRHDGKGSFAGWHLNKVELENMQTKKKYVFNCDQWLAEDEGDGEIIREMPAE 828          

HSP 8 Score: 111.694 bits (278), Expect = 2.881e-20
Identity = 64/169 (37.87%), Postives = 100/169 (59.17%), Query Frame = 1
Query: 3685 ANIDRYWFICNRWLASDED---DNMIVRELLPTDE-KGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDES--DEYLFPCFSWLATNKDGGHLSKDIFPAN 4173
            A+  +Y F C  W+  + +   D+  + EL   +E K + + +L  +KY + VKTG+E+G+GT+ANVF+T++G NGD+G+R L     +    FE    D+F I+ +DLG L K++I HDNS    AW L+ V V +++     +FPC  W    K  G LS+D+ PA+
Sbjct: 2365 ASGSKYVFPCKSWVKIENEIDIDSAKILELKTMEEGKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLDQKFRDL---FERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLLPAS 2530          

HSP 9 Score: 86.6557 bits (213), Expect = 9.996e-13
Identity = 69/271 (25.46%), Postives = 124/271 (45.76%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESIL---IEHDGLEPKDS------WLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVR------------TKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKE 1311
            Y++ VTT+D K  GT+   ++ + G+     +  L +    NK      L  G T  F +   +LG L+      +E +    +D+      W    V + +  +   ++F C  W+ +  E    S ++   K++              KY+I+V TGD   +GT++ VF++L G  G + + QL ++    F+R QT +F I    +G ++K+RI  D SG + +W L++V + +    +    F C  W  K  GD    R++  A +
Sbjct: 2267 YEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSAKNKI-----LRRGQTDEFKMTSKNLGKLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSKYVFPCKSWVKIENEIDIDSAKILELKTMEEGKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLDQKFRDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNK-STIFPCNKWFDKKKGDGELSRDLLPASD 2531          

HSP 10 Score: 68.5514 bits (166), Expect = 3.462e-7
Identity = 42/146 (28.77%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  490 AEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            A+ L L++    K + + +   + YK+ V T D  GAGT+  +++++ G   +  + +L        +          T  F I   DLG+L  + IEHD    + +WLL+ VE++N    +  +F CN W    K DG++SR+L 
Sbjct: 2389 AKILELKTMEEGKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQL-------DQKFRDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLL 2527          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. TrEMBL
Match: A0A1S3K2T6 (lipoxygenase homology domain-containing protein 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106178182 PE=4 SV=1)

HSP 1 Score: 1944.86 bits (5037), Expect = 0.000e+0
Identity = 1048/2473 (42.38%), Postives = 1536/2473 (62.11%), Query Frame = 1
Query:  301 TPYATRSTAGYVGGGAFTPT----KSTTALNYCSLRDPNLEDYFIRKFSRVLSPHLPLRDCYNSSLDAEKLGLRSNSFRKTNYL-------------SNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXL--TPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG-FKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLP-ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS-KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELT--GTTLLGK------VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVND--ESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLEN------FNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSK--LQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDE--NDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGP-KNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKK--ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPI----NDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGE-KNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK----KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
             PYA R+   + G  A +P     K+    NY S+ DP+L +YF RKF    +P  P              G+R  S R   Y              +   ++LYKVAVTT D K AGTS  +Y+ ++G K  +P+ RL K   S KK   V      G+T IF I+ +D+GDL+S+ IEHDGL  +DSW LQ +E++N  NK+ WLF C+ WLSL++ D ++SREL+  +  +T+YEIV +TGD   +GTD+ V+I++ G++G++P++QL   +  CF+R Q+  F +  +CVGP+ KIRI  D  G    W+LDRV +TD K+P+W+YFF C  WL+KD GD    R++ G+K+ M I    +Y+I+ +T ++ GAG+ A++Y+ +FGE+G++    + N +  F+ G   E  +    LG LK+++VG+ N G    W+L+K+I++DLDQS+V+EFPC +WL+  + +G + + L V   P +      Y++ ++TG+  HA T++R YV + G +  +      E++ KIW+EN KF+ G TD+  VE+   LSPL++++ G +  G    WFL+ +++ CP +G EQ F+CG W +        E +L E  S RK K   D    TW   IYTSDI+ A T++ V +VLYGD GK+D++ +  ++   + G V +F+ EL  VG PYK+R +HD  G+ + W+L K+ +       +Y F C++WL++   D   +RE+PA G  I KP P+  Y V+++TG K  AGTD+NVFIN++GE GDTG+R L  S  N NKFE+G +DEF+++AV L  +SKI++GHD   AG GWF+DKV++ +E +      F CN W  S E DG  VRE+T  G+ +L         TY +  KTG V+GAGTD+NVFI I+G    TG +QLKTS   KNKFE   TD+FK+E   +G+I+ IRI HD  G G+ WF+D + + VP  G  Y F  ++WL    +   +E +L+P++  K D  IPY++T++TGDV  AGTD+ VF+Q+YG+  KT++  L +K++ FE+G  + FKI AAD+G + KIRIGHDG    +GWFLDKVLI+R  +     +K   +  ++              D    +     +    + E E+     YWF+CNRW A  EDD  IVREL+ TDE+G PL +++E++Y V V TG+  G+GTDANVF+ I G+ GD+GERALK++   ++NKFE    D+F++KAIDLG L+K+KIRHDN  GGAAW+LD V V D      Y FPC  WLAT++D G +++D+ P +  +    +     K  F + QE  LE       ++V V T     AGTDANV+++LYGE +D+G + LK S T+ +KFE G  DEF ++  D+GELKKI+IGHDN+G    W L +VEI+A  LG+ + F C   ++  + DG +ERELYPQ   T      + YEITT TS+ +G  T+A+VY+ +YG++ CT++ +L ++  + K     G  D F + +EDV D IEKIRIGHDN G GS WHL KV V+RL      S+ Y FPCNRWLARDE+DGAI REL+ +K+I             ++D+    L+ K Y + VYTG     GT+ANVF+ ++G+ GDSGER+L+ S+T+ DKFE+  +D+F  E VDLGKVFK+ IRHDN+     DW+L K+E+ID+ +NETY FHCERWL+K KDD K++R+LY+ GY G+ S+  +  SR    GS +S+ S    S     +        +  +   I YTI + TG   D G+S   ++++ G  K L T  + L+ ++   F PGS E  SVEA DVE +K++EI ++GV   + W+L  + ++MPTKGK Y   C  WL++  G+ KTSR+FS+QD   + VS K  I   ++V TGD+   GT+S + + +FG+ G +    L+KN + FERG  D  KLE++++G IKK+RI +DG G R  WFLEK+++ N  T +   F+ N++LSKN G   K++ DLA        IKKT+YK+ VKTS+VK AGT + V +  +GE GDSG+L LKT E    PF+ NQ+D F F D+LSLG+L +C+VWH+N GF + WHL+YIE++++ +++ + FPC +WLS  +DD+QI REL C ++P+   + + + +YE+TV T DKK+ G   + W +  GE K  S +F+MEN+  K K+  R   D+ K+T   LG+LK   LGAV  +++   D++     W C+EV V + A+   YVF  +SW+++  +I     +I ++  + E     +V  ++    VKY+I+V TG   G GT+ANVF+TL+G N ++GKR L QK R+LFE+ Q D+F +E +DLG++ K++IEHD+S FR  W L++V+V N +TNK   +PCN+W  K KG
Sbjct:  107 APYAPRTRESFSGSAAGSPMLDYGKTIGIPNYNSICDPHLTEYFQRKFG---APRPPS-------------GIRPRSPRGKQYSYAGRGNKSPRGAKAKKGDVLYKVAVTTGDKKNAGTSAKVYLRLKGTKGKIPKTRLTKKAGSVKKTKAVSFRFNKGTTHIFKIKGADIGDLKSLSIEHDGLTKEDSWFLQEIEVVNTANKKAWLFPCSQWLSLFESDCQLSRELYPRRHTKTEYEIVTVTGDCKGAGTDAHVYITIYGKSGVTPKLQLKNNSKDCFERSQSDIFHVKTSCVGPMEKIRIEHDNLGRAPGWFLDRVVVTDQKHPKWKYFFPCNQWLAKDEGDGLIARDLMGSKDPMAIRKANKYRITVFTADRRGAGTDANVYMTLFGESGDTGERKLDNSNNNFERGQKDEFLIESPNLGPLKRLRVGHDNKGFSAGWYLDKIIVDDLDQSKVYEFPCDRWLAKDEDDGQISRELLVGVGPHDPTPGIPYQIHVTTGDVRHAGTSARVYVEMFGGKGGN------ETSGKIWLENGKFERGRTDIFNVEVLSLLSPLSKLVIGHDNSGSGAGWFLEKVIVICPLSGYEQHFLCGKWFADDEDDGVIERTLYEHESLRKKKKKKD----TWFARIYTSDIRGAGTDANVYMVLYGDKGKSDEVKLDNETDNFEQGQVDKFKIELDEVGKPYKMRIRHDGKGSFAGWHLNKVELENMQTKKKYVFNCDQWLAEDEGDGEIIREMPAEGEDIKKPMPLVTYNVEVHTGKKFGAGTDSNVFINLFGEFGDTGERPLKKSKANMNKFERGNVDEFIVKAVTLKKLSKIRIGHDGSQAGDGWFLDKVVVKQEGSDKYDTVFECNRWLASDEDDGQIVREITAGGSQMLASCEDKDATTYHIHTKTGDVRGAGTDANVFIWIYGAKNKTGKLQLKTSENYKNKFERAKTDVFKLETTYVGKIERIRIGHDGQGVGAGWFLDGVNIDVPSYGEHYEFSCHRWLAEDEEDGQIEIELEPTETRKGDSLIPYEVTIWTGDVRGAGTDANVFMQMYGETGKTEEYKLDNKTNNFEQGMIEKFKIEAADIGPLVKIRIGHDGAGAFAGWFLDKVLIQRTPAKTSKRNKKLAEKAKTKK-------KVKRKDKNKDEEEDDEQKDDVVDETED-----YWFLCNRWFAKGEDDGQIVRELMATDEQGKPLHDMEEIEYKVKVHTGDIMGAGTDANVFINISGEKGDTGERALKDS--QNINKFERNVTDEFIVKAIDLGKLKKVKIRHDNKGGGAAWFLDSVEVEDVKSKRSYYFPCQRWLATDEDDGQIARDLVPVDKKLMGLNR-----KGSFAVRQEIALETKAAMTTYHVIVVTGNVWGAGTDANVYVVLYGEKDDTGQMFLKVSKTNKDKFERGKTDEFVIEAVDIGELKKIKIGHDNAGGGGAWFLERVEIDAPSLGRKWYFQCGRCLALDEDDGQIERELYPQELATEAYEACVPYEITTYTSDMRGGSTDADVYVVLYGKDSCTQQKSLCSSKRERKQSFNKGAVDKFVLELEDVGDTIEKIRIGHDNSGFGSGWHLSKVEVRRLKDTGKGSVTYVFPCNRWLARDEDDGAIARELVAEKIIEENVKKDGTVKKKELDT-GEKLKNKKYIVNVYTGDVRGAGTDANVFITIFGDKGDSGERKLLHSETNRDKFERKQVDKFILEIVDLGKVFKMKIRHDNANLM-ADWYLDKVEVIDQDENETYTFHCERWLAKGKDDGKLERSLYVKGYDGDMSSMAT-MSRFGSIGSLDSVKSTDPFSKSPRLSRRQSAILENVPEGPTIPYTIKVTTGDGDDNGTSSNVFIKIMGAKKGLHTGQLPLELVQKEKFMPGSIETFSVEAVDVEEVKKIEIGHDGVTPGTGWFLKEVDVDMPTKGKHYYFNCKQWLARDKGDGKTSRVFSLQDGESSMVSYKPMIPCELTVYTGDMQGAGTDSKVSITVFGSTGTTPEIILEKNGERFERGKVDLIKLELDEIGAIKKLRIGHDGKGSRSDWFLEKVELRNMDTGDLTVFKCNDWLSKNKGD-GKISRDLAATVRGKQQIKKTNYKINVKTSDVKGAGTDANVYIILFGENGDSGELHLKTSETYKDPFENNQIDIFTFSDLLSLGELMKCRVWHDNKGFGAAWHLDYIEVEDLGSKKKYIFPCGRWLSTKEDDKQIIRELSC-SSPSTPGSKKKQNTYEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSA-KNKILRRGQTDEFKMTSKNLGKLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSKYVFPCKSWVKIENEIDIDSAKILELKTMEE----GKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLDQKFRDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKG 2524          

HSP 2 Score: 588.956 bits (1517), Expect = 1.311e-167
Identity = 429/1406 (30.51%), Postives = 695/1406 (49.43%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDE---KGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDE-SDEY--LFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNK-------------------------------------SIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDG-SHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNI-IRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFG----TQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVG-KIKKIRIQNDGNGDRPHWFLEKLDIT----NESTNESYQFEYNEFLSK-------------------NV---GQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICEN------------------------APNP----TKTSRNETS------------YEVTVITGDKKNAGMPHDVWFVFYGEKN--YSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRP--LVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKI 7548
            +Y F C++WLA DE D  I+RE+    E   K  PL     + Y V+V TG +FG+GTD+NVF+ +FG+ GD+GER LK +  N +NKFE  ++D+F++KA+ L  L KI+I HD S  G  W+LD V+V  E SD+Y  +F C  WLA+++D G + ++I      M    +D   D + + I+ +           T     AGTDANV I +YG  N +G + LK S  + NKFE    D F+++   +G++++IRIGHD  G  A W L  V I+    G+ + F C+ W+++ + DG +E EL P  + T      I YE+T  T + +GAGT+ANV++Q+YG    TE+  L+N ++    + G  + F +   D+  P+ KIRIGHD  G  + W L+KVL++R  A  +K                                     +  Y F CNRW A+ E+DG I REL+               + D+     + +++  Y ++V+TG     GT+ANVF+ + GE GD+GER L DS+ + +KFE+N  DEF  +A+DLGK+ K+ IRHDN G     WFL  +E+ D     +Y F C+RWL+  +DD +I R L                           +D +  G +  G+FA   +     +     Y + +VTG     G+    ++ LYG K+    + +++ K   + F  G  +   +EA D+  +K+++I ++      +W+L  + I+ P+ G+ +   CG  L+    + +  R    Q+         + Y I+  T D+  G T++ +++ L+G    TQ  S      + + +F +G  D F LE+EDVG  I+KIRI +D +G    W L K+++         + +Y F  N +L++                   NV   G  KK  +D      +K   Y V V T +V+ AGT + V +  +G+ GDSG+ +L   E N   F+  Q+D+FI  +++ LG + + ++ H+N+   + W+L+ +E+ +     ++ F C +WL+   DD ++ R L  +                         + +P     + SR +++            Y + V TGD  + G   +V+    G K   ++ +  +E  V KEK    S E    V  V + E+K I++G     ++  +    WF  EV V      K Y F  + W+   +     DG+   + ++ +D   + V     K ++  E+ V TG   G GTD+ V IT+FG    +G  P  +++K    FE+G+ D   LE  ++G I+K++I HD    RSDWFL++V+++N+ T  +  + CN+WLSK+KG  KI
Sbjct:  803 KYVFNCDQWLAEDEGDGEIIREMPAEGEDIKKPMPL-----VTYNVEVHTGKKFGAGTDSNVFINLFGEFGDTGERPLKKSKAN-MNKFERGNVDEFIVKAVTLKKLSKIRIGHDGSQAGDGWFLDKVVVKQEGSDKYDTVFECNRWLASDEDDGQIVREITAGGSQMLASCEDK--DATTYHIHTK-----------TGDVRGAGTDANVFIWIYGAKNKTGKLQLKTSENYKNKFERAKTDVFKLETTYVGKIERIRIGHDGQGVGAGWFLDGVNIDVPSYGEHYEFSCHRWLAEDEEDGQIEIELEP--TETRKGDSLIPYEVTIWTGDVRGAGTDANVFMQMYGETGKTEEYKLDNKTNN--FEQGMIEKFKIEAADIG-PLVKIRIGHDGAGAFAGWFLDKVLIQRTPAKTSKRNKKLAEKAKTKKKVKRKDKNKDEEEDDEQKDDVVDETEDYWFLCNRWFAKGEDDGQIVRELM---------------ATDEQGKPLHDMEEIEYKVKVHTGDIMGAGTDANVFINISGEKGDTGERALKDSQ-NINKFERNVTDEFIVKAIDLGKLKKVKIRHDNKGGGAA-WFLDSVEVEDVKSKRSYYFPCQRWLATDEDDGQIARDLV-------------------------PVDKKLMGLNRKGSFAVRQEIALETKAAMTTYHVIVVTGNVWGAGTDANVYVVLYGEKDDTGQMFLKVSKTNKDKFERGKTDEFVIEAVDIGELKKIKIGHDNAGGGGAWFLERVEIDAPSLGRKWYFQCGRCLALDEDDGQIERELYPQELATEAYEACVPYEITTYTSDMRGGSTDADVYVVLYGKDSCTQQKSLCSSKRERKQSFNKGAVDKFVLELEDVGDTIEKIRIGHDNSGFGSGWHLSKVEVRRLKDTGKGSVTYVFPCNRWLARDEDDGAIARELVAEKIIEENVKKDGTVKKKELDTG--EKLKNKKYIVNVYTGDVRGAGTDANVFITIFGDKGDSGERKLLHSETNRDKFERKQVDKFIL-EIVDLGKVFKMKIRHDNANLMADWYLDKVEVIDQDENETYTFHCERWLAKGKDDGKLERSLYVKGYDGDMSSMATMSRFGSIGSLDSVKSTDPFSKSPRLSRRQSAILENVPEGPTIPYTIKVTTGDGDDNGTSSNVFIKIMGAKKGLHTGQLPLEL-VQKEKFMPGSIE-TFSVEAVDVEEVKKIEIG-----HDGVTPGTGWFLKEVDVDMPTKGKHYYFNCKQWLARDK----GDGKTSRVFSL-QDGESSMVS---YKPMIPCELTVYTGDMQGAGTDSKVSITVFGS---TGTTPEIILEKNGERFERGKVDLIKLELDEIGAIKKLRIGHDGKGSRSDWFLEKVELRNMDTGDLTVFKCNDWLSKNKGDGKI 2121          

HSP 3 Score: 501.13 bits (1289), Expect = 2.026e-139
Identity = 410/1516 (27.04%), Postives = 654/1516 (43.14%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMN-----------------------------------------VENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSV--------RTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLF-KENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGA-KEIMGI-----------------ASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS--DVKGEGLEKILPVKKLPERYQK-YKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDI-VIFCPQTG---IEQSFICGNWLSPSRPGCQTEVSLVED------------LSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS----KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED---------------------------FSTVREIPATGPGIVKP---------------APICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVR-------ELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT----LEYDLDPSKIDKID-KTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKS---DTFERGNEDVFKI-NAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGD-SGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKI---------KIRHDNSNGGAAWYLDYVLVNDESD--EYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYP 4608
            I Y+V + T DV+GAGT   +++ + G+       +L     +           G  + F I  +D+G L  I I HDG      W L  V I                                           V+    + F CN W +  ++DG++ REL A              +Y++ V TGD+  +GTD+ VFI++ G  G + +  L   +N   F+R  T +F++ A  +G + K++IR D  G  ++W+LD V + D+K+    Y+F C+ WL+ D  D    R++    K++MG+                 A+ T Y +   T N  GAG+ A++Y+ ++GE  ++  + +K    NKD F+ G   E  +    +G LKKIK+G+ N G    WFL +V I+     R + F CG+ L+  +  G+   ++ P +   E Y+    YE+   T +    ST +  YV+L G   KD    +    +        F +G  D   +EL +    + +I  G +  G    W L  + V     TG   +   F C  WL+           LV +            + K++L T        ++V++YT D++ A T++ V + ++GD G + +  +        K +   V +F  E+  +G  +K++ +HDN+   + W L+K+ +      + Y F C RWL+   +D                             ++  + +T P    P                P   Y +++ TG+    GT +NVFI I G K       L        KF  G ++ F +EAV +  + KI++GHD    G+GWF+ +V + +         F C  W    +GDG T R       E +  +    +  E+ V TG +QGAGTDS V I +FG TG T  + L+    N  +FE G  DL K+E ++IG IK +RI HD  G+ S WF++++ +     G   +F  N WL        +  DL  +   K   K   Y+I V T DV  AGTD+ V+I ++G++  + +L LK+     D FE    D+F   +   +G + K R+ HD K  G+ W                                                      L  I  ++  +  +Y F C RWL++ EDD  I+REL        P S  K+  Y + V T ++   GT  N +L + G++   S E  ++N+  N +        D+F + + +LG L++          K   D     A W+   V+V D +   +Y+FPC SW+    +      DI  A     K  ++ K+      + +      + + V T  +  AGT+ANV + LYG   D+G   L Q     + FE    DEF+++  DLGEL K+RI HDNSG    W L KVE+  +   +S +FPCN+W  K K DG L R+L P
Sbjct: 1103 IPYEVTIWTGDVRGAGTDANVFMQMYGETGKTEEYKLDNKTNN--------FEQGMIEKFKIEAADIGPLVKIRIGHDGAGAFAGWFLDKVLIQRTPAKTSKRNKKLAEKAKTKKKVKRKDKNKDEEEDDEQKDDVVDETEDYWFLCNRWFAKGEDDGQIVRELMATDEQGKPLHDMEEIEYKVKVHTGDIMGAGTDANVFINISGEKGDTGERALKDSQNINKFERNVTDEFIVKAIDLGKLKKVKIRHDNKGGGAAWFLDSVEVEDVKSKR-SYYFPCQRWLATDEDDGQIARDLVPVDKKLMGLNRKGSFAVRQEIALETKAAMTTYHVIVVTGNVWGAGTDANVYVVLYGEKDDTGQMFLKVSKTNKDKFERGKTDEFVIEAVDIGELKKIKIGHDNAGGGGAWFLERVEIDAPSLGRKWYFQCGRCLALDEDDGQIERELYPQELATEAYEACVPYEITTYTSDMRGGSTDADVYVVLYG---KDSCTQQKSLCSSKRERKQSFNKGAVDKFVLELEDVGDTIEKIRIGHDNSGFGSGWHLSKVEVRRLKDTGKGSVTYVFPCNRWLARDEDDGAIARELVAEKIIEENVKKDGTVKKKELDTGEKLKNKKYIVNVYTGDVRGAGTDANVFITIFGDKGDSGERKLLHSETNRDKFERKQVDKFILEIVDLGKVFKMKIRHDNANLMADWYLDKVEVIDQDENETYTFHCERWLAKGKDDGKLERSLYVKGYDGDMSSMATMSRFGSIGSLDSVKSTDPFSKSPRLSRRQSAILENVPEGPTIPYTIKVTTGDGDDNGTSSNVFIKIMGAKKGLHTGQLPLELVQKEKFMPGSIETFSVEAVDVEEVKKIEIGHDGVTPGTGWFLKEVDV-DMPTKGKHYYFNCKQWLARDKGDGKTSRVFSLQDGESSMVSYKPMIPCELTVYTGDMQGAGTDSKVSITVFGSTGTTPEIILEK---NGERFERGKVDLIKLELDEIGAIKKLRIGHDGKGSRSDWFLEKVELRNMDTGDLTVFKCNDWLSKNKGDGKISRDLAATVRGKQQIKKTNYKINVKTSDVKGAGTDANVYIILFGENGDSGELHLKTSETYKDPFENNQIDIFTFSDLLSLGELMKCRVWHDNKGFGAAWH-----------------------------------------------------LDYIEVEDLGSKKKYIFPCGRWLSTKEDDKQIIREL-SCSSPSTPGSKKKQNTYEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSAKNKI--LRRGQTDEFKMTSKNLGKLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSKYVFPCKSWVKIENE-----IDIDSAKILELKTMEEGKV-----SVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLDQKF--RDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLLP 2534          

HSP 4 Score: 379.793 bits (974), Expect = 7.997e-102
Identity = 316/1096 (28.83%), Postives = 503/1096 (45.89%), Query Frame = 1
Query: 3697 RYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLG-TLEKIKIRHDNSNGGAAWYLDYVLVNDESDE------YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELY-----------------------------------PQLSLTMT-------KRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLN-NASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIEREL-LPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISV-EAPDVENIKQVEICNEGVDRE---SSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKI-TYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN---FERGHRDHFKLEMEDVGKIKKIRIQ---------NDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTD--------------YKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELI 6732
            +++F C R LA DEDD  I REL P +           + Y +   T +  G  TDA+V++ ++GK+  + +++L ++       F + ++DKF+++  D+G T+EKI+I HDNS  G+ W+L  V V    D       Y+FPC  WLA ++D G +++++           KD  + K +    ++ K + + V VYT     AGTDANV I ++G+  DSG   L  S T+ +KFE    D+F ++  DLG++ K++I HDN+   ADW+L KVE+  +   +++ F C  W++K K DG LER LY                                   P+LS   +       + P I Y I   T +    GT++NV+I++ G         L      K K   G  + F V   DV++ ++KI IGHD    G+ W L++V V      K+    Y F C +WLARD+ DG   R   L D           GES     S+ +        + VYTG     GT++ V + V+G  G + E  L   + + ++FE+  +D  + E  ++G + K+ I HD  G  + DWFL+K+E+ +    +  +F C  WLSK+K D KI R L           A + R +                                Q +   Y I + T   K  G+    ++ L+G +N  +  + L+  ET Y  P     I +    D+ ++ ++  C    D +   ++W+L+ I +E     K Y   CG WLS    +++  R  S          KK  TY I+V T D   GGT    +L L G     S   L +N        RG  D FK+  +++GK+K+  +           D  G    W   ++ +T+ ++   Y F    +    V  + ++ ID A I ++K  +              YK+IVKT +   AGT++ V +  YG  GD+G  +L   ++    F+ NQ DEF   ++L LG+L++ ++ H+NSGF   W LE +E+    T +S  FPCNKW      D ++ R+L+
Sbjct: 1516 KWYFQCGRCLALDEDDGQIERELYPQELATEAYEAC--VPYEITTYTSDMRGGSTDADVYVVLYGKDSCTQQKSLCSSKRERKQSFNKGAVDKFVLELEDVGDTIEKIRIGHDNSGFGSGWHLSKVEVRRLKDTGKGSVTYVFPCNRWLARDEDDGAIARELVAEKIIEENVKKDGTVKKKELDTGEKLKNKKYIVNVYTGDVRGAGTDANVFITIFGDKGDSGERKLLHSETNRDKFERKQVDKFILEIVDLGKVFKMKIRHDNANLMADWYLDKVEVIDQDENETYTFHCERWLAKGKDDGKLERSLYVKGYDGDMSSMATMSRFGSIGSLDSVKSTDPFSKSPRLSRRQSAILENVPEGPTIPYTIKVTTGDGDDNGTSSNVFIKIMGAKKGLHTGQLPLELVQKEKFMPGSIETFSVEAVDVEE-VKKIEIGHDGVTPGTGWFLKEVDVDMPTKGKH----YYFNCKQWLARDKGDGKTSRVFSLQD-----------GES-----SMVSYKPMIPCELTVYTGDMQGAGTDSKVSITVFGSTGTTPEIIL---EKNGERFERGKVDLIKLELDEIGAIKKLRIGHDGKGS-RSDWFLEKVELRNMDTGDLTVFKCNDWLSKNKGDGKISRDL-----------AATVRGKQ-------------------------------QIKKTNYKINVKTSDVKGAGTDANVYIILFG-ENGDSGELHLKTSET-YKDPFENNQIDIFTFSDLLSLGELMKCRVWHDNKGFGAAWHLDYIEVEDLGSKKKYIFPCGRWLSTKEDDKQIIRELSCSSPSTPGSKKKQNTYEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSAKNKILRRGQTDEFKMTSKNLGKLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSKYVFPCKSW----VKIENEIDIDSAKILELKTMEEGKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLD--QKFRDLFERNQTDEFEI-EVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLL 2533          

HSP 5 Score: 296.204 bits (757), Expect = 2.582e-76
Identity = 200/602 (33.22%), Postives = 312/602 (51.83%), Query Frame = 1
Query: 3700 YWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVN--DESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVK-CCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELY-PQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSK-LQTGCTDVFYVSMEDVDDPIEKIRIG---------HDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGE--TGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIA 5457
            Y+F C +WLA D+ D    R     D + + +S    +   + V TG+  G+GTD+ V +T+FG  G + E  L+   +    +FE   +D   ++  ++G ++K++I HD     + W+L+ V +   D  D  +F C  WL+ NK  G +S+D+                  +  +  Q+ K  N+ + V T+    AGTDANV+IIL+GE  DSG + LK S T+ + FE+   D F       LGEL K R+ HDN G  A WHL  +E+E     + ++FPC  W+S  + D  + REL     S   +K+ +  YEIT  TS++K  GT  N ++ + G +    K  L   S K+K L+ G TD F ++ +++   +++  +G          D +G  + WH  +V+V    +       Y FPC  W+  + E      ++L  K +  G ++        V S+AN+     Y I V TG E   GTNANVF+ +YG NGD+G+RQL   +   D FE+N  DEFE E +DLG++ K+ I HDNSGF +  W L+K+E+I++  N++ +F C +W  K K D ++ R L  A
Sbjct: 1974 YYFNCKQWLARDKGDGKTSRVFSLQDGESSMVSYKPMIPCELTVYTGDMQGAGTDSKVSITVFGSTGTTPEIILEKNGE----RFERGKVDLIKLELDEIGAIKKLRIGHDGKGSRSDWFLEKVELRNMDTGDLTVFKCNDWLSKNKGDGKISRDL-----------------AATVRGKQQIKKTNYKINVKTSDVKGAGTDANVYIILFGENGDSGELHLKTSETYKDPFENNQIDIFTFSDLLSLGELMKCRVWHDNKGFGAAWHLDYIEVEDLGSKKKYIFPCGRWLSTKEDDKQIIRELSCSSPSTPGSKKKQNTYEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSAKNKILRRGQTDEFKMTSKNLG-KLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSK----YVFPCKSWVKIENEIDIDSAKILELKTMEEGKVSV-------VRSLANV----KYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQL--DQKFRDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGF-RPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLLPA 2535          

HSP 6 Score: 259.61 bits (662), Expect = 3.304e-65
Identity = 203/692 (29.34%), Postives = 328/692 (47.40%), Query Frame = 1
Query:  517 SFRKTNYLSNHDE---ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFK---SVRTKY------EIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVRE----IRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN----KDGFKEGSIFEHTLP-LRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLS---DVKGEGLEKILPVKKLP-ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGI---------NVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVE--DLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK--LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVRE-IPAT 2475
            S R++  L N  E   I Y + VTT D    GTS  ++I I G K  L   +L       +K       PGS + F +   D+ +++ I I HDG+ P   W L+ V++      + + F C  WL+  K DGK SR +F+ +   S    Y      E+ V TGD+  +GTDSKV I++ G TG +P+I + ++N + F+RG+     +    +G I K+RI  D  GS+S W+L++V + ++   +    F+C +WLSK+ GD    R+    +RG ++I     +T YKI+  T +  GAG+ A++YI +FGENG+S  + +K     KD F+   I   T   L  LG L K +V + N G    W L+ + + DL   + + FPCG+WLS   D K    E        P  + ++  YE+ ++T ++    TT  A++IL+G + K      +E++ K    N   + G TD   +  ++ L  L     G          +  G+   W   ++V+    +G +  F C +W+            ++E   + + K+  V       + + + T D   A TN+ V + LYG NG T    +    +   +     EF  E+  +G   K+R +HDNSG   +W LEK+ +          F CN+W      D    R+ +PA+
Sbjct: 1862 SRRQSAILENVPEGPTIPYTIKVTTGDGDDNGTSSNVFIKIMGAKKGLHTGQLPLELVQKEK-----FMPGSIETFSVEAVDVEEVKKIEIGHDGVTPGTGWFLKEVDVDMPTKGKHYYFNCKQWLARDKGDGKTSR-VFSLQDGESSMVSYKPMIPCELTVYTGDMQGAGTDSKVSITVFGSTGTTPEI-ILEKNGERFERGKVDLIKLELDEIGAIKKLRIGHDGKGSRSDWFLEKVELRNMDTGDLT-VFKCNDWLSKNKGDGKISRDLAATVRGKQQI----KKTNYKINVKTSDVKGAGTDANVYIILFGENGDSGELHLKTSETYKDPFENNQIDIFTFSDLLSLGELMKCRVWHDNKGFGAAWHLDYIEVEDLGSKKKYIFPCGRWLSTKEDDKQIIRELSCSSPSTPGSKKKQNTYEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSAK----NKILRRGQTDEFKM-TSKNLGKLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSKYVFPCKSWVKIENEIDIDSAKILELKTMEEGKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLDQKFRDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLLPAS 2536          

HSP 7 Score: 256.529 bits (654), Expect = 2.789e-64
Identity = 204/721 (28.29%), Postives = 354/721 (49.10%), Query Frame = 1
Query: 5467 GERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNL--------KTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKN-EDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNE-SYQFEYNEFLSKNVGQKKKLAIDLA----PINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAP-NPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKN---YSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYV--FKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKIL--TPSE 7563
            G R  +P G+  S Y+G  N        S  G  A + D         + Y + + TG +K+ G+S   ++RL G K          K   ++  K  +  F  G+  +  ++  D+ ++K + I ++G+ +E SW+L  I +      K +   C  WLS F  + + SR      ++      K  Y I  +TGD    GT++ +++ ++G  G +    L  N +D FER   D F ++   VG ++KIRI++D  G  P WFL+++ +T++   +  Y F  N++L+K+ G    +A DL     P+   K   Y++ V T++ + AGT + V +  +GE GD+G+ +L   + +N  F+  Q DEF+  +  +LG L R +V H+N GFS+ W+L+ I + ++   + ++FPC++WL+  +DD QI REL+    P +PT        Y++ V TGD ++AG    V+   +G K     S K  +EN       F R   D   +  V +  L +     V+  +   S +  WF  +V V  +  L  Y   F    W    E     +  +++  ++ +   K             +   + T    G GTDANV++ L+G+  +S +  L  +  N FEQGQ DKF +E  ++GK  K++I HD     + W L++V+++N+ T K + + C++WL++ +G  +I+   P+E
Sbjct:  162 GIRPRSPRGKQYS-YAGRGNK-------SPRGAKAKKGD---------VLYKVAVTTGDKKNAGTSAKVYLRLKGTKGKIPKTRLTKKAGSVKKTKAVSFRFNKGTTHIFKIKGADIGDLKSLSIEHDGLTKEDSWFLQEIEVVNTANKKAWLFPCSQWLSLFESDCQLSR------ELYPRRHTKTEYEIVTVTGDCKGAGTDAHVYITIYGKSGVTPKLQLKNNSKDCFERSQSDIFHVKTSCVGPMEKIRIEHDNLGRAPGWFLDRVVVTDQKHPKWKYFFPCNQWLAKDEGDGL-IARDLMGSKDPMAIRKANKYRITVFTADRRGAGTDANVYMTLFGESGDTGERKL---DNSNNNFERGQKDEFLI-ESPNLGPLKRLRVGHDNKGFSAGWYLDKIIVDDLDQSKVYEFPCDRWLAKDEDDGQISRELLVGVGPHDPTPG----IPYQIHVTTGDVRHAGTSARVYVEMFGGKGGNETSGKIWLENGK-----FERGRTD---IFNVEVLSLLSPLSKLVIGHDNSGSGAG-WFLEKVIV--ICPLSGYEQHFLCGKWFADDEDDGVIERTLYEHESLRKKKKKKDT----------WFARIYTSDIRGAGTDANVYMVLYGDKGKSDEVKLDNETDN-FEQGQVDKFKIELDEVGKPYKMRIRHDGKGSFAGWHLNKVELENMQTKKKYVFNCDQWLAEDEGDGEIIREMPAE 828          

HSP 8 Score: 111.694 bits (278), Expect = 2.811e-20
Identity = 64/169 (37.87%), Postives = 100/169 (59.17%), Query Frame = 1
Query: 3685 ANIDRYWFICNRWLASDED---DNMIVRELLPTDE-KGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDES--DEYLFPCFSWLATNKDGGHLSKDIFPAN 4173
            A+  +Y F C  W+  + +   D+  + EL   +E K + + +L  +KY + VKTG+E+G+GT+ANVF+T++G NGD+G+R L     +    FE    D+F I+ +DLG L K++I HDNS    AW L+ V V +++     +FPC  W    K  G LS+D+ PA+
Sbjct: 2371 ASGSKYVFPCKSWVKIENEIDIDSAKILELKTMEEGKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLDQKFRDL---FERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLLPAS 2536          

HSP 9 Score: 86.6557 bits (213), Expect = 1.043e-12
Identity = 69/271 (25.46%), Postives = 124/271 (45.76%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESIL---IEHDGLEPKDS------WLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVR------------TKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKE 1311
            Y++ VTT+D K  GT+   ++ + G+     +  L +    NK      L  G T  F +   +LG L+      +E +    +D+      W    V + +  +   ++F C  W+ +  E    S ++   K++              KY+I+V TGD   +GT++ VF++L G  G + + QL ++    F+R QT +F I    +G ++K+RI  D SG + +W L++V + +    +    F C  W  K  GD    R++  A +
Sbjct: 2273 YEITVTTSDKKDGGTTQNAWLILEGEDKKKSKEFLMENSAKNKI-----LRRGQTDEFKMTSKNLGKLKRCYLGAVEREDKPLQDAQGREAMWHCHEVVVTDTASGSKYVFPCKSWVKIENEIDIDSAKILELKTMEEGKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQLDQKFRDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNK-STIFPCNKWFDKKKGDGELSRDLLPASD 2537          

HSP 10 Score: 68.5514 bits (166), Expect = 3.463e-7
Identity = 42/146 (28.77%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  490 AEKLGLRSNSFRKTNYLSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF 927
            A+ L L++    K + + +   + YK+ V T D  GAGT+  +++++ G   +  + +L        +          T  F I   DLG+L  + IEHD    + +WLL+ VE++N    +  +F CN W    K DG++SR+L 
Sbjct: 2395 AKILELKTMEEGKVSVVRSLANVKYKIIVKTGDEWGAGTNANVFMTLYGTNGDTGKRQL-------DQKFRDLFERNQTDEFEIEVLDLGELTKMRIEHDNSGFRPAWLLEKVEVINQATNKSTIFPCNKWFDKKKGDGELSRDLL 2533          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. TrEMBL
Match: A0A210R1S7 (Lipoxygenase homology domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18000 PE=4 SV=1)

HSP 1 Score: 1830.84 bits (4741), Expect = 0.000e+0
Identity = 1022/2526 (40.46%), Postives = 1505/2526 (59.58%), Query Frame = 1
Query:  175 MSSPIDHSENVRLCMKLSSNENKDIYRYQRNKSQSFTLN---KPPTPYA---TRSTAGYVGGGAFTPTKSTTALNYCSLRDPNLEDYFIRKFSRVLSPHLPLRDCYNSSLDAEKLGLRSNSFRKTNYLSNHDEI-LYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXL--TPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEK------ILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKLDS---GSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELT-GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL-----DSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXI----------KRSPSFK-----SLSQISEQEEANI------DRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSN-LKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVND--ESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMY-KDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGE--RSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEY-----IAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKK--ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPIND----IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSK----KWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREAD-GEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            M +P  +SE V+ CM           RY   +      N   K   PY+   + S    V  G  TP        Y  L DP+L +YF R+F  + +           S  +  +   S  F+  +  S+ +E  LYKVAVTT D+K A T   ++++++G K  +P+ RL K   S K +  V    +  ST IF IR  ++G+L+S++IEH+G + +D+W L+ +E+++V++K+ W+F CN WLSL   D +  RELF   S  T YEIV +TGD  +  T++ V++++ GRTG + +I L     + F+RG +  F I   CVGP+ K+RI  D +G  + WYL+R+ ++DLK+ +W+YFF C  WL++D GD A  R++ G+K+  GI    +YKI+ YT +  G+G+ A++YI +FGE G+S    +    + F+ G   E  L    LG L+++++G+ N+G  P WFL+KVII+D D + V+EFPC +WL+  + +G+        + P+   P     + + + ++TG++++A T +R +V++ GP+ K        ++ K+W+E  KF++G TD+  V++ E LSPL EI  G +  G    WFLD +++FCP TGIEQ F C  W +      Q + +L E  + RK K      +  W+V I TSDIK+A T++ V +V YGD GK+D + +  D+K D+   G    F+  +  +G  YK+R  HDN G  S W+L K+ +      ++Y F C+RWL+D  +D S +RE+PA    I KP P+ KY V+++TG KM  GTDANVF+N++GE GDTGDR L  S TN NKFEKG  D F +EAV L  ++KI +GHD K AGSGWF+DKV++ +E       TF C  W  +SE DG  VRELT G+ +L   TY V V TG ++ AGTD+NV I+IFG  GDTG +QL++S    NKFE G TD+FK+E+ +IG +K I+I HD++  G+ W +D++ + VP  G  Y+F  ++WL     D  T+  +L+PS  +  +K +PY++TV+T +   AGTD+ VF+Q+YG   KT++  L ++SD FE   +D FKI A+DVG IQKIRIGHD     SGW L+KVLI+R       ++  +K+   +N        D  + D  S           +R  SFK      L  + E+ E ++      + YWF  N W A  E D  I RE  PTD+ G PL   L++++Y + V TGN  G+GTD+NVF+ I+G+  DSGER LK++  N++NKFE    D F +   DLG L K++IRHDN+  GAAWYLD V V D  +   + F C  WLAT +D G + +++ P + ++  K  KD+   +++  +  +  +  + V V T     AGTDANV+I+L+G+ + +  I LK S+T+ NKFE G  D+F V+  ++GELKKI+IGHD++G  A W L  V I++  LG+ +VFPCN+W+S    D  LEREL+PQ   T    P I YEI   TS++ GAGT+A VYIQ+YG+  CT +  +         K +    D+F + MEDV D IEKIRIGH+N GL + WHL +V +++L      SI + FPC+RWLARDE+D AIEREL+  KV  +  +   G+   +   + + LQ K Y + V+TG     GT+ANVFL ++G+ GDSGER+L  S T++DKFE+N++D F+ + VDLG ++KI IRHDNS  F   W+L  +EIID+ +N+ Y+FHCERWL+K+KDDKKIQR++Y+ GY GE   S    G  +S   GS  SLDS K           + +   AQ E      I YTI + TG  KD G++   W+R+ GP+   T  + L+  + + F  GS E  S+EA DV  +K++EI ++G    + W++  +S+++PTKGK Y   C  WL++   + KT R+F++ D + T  S K  + Y   V TGD+ + GT++ + L +FG +G S+  PL+K  D FERGH D  KLEMEDV  IKKIRIQ +G G RP W LEKL + +  T+    FE N++  K   +K  L  D+A        IK+T YK+ VKTS+V  AGT + V V  +G  GD+G++ L   E    PF+ NQ+D F    +LS+G+LS+C+VWH+NSGF + WHL YIE++++ T++ + F C+ WLS  D D+QI REL C     P+   +  TSYE+ V T DKK AG  H  W +  G K  S K+ +EN+  + K+  R + D  +V    LG+LK + +GA   ++    D +     WFC E++V +  T   Y+F  + WI + +++      E+ +  ++     +++V  ++    +KYEI+V TG   G GT+ANV IT+FG N +SG R L Q  R+LFE+ Q DKF +E +DLG++ KI+IEHD+S FR  WFLDR+++ N++TN    +PC+ WL K+KG
Sbjct:    1 MQAPCTNSEAVKRCMSFPDKPLSSQMRYIEPRPPYAAGNNVVKRDRPYSDVYSNSMYDPVDRGGKTPPFPP----YDPLNDPHLSEYFDRRFGLIQAAAAKRGWGSRPSSASSYMTGGSKRFKTGSGKSSGNETALYKVAVTTGDLKNASTDAKVFVTLKGLKGKIPKTRLTKKAGSVKSNKDVAFRFSRDSTHIFKIRGQNVGNLKSVVIEHNGTKKEDAWFLREIEVVHVKSKKSWVFVCNQWLSLVHGDQQTQRELFPRMSPNTTYEIVTVTGDKMNGATNANVYLTIYGRTGATEKIPLKNNTGKTFERGSSDIFKIKTKCVGPMRKVRIEHDNTGIGAGWYLERIVVSDLKHQQWKYFFPCGQWLARDEGDGAISRDLIGSKDPFGIRKDNKYKITVYTGDGRGSGTDANVYITLFGETGDSGEKRLDTTSNNFRRGKSDEFMLKSPCLGRLERVRIGHDNSGFGPGWFLDKVIIDDTDNNIVYEFPCNRWLATDEDDGMTSRDLIVNVGPMNIAP----GFPFVITVTTGDKSNAGTDARVFVVMNGPQGK--------TSGKVWLETGKFEKGTTDIFNVDMVEMLSPLKEIEVGHDNSGIGPGWFLDQVIVFCPSTGIEQVFPCQKWFATDSGDGQIQRTLKEQKAVRKTKE----KKIPWLVVISTSDIKSAGTDANVYMVAYGDKGKSDKVTL--DNKGDNFEKGQTDHFKVGMVDIGKLYKIRVWHDNDGLASGWHLHKVNLENMTTKEKYNFKCDRWLADDEDDKSLIREMPAESKDINKPLPLVKYVVEVHTGKKMRGGTDANVFVNLFGELGDTGDRPLKESKTNRNKFEKGNTDIFTLEAVTLLKLNKIIIGHDGKGAGSGWFLDKVVVKQEGKDKYDCTFECGRWLATSEDDGQIVRELTLGSQMLSTTTYNVHVTTGDIRSAGTDANVSIQIFGSKGDTGELQLRSSENTSNKFERGKTDMFKLESVNIGVLKKIKIGHDNSKPGAGWHLDEVRIDVPSRGEHYLFACHRWLAKDEKDGLTM-VELEPSHKEDREKRLPYEVTVWTSNKTSAGTDANVFLQMYGDSGKTEKEVLNNRSDNFEANKKDTFKIEASDVGRIQKIRIGHDSVGMFSGWHLEKVLIQRHPIKGTRKTPKRKRTPSANERRKSLVSDLQERDEDSDGSNSSSSPTPRRRRSFKKHKEPELKTVEEESEEDVYDGTETEDYWFFVNEWFARSEGDGAIQREFTPTDKDGKPLKGALQDVEYEIHVFTGNVRGAGTDSNVFVNIYGEKFDSGERQLKDS--NNLNKFENGQEDIFKMNIKDLGRLVKLRIRHDNAGIGAAWYLDRVEVVDTRKRQTFYFLCQRWLATGEDDGQICRELVPVDKSLLGKSGKDSA--RAEVALETKAAMTTYYVNVKTGTVWGAGTDANVYILLFGDKDHTDTIFLKSSMTNKNKFEGGQTDKFLVEAVNIGELKKIKIGHDDAGGGAPWFLDNVVIDSPSLGKCWVFPCNKWLSSKDGDCQLERELWPQELNTQEYTPCIPYEIKVYTSDKSGAGTSAEVYIQLYGKELCTTQKQMCPTKRERNDKFKRNACDLFLLEMEDVGDTIEKIRIGHNNSGLTAGWHLNRVEIRKLHETGRGSITFVFPCDRWLARDEDDTAIERELIAGKV-HQELIGKDGQVKKKDIKLRDQLQNKHYVVNVHTGDVSGAGTDANVFLTIWGDRGDSGERKLHKSDTYSDKFERNHIDVFKMDIVDLGNIYKIKIRHDNS-MFNPAWYLDYVEIIDQSNNQKYMFHCERWLAKNKDDKKIQRSIYVKGYDGEMESSTGTLGTMKSTRYGSVASLDSLKSTDPFSKSPRLSRKQQLAQEEMPDGDTIPYTIKVSTGKGKDDGTTSNVWVRVIGPRKRDTGRLFLELAQKDRFMAGSVETFSLEAVDVGEVKKLEIGHDGEAPGTGWFVWEVSVDVPTKGKHYVFQCKQWLARDKSDGKTVRVFTLDDGVSTVTSYKPMVQYECEVTTGDITEAGTDTQITLTVFGAKGTSAPIPLEKVGDRFERGHSDLIKLEMEDVAPIKKIRIQTNGKGSRPEWHLEKLTLRSYETDALSVFEVNDWFGK---KKGVLMRDIAAKERGKFVIKETSYKISVKTSDVSGAGTDAKVFVTLFGANGDTGEIHLDKSETYKDPFENNQIDVFTIQKILSVGELSKCRVWHDNSGFGAAWHLAYIEVEDLSTKKVYTFHCDNWLSKKDGDKQILRELTCGTIAKPSTGDKETTSYELEVKTSDKKEAGTIHHGWVILEGSKE-SVKYKLENSA-RNKILRRGNTDYFQVPSRPLGKLKRVIVGAAEREDHPLQDMEGHEAMWFCYEINVTDTTTGNKYLFPCKKWITISDRLYSKKYREVLEAKSV----EQSQVSVVRNLAPIKYEIIVFTGDVFGAGTNANVSITIFGSNGDSGMRTLQQSFRDLFERNQVDKFQMEILDLGELHKIRIEHDNSGFRPAWFLDRIEIVNMATNNTTVFPCSNWLDKNKG 2488          

HSP 2 Score: 476.863 bits (1226), Expect = 6.409e-132
Identity = 403/1438 (28.03%), Postives = 654/1438 (45.48%), Query Frame = 1
Query: 2803 FRCNCWFDSSEGDGLTVRELTGTTLLGK--------VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKIDKT-----------------IPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSK---SDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYW-FICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLG-TLEKIKIRHDNSNGGAAWYLDYVLVND------ESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELY-----------------------------------------PQLS----LTMTKRP---KIKYEITTVTSNRKGAGTNANVYIQVYG-RNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLET--NYFAPGSKEVISVEA-PDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQD--KMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN--FERGHRDHFKLEMEDVGKIKKIRIQ---------NDGNGDRPHWFLEKLDITNESTNESYQF---------------EYNEFLSKNVGQKKKLAI--DLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKP-FKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICEN 6741
            F  N WF  SEGDG   RE T T   GK        V YE+ V TG V+GAGTDSNVF+ I+G+  D+G  QLK S  N NKFE G  D+FK+  +D+G +  +RI HD+ G G+AW++D++ V+  +    + F   +WL    D   +  +L P     + K+                   Y + V TG V  AGTD+ V+I ++G    TD + LKS     + FE G  D F + A ++G ++KI+IGHD    G+ WFLD V+I+                                        SPS              + + W F CN+WL+S + D  + REL P  ++ N       + Y + V T ++ G+GT A V++ ++GK   + ++ +  T     +KF+  + D FL++  D+G T+EKI+I H+NS   A W+L+ V +         S  ++FPC  WLA ++D   + +++           KD ++ K   K+  + + +++ V V+T     AGTDANV + ++G+  DSG   L +S T+S+KFE  + D F++   DLG + KI+I HDNS  N  W+L  VEI  +   Q ++F C  W++K+K D  ++R +Y                                         P+LS    L   + P    I Y I   T   K  GT +NV+++V G R   T +  L  A  K +   G  + F +   DV + ++K+ IGHD +  G+ W + +V V      K+    Y F C +WLARD+ DG   R    D               D V +V +      Y   V TG   E GT+  + L V+G  G S    L   +   D+FE+ + D  + E  D+  + KI I+ +  G  + +W L+K+ +     +   +F    W  K K               G      + + R                   G F  +            +Y I++ T      G+    ++ L+G  N  T  I L K ET  + F     +V +++    V  + +  + ++     ++W+L  I +E  +  K+Y   C  WLSK  G+++  R  +     K  T   +  +Y + V T D  + GT    ++ L G++  S  Y L+ +  N    RG+ D+F++    +GK+K++ +           D  G    WF  ++++T+ +T   Y F               +Y E L     ++ ++++  +LAPI       Y++IV T +V  AGT++ V++  +G  GDSG   ++T +Q+ +  F+ NQ+D+F   ++L LG+L + ++ H+NSGF   W L+ IE+  + T  +  FPC+ WL     D+ I R+L+  +
Sbjct: 1201 FFVNEWFARSEGDGAIQREFTPTDKDGKPLKGALQDVEYEIHVFTGNVRGAGTDSNVFVNIYGEKFDSGERQLKDS-NNLNKFENGQEDIFKMNIKDLGRLVKLRIRHDNAGIGAAWYLDRVEVVDTRKRQTFYFLCQRWLATGEDDGQICRELVPVDKSLLGKSGKDSARAEVALETKAAMTTYYVNVKTGTVWGAGTDANVYILLFGDKDHTDTIFLKSSMTNKNKFEGGQTDKFLVEAVNIGELKKIKIGHDDAGGGAPWFLDNVVID----------------------------------------SPS--------------LGKCWVFPCNKWLSSKDGDCQLERELWP--QELNTQEYTPCIPYEIKVYTSDKSGAGTSAEVYIQLYGKELCTTQKQMCPTKRERNDKFKRNACDLFLLEMEDVGDTIEKIRIGHNNSGLTAGWHLNRVEIRKLHETGRGSITFVFPCDRWLARDEDDTAIERELIAGKVHQELIGKDGQVKKKDIKLRDQLQNKHYVVNVHTGDVSGAGTDANVFLTIWGDRGDSGERKLHKSDTYSDKFERNHIDVFKMDIVDLGNIYKIKIRHDNSMFNPAWYLDYVEIIDQSNNQKYMFHCERWLAKNKDDKKIQRSIYVKGYDGEMESSTGTLGTMKSTRYGSVASLDSLKSTDPFSKSPRLSRKQQLAQEEMPDGDTIPYTIKVSTGKGKDDGTTSNVWVRVIGPRKRDTGRLFLELAQ-KDRFMAGSVETFSLEAVDVGE-VKKLEIGHDGEAPGTGWFVWEVSVDVPTKGKH----YVFQCKQWLARDKSDGKTVRVFTLD---------------DGVSTVTSYKPMVQYECEVTTGDITEAGTDTQITLTVFGAKGTSAPIPL---EKVGDRFERGHSDLIKLEMEDVAPIKKIRIQTNGKGS-RPEWHLEKLTLRSYETDALSVFEVNDWFGKKK---------------GVLMRDIAAKER-------------------GKFVIKE----------TSYKISVKTSDVSGAGTDAKVFVTLFGA-NGDTGEIHLDKSETYKDPFENNQIDVFTIQKILSVGELSKCRVWHDNSGFGAAWHLAYIEVEDLSTKKVYTFHCDNWLSKKDGDKQILRELTCGTIAKPSTGDKETTSYELEVKTSDKKEAGTIHHGWVILEGSK-ESVKYKLENSARNKILRRGNTDYFQVPSRPLGKLKRVIVGAAEREDHPLQDMEGHEAMWFCYEINVTDTTTGNKYLFPCKKWITISDRLYSKKYREVLEAKSVEQSQVSVVRNLAPIK------YEIIVFTGDVFGAGTNANVSITIFGSNGDSG---MRTLQQSFRDLFERNQVDKFQM-EILDLGELHKIRIEHDNSGFRPAWFLDRIEIVNMATNNTTVFPCSNWLDKNKGDKSISRDLLARD 2500          

HSP 3 Score: 331.257 bits (848), Expect = 4.171e-87
Identity = 280/1102 (25.41%), Postives = 507/1102 (46.01%), Query Frame = 1
Query: 4531 QSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRP------KIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLP-DKVIRRGSMNALGESIDQVDSVANILQKKA----YTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTN--IIRLQKLETNYFAPGSKEVISVEAPDV-ENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVT----CGVWLSKFMGERKTSRIFSI----------------QDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSS---LYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKK-KLAI-------------------------DLAPINDIKKTD--------------------------YKVIVKTSNVKSAGTSSAVTVKFYGEFG-DSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL--VQKGRNLFEQGQEDKFILE-CVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKIL 7551
            + + F  NEW ++S+ DG ++RE  P        +P       ++YEI   T N +GAGT++NV++ +YG    + +  L ++++ +K + G  D+F ++++D+   + K+RI HDN G+G+AW+L++V V     +  K   + F C RWLA  E+DG I REL+P DK +       LG+S          L+ KA    Y + V TG     GT+ANV++ ++G+   +    L  S T+ +KFE    D+F  EAV++G++ KI I HD++G     WFL  + I      + ++F C +WLS    D +++R L+                          L++Q+                   T  I Y I + T  +   G+S   +++LYG +   T   +   ++   + F   + ++  +E  DV + I+++ I +      + W+LN + I    +    ++T    C  WL++   +    R                    +D  + +  +   Y+++V TGDV   GT++ +FL ++G +G+S    L+  D   D FER H D FK+++ D+G I KI+I++D +   P W+L+ ++I ++S N+ Y F    +L+KN   KK + +I                          +A ++ +K TD                          Y + V T   K  GT+S V V+  G    D+G L L+  +++   F    ++ F   + + +G++ + ++ H+     + W +  + +      + + F C +WL+    D +  R    ++  +   + +    YE  V TGD   AG    +    +G K  S    +E   D+   F R   D  K+    +  +K I++     +        +W   ++ +++  T    VF++  W    + +      + DI+   ++  K  ++E        Y+I V T   +G GTDA VF+TLFG N ++G+  L   +  ++ FE  Q D F ++  + +G++ K ++ HD+S F + W L  ++V++LST K++ + C+ WLSK  G  +IL
Sbjct: 1197 EDYWFFVNEWFARSEGDGAIQREFTPT---DKDGKPLKGALQDVEYEIHVFTGNVRGAGTDSNVFVNIYGEKFDSGERQLKDSNNLNKFENGQEDIFKMNIKDLGRLV-KLRIRHDNAGIGAAWYLDRVEV----VDTRKRQTFYFLCQRWLATGEDDGQICRELVPVDKSL-------LGKSGKDSARAEVALETKAAMTTYYVNVKTGTVWGAGTDANVYILLFGDKDHTDTIFLKSSMTNKNKFEGGQTDKFLVEAVNIGELKKIKIGHDDAGG-GAPWFLDNVVIDSPSLGKCWVFPCNKWLSSKDGDCQLERELW-----------------------PQELNTQE------------------YTPCIPYEIKVYTSDKSGAGTSAEVYIQLYGKELCTTQKQMCPTKRERNDKFKRNACDLFLLEMEDVGDTIEKIRIGHNNSGLTAGWHLNRVEIRKLHETGRGSITFVFPCDRWLARDEDDTAIERELIAGKVHQELIGKDGQVKKKDIKLRDQLQNKHYVVNVHTGDVSGAGTDANVFLTIWGDRGDSGERKLHKSDTYSDKFERNHIDVFKMDIVDLGNIYKIKIRHDNSMFNPAWYLDYVEIIDQSNNQKYMFHCERWLAKNKDDKKIQRSIYVKGYDGEMESSTGTLGTMKSTRYGSVASLDSLKSTDPFSKSPRLSRKQQLAQEEMPDGDTIPYTIKVSTGKGKDDGTTSNVWVRVIGPRKRDTGRLFLELAQKDR--FMAGSVETFSL-EAVDVGEVKKLEIGHDGEAPGTGWFVWEVSVDVPTKGKHYVFQCKQWLARDKSDGKTVRVFTLDDGVSTVTSYKPMVQYECEVTTGDITEAGTDTQITLTVFGAKGTSAPIPLEKVGDR---FERGHSDLIKLEMEDVAPIKKIRI-----QTNGKGSRPEWHLEKLTLRSYETDALSVFEVNDWFGKKKGVL-----MRDIA--AKERGKFVIKE------TSYKISVKTSDVSGAGTDAKVFVTLFGANGDTGEIHLDKSETYKDPFENNQIDVFTIQKILSVGELSKCRVWHDNSGFGAAWHLAYIEVEDLSTKKVYTFHCDNWLSKKDGDKQIL 2217          

HSP 4 Score: 330.102 bits (845), Expect = 9.398e-87
Identity = 313/1247 (25.10%), Postives = 557/1247 (44.67%), Query Frame = 1
Query: 4084 ESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYP----------------QLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNLNNA-SDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGETG--TNANVFLKVYGENGDSGERQLVDSKT-HTDKFEKNNMDEFEWEAVDLGKVF-KIDIRHDNSGFFKKDWFLKKIEIIDKFDNE----TYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLET--NYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSK-------------------------FMGERKTSRIFSIQ--DKMMTN--------VSKK-------------ITYLISVITGDVDQGGTNSTLFLQLFGTQGNSS--LYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAI-----DLAPINDIKK-TDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVY-LGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRN-LFEQGQEDKFILECVDLGKIEKIKI---EHDDSRFR------SDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLW 7542
            E+++Y F    W A ++  G + ++  P +       KD K  K   +  +      + + V+T     AGTD+NV + +YGE  DSG   LK S  + NKFE+G  D F++   DLG L K+RI HDN+G  A W+L +VE+   +  Q+F F C  W++  + DG + REL P                +++L  TK     Y +   T    GAGT+ANVYI ++G  D T+   L ++ ++K+K + G TD F V   ++ + ++KI+IGHD+ G G+ W L+ V++      K     + FPCN+WL+  + D  +EREL P ++  +     +                  Y I+VYT  ++G  T+A V++++YG+   + ++Q+  +K    DKF++N  D F  E  D+G    KI I H+NSG     W L ++EI    +      T++F C+RWL++ +DD  I+R L IAG                       +  +  G  G     +    D  Q ++  Y + + TG     G+    ++ ++G +   +   +L K +T  + F     +V  ++  D+ NI +++I ++      +WYL+ + I   +  + Y   C  WL+K                          +G  K++R  S+   D + +         +S+K             I Y I V TG     GT S +++++ G +   +  L+     +D F  G  + F LE  DVG++KK+ I +DG      WF+ ++ +   +  + Y F+  ++L+++    K + +      ++ +   K    Y+  V T ++  AGT + +T+  +G  G S  + L   E+    F+    D  I  +M  +  + + ++  N  G    WHLE + ++  +T     F  N W         + R++    A    K    ETSY+++V T D   AG    V+   +G    + +  ++ +   +  F  +  D   +  +  +GEL   +   V + N  +  +  W    + V++L+T K Y F   +W+   +  ++   E+      +  P+    E         YE+ V T      GT  + ++ L G + ES K  L    RN +  +G  D F +    LGK++++ +   E +D   +      + WF   + V + +T   + +PC +W++ S  L+
Sbjct: 1195 ETEDYWFFVNEWFARSEGDGAIQREFTPTD-------KDGKPLKGALQDVE------YEIHVFTGNVRGAGTDSNVFVNIYGEKFDSGERQLKDS-NNLNKFENGQEDIFKMNIKDLGRLVKLRIRHDNAGIGAAWYLDRVEVVDTRKRQTFYFLCQRWLATGEDDGQICRELVPVDKSLLGKSGKDSARAEVALE-TKAAMTTYYVNVKTGTVWGAGTDANVYILLFGDKDHTDTIFLKSSMTNKNKFEGGQTDKFLVEAVNIGE-LKKIKIGHDDAGGGAPWFLDNVVIDSPSLGK----CWVFPCNKWLSSKDGDCQLERELWPQELNTQEYTPCI-----------------PYEIKVYTSDKSGAGTSAEVYIQLYGKELCTTQKQMCPTKRERNDKFKRNACDLFLLEMEDVGDTIEKIRIGHNNSGL-TAGWHLNRVEIRKLHETGRGSITFVFPCDRWLARDEDDTAIEREL-IAG----------------------KVHQELIGKDGQVKKKDIKLRDQLQNKH--YVVNVHTGDVSGAGTDANVFLTIWGDRG-DSGERKLHKSDTYSDKFERNHIDVFKMDIVDLGNIYKIKIRHDNSMFNPAWYLDYVEIIDQSNNQKYMFHCERWLAKNKDDKKIQRSIYVKGYDGEMESSTGTLGTMKSTRYGSVASLDSLKSTDPFSKSPRLSRKQQLAQEEMPDGDTIPYTIKVSTGKGKDDGTTSNVWVRVIGPRKRDTGRLFLELAQKDRFMAGSVETFSLEAVDVGEVKKLEIGHDGEAPGTGWFVWEVSVDVPTKGKHYVFQCKQWLARDKSDGKTVRVFTLDDGVSTVTSYKPMVQYECEVTTGDITEAGTDTQITLTVFGAKGTSAPIPL---EKVGDRFERGHSD-LIKLEMEDVAPIKKIRIQTNGKGSRPEWHLEKLTLRSYETDALSVFEVNDWFGKKKG--VLMRDIA---AKERGKFVIKETSYKISVKTSDVSGAGTDAKVFVTLFGANGDTGEIHLDKSETYKDPFENNQIDVFTIQKILSVGELSKCR---VWHDNSGFGAA--WHLAYIEVEDLSTKKVYTFHCDNWLSKKDGDKQILREL--TCGTIAKPSTGDKE------TTSYELEVKTSDKKEAGTIHHGWVILEG-SKESVKYKLENSARNKILRRGNTDYFQVPSRPLGKLKRVIVGAAEREDHPLQDMEGHEAMWFCYEINVTDTTTGNKYLFPCKKWITISDRLY 2354          

HSP 5 Score: 286.96 bits (733), Expect = 1.704e-73
Identity = 258/1013 (25.47%), Postives = 447/1013 (44.13%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGD-LESILIEHDGLEPKDSWLLQGVEIMNV-ENKR---IWLFTCNHWLSLYKEDGKVSRELFAFK----------SVRTK------------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQC--FQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVR---------EIRGAKEIMGIASRTRY-----------------------KISFYTENKPGA-----------------GSHADIYIQIFGENGESD---VIDIKNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLPERYQKYK----YEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENA--KFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK----LDSGSVVEFRTE-LAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAP----ICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLG---------HDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSS------------EGDGLTVRELTGTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDS----KTLEYDL 3228
            I Y++ V T+D  GAGTS  +YI + G +    + ++   K+             +  +F +   D+GD +E I I H+       W L  VEI  + E  R    ++F C+ WL+  ++D  + REL A K           V+ K            Y + V TGD+  +GTD+ VF+++ G  G S + +L K +T    F+R     F +    +G I KI+IR D S    +WYLD V I D  N + +Y F C+ WL+K+  D    R         E+  +   +G    TRY                       K     E  P                   G+ +++++++ G          +++  KD F  GS+   +L    +G +KK+++G+    P   WF+ +V ++   + + + F C QWL+  K +G   ++  +         YK    YE +++TG+   A T ++  + + G +          ++  I +E    +F+ G +D++ +E+ E ++P+ +I    N  G   +W L+ + +   +T     F   +W      G +  V + +  +K + K VI   E ++ +S+ TSD+  A T++KV + L+G NG T +I +          ++  +  F  + +  VG   K R  HDNSG  ++W+L  I +        Y F C+ WLS    D   +RE+  T   I KP+        Y++++ T +K  AGT  + ++ + G K     ++   ++       +G  D F + +  LG + ++ +G          D +   + WF  ++ +  +    N   F C  W   S            E   +   +++    L  + YE+ V TG V GAGT++NV I IFG  GD+G   L+ S   ++ FE    D F++E  D+GE+  IRI HD++G   AWF+D+I ++        +F  + WLD     K++  DL
Sbjct: 1513 IPYEIKVYTSDKSGAGTSAEVYIQLYGKELCTTQKQMCPTKRERNDK----FKRNACDLFLLEMEDVGDTIEKIRIGHNNSGLTAGWHLNRVEIRKLHETGRGSITFVFPCDRWLARDEDDTAIERELIAGKVHQELIGKDGQVKKKDIKLRDQLQNKHYVVNVHTGDVSGAGTDANVFLTIWGDRGDSGERKLHKSDTYSDKFERNHIDVFKMDIVDLGNIYKIKIRHDNSMFNPAWYLDYVEIIDQSNNQ-KYMFHCERWLAKNKDDKKIQRSIYVKGYDGEMESSTGTLGTMKSTRYGSVASLDSLKSTDPFSKSPRLSRKQQLAQEEMPDGDTIPYTIKVSTGKGKDDGTTSNVWVRVIGPRKRDTGRLFLELAQKDRFMAGSVETFSLEAVDVGEVKKLEIGHDGEAPGTGWFVWEVSVDVPTKGKHYVFQCKQWLARDKSDGKTVRVFTLDDGVSTVTSYKPMVQYECEVTTGDITEAGTDTQITLTVFGAK---------GTSAPIPLEKVGDRFERGHSDLIKLEM-EDVAPIKKIRIQTNGKGSRPEWHLEKLTLRSYETDALSVFEVNDWF-----GKKKGVLMRDIAAKERGKFVI--KETSYKISVKTSDVSGAGTDAKVFVTLFGANGDTGEIHLDKSETYKDPFENNQIDVFTIQKILSVGELSKCRVWHDNSGFGAAWHLAYIEVEDLSTKKVYTFHCDNWLSKKDGDKQILREL--TCGTIAKPSTGDKETTSYELEVKTSDKKEAGTIHHGWVILEGSKESV--KYKLENSARNKILRRGNTDYFQVPSRPLGKLKRVIVGAAEREDHPLQDMEGHEAMWFCYEINV-TDTTTGNKYLFPCKKWITISDRLYSKKYREVLEAKSVEQSQVSVVRNLAPIKYEIIVFTGDVFGAGTNANVSITIFGSNGDSGMRTLQQSF--RDLFERNQVDKFQMEILDLGELHKIRIEHDNSGFRPAWFLDRIEIVNMATNNTTVFPCSNWLDKNKGDKSISRDL 2496          

HSP 6 Score: 225.713 bits (574), Expect = 6.552e-55
Identity = 176/679 (25.92%), Postives = 312/679 (45.95%), Query Frame = 1
Query:  538 LSNHDEILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRT--------KYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN----KDGFKEGSIFEHTL-PLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILP-------VKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGI---------NVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPS---RPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK--LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPA 2472
            + + D I Y + V+T   K  GT+  +++ + G     PR R    +   +     +   GS + F +   D+G+++ + I HDG  P   W +  V +      + ++F C  WL+  K DGK  R       V T        +YE  V TGD+ ++GTD+++ +++ G  G S  I L K   + F+RG +    +    V PI KIRI+ +  GS+  W+L+++ +   +       F+  +W  K  G    +R+I   +    +   T YKIS  T +  GAG+ A +++ +FG NG++  I +      KD F+   I   T+  +  +G L K +V + N+G    W L  + + DL   +V+ F C  WLS  K +G ++IL         K      +   YE+++ T ++  A T    +VIL+G   K+ +  K+E++ +    N   + G TD   V  +  L  L  +I G          ++ G    WF  +I +    TG +  F C  W++ S         EV   + + + ++  V +     + + ++T D+  A TN+ V + ++G NG +    +    +   +   V +F+ E+  +G  +K+R +HDNSG   +W L++I +      +   F C+ WL  +  D S  R++ A
Sbjct: 1839 MPDGDTIPYTIKVSTGKGKDDGTTSNVWVRVIG-----PRKR-DTGRLFLELAQKDRFMAGSVETFSLEAVDVGEVKKLEIGHDGEAPGTGWFVWEVSVDVPTKGKHYVFQCKQWLARDKSDGKTVRVFTLDDGVSTVTSYKPMVQYECEVTTGDITEAGTDTQITLTVFGAKGTSAPIPLEKVGDR-FERGHSDLIKLEMEDVAPIKKIRIQTNGKGSRPEWHLEKLTLRSYETDALS-VFEVNDWFGKKKG--VLMRDIAAKERGKFVIKETSYKISVKTSDVSGAGTDAKVFVTLFGANGDTGEIHLDKSETYKDPFENNQIDVFTIQKILSVGELSKCRVWHDNSGFGAAWHLAYIEVEDLSTKKVYTFHCDNWLS--KKDGDKQILRELTCGTIAKPSTGDKETTSYELEVKTSDKKEAGTIHHGWVILEGS--KESVKYKLENSAR----NKILRRGNTDYFQVP-SRPLGKLKRVIVGAAEREDHPLQDMEGHEAMWFCYEINVTDTTTGNKYLFPCKKWITISDRLYSKKYREVLEAKSVEQSQVSVVRNLAPIKYEIIVFTGDVFGAGTNANVSITIFGSNGDSGMRTLQQSFRDLFERNQVDKFQMEILDLGELHKIRIEHDNSGFRPAWFLDRIEIVNMATNNTTVFPCSNWLDKNKGDKSISRDLLA 2498          
BLAST of Lipoxygenase homology domain-containing protein 1 vs. TrEMBL
Match: V4AVD7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_208950 PE=4 SV=1)

HSP 1 Score: 1796.56 bits (4652), Expect = 0.000e+0
Identity = 958/2240 (42.77%), Postives = 1385/2240 (61.83%), Query Frame = 1
Query:  946 TKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKN-KDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKILPVKKLP-ERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELT--GTTLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADVGVIQKIRIGHDGKKPGSGWFLDKV---------LXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQI----SEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSN-LKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLGTLEKIKIRHDNSNGGAAWYLDYVLVNDESDE--YLFPCFSWLATNKDGGHLSKDIFPANPAMYKDW--KDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGRNDCTEKTNL--NNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGET--GTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTE-------YIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKIT-YLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAPINDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRNETSYEVTVITGDKKNAGMPHDVWFVFYGEKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSD----SKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPLVQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKG 7536
            ++YEI+ +TGD  + GT++ VF +L G++GI+ +  L       F+RG T  F  P+ CVGP+ KIRI  D +G  + WYL+RV +TDLKNP W+YFF C  WL+ D GD +  R++ G+K+ M I   T+YK++ +T NK GAG+ A++ I +FGE G+S    + + K+ F+   + E  L   +LG L++I++G+ + G  P WFL+KVI++D+  S+V+EFPC +WL+  + +G + + L +   P +  Q + Y + + TG++  A T +R +++L G +  +      ES+ KIW+++ KF+   TD+  V +   LSPL+ I  G +  G    WFLD + I+CP +GIEQ F CG WL+      + E  +   L +++ +      +N W V +YTSD +NA T+S V + LYGD GK+DDI +                           +     SG+   +N+    +T  V+ + Y+F C++WL++   D   VRE+PA GPGI KP P+ KYK++++TG    AGTDANVF+NI+GE+GDTG+RFL HS +N NKFEKG +DE  IEAV L  + KI++GHD K  GSGWF+DK+++ +  NP    TF CN W    E DG   RE+T  G+ +L   +Y V+VKTG V+GAGTD+NV ++IFG  GDTG++QL+ S +  NKFE   TD FK+EA DIG+IK I+I HD T  G+ WF+D I + VP  G  Y F  ++WL    +   +E +L+PS  +  DK IPY++T++T D+  AGTD+ VFIQ+YG++ KTD+  +++KSD FERG  D FKI AADVG + K+RIGHDG    +GW  +KV         +       + P  K K +    + Y S+S+  S       ++R  +  +L  +       +    + YWF  +RW A +EDD  IVREL+PTDEKG PL + L+E  Y V + TG+ +G+GTDANVF+ +FG  GDSGER +K++  N+ NKFE    D F I+AI+LG L K+K+RHDN  GGAAW+LD + V DE ++  Y FPC  WLA  +D G +S+++ P + ++ K    KD+K   ++  + Q+  +  +NV V T KK  AGTDANV+IIL+GE + +G I LK SLT+ NKFE G  DEF ++   +GELKKIRIGHDN+G    W L  V I+A  LG+ ++FPC  W+S    DG LERELYPQ   T    P I YEIT  TS + GA T+A+VYI +YG++ CTE+ +L       K     G  D F V +EDV + IEKIRIGHD  GLGS WHL+K+ V++L      SI Y FPC RWLAR+EEDGAIERELLPDKV++   +   GE   +   + + L+ K YT+ V TG ++  GT+ANVF+ V+G+ GD+GER+L  S+TH DKFE+   D F+ EAVDLGKV+KI IRHDNS      WFL +IE++D  DNET++FHCERWL+K+KDD KI+RTLY+         + +G  RS   GS +SLDS +             +  ++  E        I+YT+ + TG  +D G+    W+ +YGP+   T    L   + + F PGS EV S+EA D++ IK++EI ++G    + W++  + ++MPTKGK Y+ +C  WL++  G+ KTSRIFS+ D   + VS K + Y ++V TGDV   GT+S + + +FG++G++S   LDKN+D FER   D  K+++ED+G +KK+R+  DG G RP WFLEK+++ N  T     F   ++LSK+    + +         + KT YKV VKTS+++ AGT + V +  +G  GDSGD+ LK PE    PF  NQLDEFI  D+LS+G+LS+ +VWH+N GF S WHL YIE++++++++ + F C+KWLS ++DD+QI REL C NA  P        +Y++ + T DKK  G  H+ W V  G K  S+ F++EN+  + K+  R   D  K   + LG++K   LGAV  +++  +D    + +W C++V + + +T   Y F    WI +  KI + D  +  + ++ E      V  ++    +KYE++V TG   GCGT+ANV ITLFG N ++G RPL Q+ R+LFE+ Q DKF +E +DLG++ KI+IEHD+S FR  WFLD+V+V N++TN    +PCN+W  K KG
Sbjct:    5 SEYEILTVTGDRSNGGTNANVFCTLFGKSGITKRFHLKSTEKGLFERGTTDSFRFPSNCVGPMKKIRIEHDNTGIGAGWYLERVVVTDLKNPHWKYFFPCGQWLATDEGDGSICRDLVGSKDPMAIRKATKYKVTVFTGNKKGAGTDANVSIILFGEFGDSGEKKLSSRKNNFERNKVDEFLLECPKLGRLERIRIGHDDTGFGPGWFLDKVIVDDVAVSKVYEFPCQRWLASDEDDGQISRELILNSGPNDAAQGFPYVITVVTGDKVSAGTDARVWIVLHGGKNGN------ESSGKIWLDSGKFERNKTDLFNVSIARMLSPLSRIDIGHDNKGAASGWFLDSVTIYCPMSGIEQFFPCGKWLAID----EGERVISRTLYEQEARRKKKQKKNNWTVWVYTSDTRNAGTDSNVFICLYGDKGKSDDIQLEG-------------------------KGDSFESGSKDIFNIN---ITDVVSKERYKFYCDKWLANDEGDQQIVREMPAEGPGIKKPLPLEKYKIEVHTGKCKYAGTDANVFVNIFGERGDTGNRFLRHSDSNINKFEKGDVDECEIEAVSLSKLKKIRVGHDGKGPGSGWFLDKIVVKQIGNPKYDTTFECNRWLAEDEDDGAIEREITASGSQMLSTTSYHVQVKTGDVRGAGTDANVSLKIFGTNGDTGSIQLRQSDSAANKFERNRTDTFKLEATDIGKIKRIKIGHDGTKPGAGWFLDNIIIDVPSKGKHYEFACHRWLAKDEEDGLIELELEPSVSEARDKNIPYEVTIWTSDISSAGTDANVFIQMYGENGKTDEQFMQNKSDEFERGKCDKFKIEAADVGRLHKLRIGHDGAGRFAGWHCEKVGPNFIFQRPVPGTKKRRRRPLQKQKSRYLDRDEYDSDSTSPSTSPHRRQLRRKGTKSNLESVREEEEVYDGEETEDYWFFVDRWFAKNEDDGAIVRELIPTDEKGRPLDDSLQE--YTVKICTGDVWGAGTDANVFVNLFGDKGDSGERQMKDS--NNANKFETNKEDIFTIRAIELGKLVKLKVRHDNKGGGAAWFLDRIEVIDEKNKKSYFFPCQRWLAVKEDDGQISRELVPVDQSLKKKLTRKDSKSVYNEIALEQKAAMTTYNVMVETGKKFGAGTDANVYIILFGEQDTTGKIFLKSSLTNKNKFEKGQKDEFVIEAVQIGELKKIRIGHDNAGGGGAWFLENVGIDAPSLGRKWIFPCGRWLSDKDDDGKLERELYPQELATEEYNPCIPYEITAYTSEKSGASTDADVYIVLYGKDTCTEQKSLCPTKRERKEHFNKGNVDKFIVELEDVGESIEKIRIGHDGTGLGSGWHLDKIEVRKLHETGKGSITYTFPCKRWLARNEEDGAIERELLPDKVVKE-VIGKNGEVKAKEVKIKDKLKAKTYTVNVITGDKSGCGTDANVFITVFGDRGDTGERKLHQSETHRDKFERKQTDVFKLEAVDLGKVYKIKIRHDNS-LLNPSWFLDRIEVLDPEDNETFIFHCERWLAKNKDDGKIERTLYV-------KMSSTGTLRSTKIGSVSSLDSIRTNDPFSKSPRLNRKQLSSSLEDVPEGGPSISYTVKVYTGTGEDNGTDSNAWITIYGPRKKSTGRQYLDLAQKSGFEPGSLEVFSLEAVDIDEIKKIEIGHDGTKPGTGWFIKEMEVDMPTKGKHYHFSCNQWLARDKGDGKTSRIFSVSDGQSSVVSYKPSNYELTVYTGDVSDAGTDSKITMTIFGSRGSTSPIELDKNQDRFERAKVDFMKMDLEDIGDVKKMRLSLDGKGSRPTWFLEKVELRNMETGSLSVFHLKDWLSKDSMLSRDIPATERGKLVVHKTSYKVKVKTSDLRGAGTDANVYIVMFGTNGDSGDIHLKKPEGGRSPFDNNQLDEFILNDILSVGELSKVRVWHDNKGFGSAWHLSYIEIEDLRSKKVYMFHCDKWLSTSEDDKQIIRELTCSNAAKP-------AAYDIEITTTDKKEGGTIHNGWIVLEGLKRKSNIFLLENSPQR-KILRRGQTDHIKKESLALGKIKTCILGAVEREDQPITDDSGRAAQWHCHDVTITDTSTGDKYKFPCNQWIPICTKISKHDAVVLKLKDVEE----GLVPVVRNLAPIKYEVIVYTGDEKGCGTNANVSITLFGANGDTGSRPLKQRFRDLFERNQIDKFQIEALDLGEMTKIRIEHDNSGFRPGWFLDKVEVINMATNVTSLFPCNKWFDKDKG 2181          

HSP 2 Score: 469.159 bits (1206), Expect = 6.338e-130
Identity = 389/1376 (28.27%), Postives = 619/1376 (44.99%), Query Frame = 1
Query:  859 WLFTCNHWLSLYKEDGKVSRELFA-------FKSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLF-KENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREI-------------RGAKEIMG------IASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIK----NKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEG-LEKIL-PVKKLPERYQK-YKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDI-VIFCPQTG---IEQSFICGNWLSPSRPGCQTEVSLVED------------LSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADS----KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHED------------------------------------------------FSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYG-EKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLLGKVT------YEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLDSKT-LEYDLDPSKIDK--IDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKS---DTFERGNEDVFKIN-AADVGVIQKIRIGHDGKKPGSGWFLDKVLXXXXXXXXXXXXXXXXXXXXXNAYXXXXXXXXXXXXXXXIKRSPSFKSLSQISEQEEANIDRYWFICNRWLASDEDDNMIVRELLPTDEKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSV------NKFEEKSLDKFLIKAIDLGTLEK-IKIRHDNSNGGAAWYLDYVLVNDES--DEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQ 4611
            W F  + W +  ++DG + REL               +Y + + TGD+  +GTD+ VF++L G  G S + Q+    N   F+  +   F I A  +G + K+++R D  G  ++W+LDR+ + D KN +  YFF C+ WL+    D    RE+             + +K +         A+ T Y +   T  K GAG+ A++YI +FGE   +  I +K    NK+ F++G   E  +   Q+G LKKI++G+ N G    WFL  V I+     R + FPCG+WLSD   +G LE+ L P +   E Y     YE+   T  ++ AST +  Y++L G   KD   ++             F +G  D   VEL +    + +I  G +  G    W LD I V    +TG   I  +F C  WL+ +      E  L+ D            +  +++K        T+ V++ T D     T++ V + ++GD G T +  +        K +      F+ E   +G  YK++ +HDNS  N SW L++I +    + + + F C RWL+ + +D                                                 S++ ++P  GP I        Y V++YTG     GTD+N +I IYG  K  TG ++L       + FE G ++ F +EAV +  I KI++GHD    G+GWF+ ++ + +         F CN W    +GDG T R  + +     V       YE+ V TG V  AGTDS + + IFG  G T  ++L     N+++FE    D  K++ EDIG++K +R+S D  G+   WF++++ +   + G   +F L  WL   + L  D+  ++  K  + KT  Y++ V T D+  AGTD+ V+I ++G +  +  + LK        F+    D F +N    VG + K+R+ HD K  GS W                                                      LS I  ++  +   Y F C++WL++ EDD  I+REL  ++         K   Y +++ T ++   GT  N ++ + G    S    L+N+    +      +  +++SL    IK   LG +E+  +   D+S   A W+   V + D S  D+Y FPC  W+        +SK     + A+    KD  +++    + +      + V VYT  +   GT+ANV I L+G   D+G  PLKQ     + FE    D+FQ++  DLGE+ KIRI HDNSG    W L KVE+       + +FPCN+W  K K DG + R+L+P+
Sbjct:  908 WFFV-DRWFAKNEDDGAIVRELIPTDEKGRPLDDSLQEYTVKICTGDVWGAGTDANVFVNLFGDKGDSGERQMKDSNNANKFETNKEDIFTIRAIELGKLVKLKVRHDNKGGGAAWFLDRIEVIDEKNKK-SYFFPCQRWLAVKEDDGQISRELVPVDQSLKKKLTRKDSKSVYNEIALEQKAAMTTYNVMVETGKKFGAGTDANVYIILFGEQDTTGKIFLKSSLTNKNKFEKGQKDEFVIEAVQIGELKKIRIGHDNAGGGGAWFLENVGIDAPSLGRKWIFPCGRWLSDKDDDGKLERELYPQELATEEYNPCIPYEITAYTSEKSGASTDADVYIVLYG---KDTCTEQKSLCPTKRERKEHFNKGNVDKFIVELEDVGESIEKIRIGHDGTGLGSGWHLDKIEVRKLHETGKGSITYTFPCKRWLARNEEDGAIERELLPDKVVKEVIGKNGEVKAKEVKIKDKLKAKTYTVNVITGDKSGCGTDANVFITVFGDRGDTGERKLHQSETHRDKFERKQTDVFKLEAVDLGKVYKIKIRHDNSLLNPSWFLDRIEVLDPEDNETFIFHCERWLAKNKDDGKIERTLYVKMSSTGTLRSTKIGSVSSLDSIRTNDPFSKSPRLNRKQLSSSLEDVPEGGPSI-------SYTVKVYTGTGEDNGTDSNAWITIYGPRKKSTGRQYL--DLAQKSGFEPGSLEVFSLEAVDIDEIKKIEIGHDGTKPGTGWFIKEMEV-DMPTKGKHYHFSCNQWLARDKGDGKTSRIFSVSDGQSSVVSYKPSNYELTVYTGDVSDAGTDSKITMTIFGSRGSTSPIELDK---NQDRFERAKVDFMKMDLEDIGDVKKMRLSLDGKGSRPTWFLEKVELRNMETGSLSVFHLKDWLSKDSMLSRDIPATERGKLVVHKT-SYKVKVKTSDLRGAGTDANVYIVMFGTNGDSGDIHLKKPEGGRSPFDNNQLDEFILNDILSVGELSKVRVWHDNKGFGSAWH-----------------------------------------------------LSYIEIEDLRSKKVYMFHCDKWLSTSEDDKQIIRELTCSNA-------AKPAAYDIEITTTDKKEGGTIHNGWIVLEGLKRKSNIFLLENSPQRKILRRGQTDHIKKESLALGKIKTCILGAVEREDQPITDDSGRAAQWHCHDVTITDTSTGDKYKFPCNQWIPICT---KISK-----HDAVVLKLKD--VEEGLVPVVRNLAPIKYEVIVYTGDEKGCGTNANVSITLFGANGDTGSRPLKQRF--RDLFERNQIDKFQIEALDLGEMTKIRIEHDNSGFRPGWFLDKVEVINMATNVTSLFPCNKWFDKDKGDGEICRDLFPK 2192          

HSP 3 Score: 386.726 bits (992), Expect = 3.060e-104
Identity = 303/1094 (27.70%), Postives = 510/1094 (46.62%), Query Frame = 1
Query: 3688 NIDRYW-FICNRWLASDEDDNMIVRELLPTD---EKGNPLSNLKELKYMVDVKTGNEFGSGTDANVFLTIFGKNGDSGERALKNTVDNSVNKFEEKSLDKFLIKAIDLG-TLEKIKIRHDNSNGGAAWYLDYVLV------NDESDEYLFPCFSWLATNKDGGHLSKDIFPANPAMYKDWKDNKLDKSQFKIYQEDKLENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQSFVFPCNEWISKSKVDGNLERELYPQLSLTMTKR-----------------------------------------PKIKYEITTVTSNRKGAGTNANVYIQVYG-RNDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTG--GETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLE---TNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPLDKNEDN--FERGHRDHFKLEMEDVGKIKKIRIQ---------NDGNGDRPHWFLEKLDITNESTNESYQFEYNEFL------SKN---VGQKKKLAIDLAPI-NDIKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELI 6732
            ++ R W F C RWL+  +DD  + REL P +   E+ NP      + Y +   T  + G+ TDA+V++ ++GK+  + +++L  T       F + ++DKF+++  D+G ++EKI+I HD +  G+ W+LD + V         S  Y FPC  WLA N++ G + +++ P         K+ ++   + KI  + K + + V V T  K   GTDANV I ++G+  D+G   L QS TH +KFE    D F+++  DLG++ KI+I HDNS  N  W L ++E+   +  ++F+F C  W++K+K DG +ER LY ++S T T R                                         P I Y +   T   +  GT++N +I +YG R   T +  L+ A  KS  + G  +VF +   D+D+ I+KI IGHD    G+ W ++++ V      K+    Y F CN+WLARD+ DG   R                  S+    S     +   Y + VYTG   + GT++ + + ++G  G +   +L     + D+FE+  +D  + +  D+G V K+ +  D  G  +  WFL+K+E+ +       +FH + WLSK                        S  SR I +     L   K                       +Y + + T   +  G+    ++ ++G  N  +  I L+K E   + +      E I  +   V  + +V + ++     S+W+L+ I IE     K+Y   C  WLS    +++      I++   +N +K   Y I + T D  +GGT    ++ L G +  S+++ L+ +       RG  DH K E   +GKIK   +           D +G    W    + IT+ ST + Y+F  N+++      SK+   V + K +   L P+  ++    Y+VIV T + K  GT++ V++  +G  GD+G   LK  ++    F+ NQ+D+F   + L LG++++ ++ H+NSGF   W L+ +E+  + T  +  FPCNKW      D +I R+L 
Sbjct: 1182 SLGRKWIFPCGRWLSDKDDDGKLERELYPQELATEEYNPC-----IPYEITAYTSEKSGASTDADVYIVLYGKDTCTEQKSLCPTKRERKEHFNKGNVDKFIVELEDVGESIEKIRIGHDGTGLGSGWHLDKIEVRKLHETGKGSITYTFPCKRWLARNEEDGAIERELLPDKVVKEVIGKNGEVKAKEVKIKDKLKAKTYTVNVITGDKSGCGTDANVFITVFGDRGDTGERKLHQSETHRDKFERKQTDVFKLEAVDLGKVYKIKIRHDNSLLNPSWFLDRIEVLDPEDNETFIFHCERWLAKNKDDGKIERTLYVKMSSTGTLRSTKIGSVSSLDSIRTNDPFSKSPRLNRKQLSSSLEDVPEGGPSISYTVKVYTGTGEDNGTDSNAWITIYGPRKKSTGRQYLDLAQ-KSGFEPGSLEVFSLEAVDIDE-IKKIEIGHDGTKPGTGWFIKEMEVDMPTKGKH----YHFSCNQWLARDKGDGKTSRIF----------------SVSDGQSSVVSYKPSNYELTVYTGDVSDAGTDSKITMTIFGSRGSTSPIEL---DKNQDRFERAKVDFMKMDLEDIGDVKKMRLSLDGKGS-RPTWFLEKVELRNMETGSLSVFHLKDWLSKD-----------------------SMLSRDIPATERGKLVVHK----------------------TSYKVKVKTSDLRGAGTDANVYIVMFGT-NGDSGDIHLKKPEGGRSPFDNNQLDEFILNDILSVGELSKVRVWHDNKGFGSAWHLSYIEIEDLRSKKVYMFHCDKWLSTSEDDKQI-----IRELTCSNAAKPAAYDIEITTTDKKEGGTIHNGWIVLEGLKRKSNIFLLENSPQRKILRRGQTDHIKKESLALGKIKTCILGAVEREDQPITDDSGRAAQWHCHDVTITDTSTGDKYKFPCNQWIPICTKISKHDAVVLKLKDVEEGLVPVVRNLAPIKYEVIVYTGDEKGCGTNANVSITLFGANGDTGSRPLK--QRFRDLFERNQIDKFQI-EALDLGEMTKIRIEHDNSGFRPGWFLDKVEVINMATNVTSLFPCNKWFDKDKGDGEICRDLF 2190          

HSP 4 Score: 324.324 bits (830), Expect = 4.823e-85
Identity = 258/896 (28.79%), Postives = 415/896 (46.32%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRI-WLFTCNHWLSLYKEDGKVSRELFAFK---SVR--TKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIF-GENGESDVIDIKNKDGFKEGS---IFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERYQKY---KYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI-PADS---KLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGD-EYQFLCNRWLSDSHEDFSTVREIPATGPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGTTLLGK---VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNK-NKFEFGATDLFKIEAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIF 3183
            Y++   T D    GT+  ++ ++ G      R  LK  +K            G+T  F    + +G ++ I IEHD       W L+ V + +++N    + F C  WL+  + DG + R+L   K   ++R  TKY++ V TG+   +GTD+ V I L G  G S + +L       F+R +  +F++    +G + +IRI  D++G    W+LD+V + D+   +  Y F C+ WL+ D  D    RE+         A    Y I+  T +K  AG+ A ++I +  G+NG      I    G  E +   +F  ++  R L  L +I +G+ N G    WFL+ V I          FPCG+WL+  +GE +      ++   R +K     + + + T +  +A T S  ++ L G + K    D I+   K       F+ G  D+  + + + +S                                   F C  WL+      + +  +V ++               + + ++T   K A T++ V + ++G+ G T +  +  +DS   K + G V E   E   +    K+R  HD  G  S W L+KI++ Q  N   +  F CNRWL++  +D +  REI A+G  ++       Y VQ+ TG+   AGTDANV + I+G  GDTG   L  S +  NKFE+ + D F +EA  +G I +IK+GHD    G+GWF+D +II +  +      F C+ W    E DGL   EL  +    +   + YEV + T  +  AGTD+NVFI+++G+ G T     +  M NK ++FE G  D FKIEA D+G +  +RI HD  G  + W  +       K+G  +IF
Sbjct:    7 YEILTVTGDRSNGGTNANVFCTLFGKSGITKRFHLKSTEKGL-------FERGTTDSFRFPSNCVGPMKKIRIEHDNTGIGAGWYLERVVVTDLKNPHWKYFFPCGQWLATDEGDGSICRDLVGSKDPMAIRKATKYKVTVFTGNKKGAGTDANVSIILFGEFGDSGEKKLSSRKNN-FERNKVDEFLLECPKLGRLERIRIGHDDTGFGPGWFLDKVIVDDVAVSK-VYEFPCQRWLASDEDDGQISRELILNSGPNDAAQGFPYVITVVTGDKVSAGTDARVWIVLHGGKNGNESSGKIWLDSGKFERNKTDLFNVSIA-RMLSPLSRIDIGHDNKGAASGWFLDSVTIYCPMSGIEQFFPCGKWLAIDEGERVISRTLYEQEARRKKKQKKNNWTVWVYTSDTRNAGTDSNVFICLYGDKGKS---DDIQLEGK----GDSFESGSKDIFNINITDVVSKE------------------------------RYKFYCDKWLAND----EGDQQIVREMPAEGPGIKKPLPLEKYKIEVHTGKCKYAGTDANVFVNIFGERGDTGNRFLRHSDSNINKFEKGDVDECEIEAVSLSKLKKIRVGHDGKGPGSGWFLDKIVVKQIGNPKYDTTFECNRWLAEDEDDGAIEREITASGSQMLSTT---SYHVQVKTGDVRGAGTDANVSLKIFGTNGDTGSIQLRQSDSAANKFERNRTDTFKLEATDIGKIKRIKIGHDGTKPGAGWFLDNIII-DVPSKGKHYEFACHRWLAKDEEDGLIELELEPSVSEARDKNIPYEVTIWTSDISSAGTDANVFIQMYGENGKTD----EQFMQNKSDEFERGKCDKFKIEAADVGRLHKLRIGHDGAGRFAGWHCE-------KVGPNFIF 836          

HSP 5 Score: 322.013 bits (824), Expect = 2.654e-84
Identity = 276/1082 (25.51%), Postives = 496/1082 (45.84%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAF------------------------KSVRTKYEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKE--NTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR-----TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-----KNKDGFKEGSIFEHTLPLRQLG-TLKKIKVGNKNNGPQPRWFLNKVIINDLDQ----SRVFEFPCGQWLSDVKGEGL--EKILPVK-----------------KLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLS--------------------------------KRKLKTVI-DFTEN----TWMVSIYTSDIKNASTNSKVILVLYGDNGKTDD---IVIPADSKLDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLSDSHEDFSTVREIPAT-GPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVRELTGT----TLLGKVTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKI-EAEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWL----DSKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKS--KSDTFERGNEDVFKINAADVGVIQKIRIG 3465
            Y V + T DV GAGT   +++++ GDK +    ++K    +NK             IF IR  +LG L  + + HD      +W L  +E+++ +NK+ + F C  WL++ ++DG++SREL                           K+  T Y ++V TG    +GTD+ V+I L G    + +I L     N   F++GQ  +FVI A  +G + KIRI  D +G   +W+L+ V I D  +   ++ F C  WLS    D    RE+   +    +A+        Y+I+ YT  K GA + AD+YI ++G++  ++   +     + K+ F +G++ +  + L  +G +++KI++G+   G    W L+K+ +  L +    S  + FPC +WL+  + +G    ++LP K                 K+ ++ +   Y + + TG+++   T +  ++ + G   +  ++ L + E+         KF+   TDV  +E  + L  + +I    +    N  WFLD I +  P+      F C  WL+ ++   + E +L   +S                                +++L + + D  E     ++ V +YT   ++  T+S   + +YG   K+     + +   S  + GS+  F  E   +    K+   HD +   + W ++++ +     G  Y F CN+WL+    D  T R    + G   V       Y++ +YTG+   AGTD+ + + I+G +G T    L     N ++FE+ ++D   ++   +G + K++L  D K +   WF++KV +   +  S SV F    W      D +  R++  T     ++ K +Y+V+VKT  ++GAGTD+NV+I +FG  GD+G++ LK     ++ F+    D F + +   +GE+  +R+ HD+ G GSAW +  I +   +    Y+F  +KWL    D K +  +L  S      K   Y I + T D    GT    +I + G  +K++   L++  +     RG  D  K  +  +G I+   +G
Sbjct:  945 YTVKICTGDVWGAGTDANVFVNLFGDKGDSGERQMKDSNNANK------FETNKEDIFTIRAIELGKLVKLKVRHDNKGGGAAWFLDRIEVIDEKNKKSYFFPCQRWLAVKEDDGQISRELVPVDQSLKKKLTRKDSKSVYNEIALEQKAAMTTYNVMVETGKKFGAGTDANVYIILFGEQDTTGKIFLKSSLTNKNKFEKGQKDEFVIEAVQIGELKKIRIGHDNAGGGGAWFLENVGI-DAPSLGRKWIFPCGRWLSDKDDDGKLERELYPQE----LATEEYNPCIPYEITAYTSEKSGASTDADVYIVLYGKDTCTEQKSLCPTKRERKEHFNKGNVDKFIVELEDVGESIEKIRIGHDGTGLGSGWHLDKIEVRKLHETGKGSITYTFPCKRWLARNEEDGAIERELLPDKVVKEVIGKNGEVKAKEVKIKDKLKAKTYTVNVITGDKSGCGTDANVFITVFGDRGDTGERKLHQSET------HRDKFERKQTDVFKLEAVD-LGKVYKIKIRHDNSLLNPSWFLDRIEVLDPEDNETFIFHCERWLAKNKDDGKIERTLYVKMSSTGTLRSTKIGSVSSLDSIRTNDPFSKSPRLNRKQLSSSLEDVPEGGPSISYTVKVYTGTGEDNGTDSNAWITIYGPRKKSTGRQYLDLAQKSGFEPGSLEVFSLEAVDIDEIKKIEIGHDGTKPGTGWFIKEMEVDMPTKGKHYHFSCNQWLARDKGDGKTSRIFSVSDGQSSVVSYKPSNYELTVYTGDVSDAGTDSKITMTIFGSRGSTSPIELDK---NQDRFERAKVDFMKMDLEDIGDVKKMRLSLDGKGSRPTWFLEKVELRNMETGSLSV-FHLKDWLSK---DSMLSRDIPATERGKLVVHKTSYKVKVKTSDLRGAGTDANVYIVMFGTNGDSGDIHLKKPEGGRSPFDNNQLDEFILNDILSVGELSKVRVWHDNKGFGSAWHLSYIEIEDLRSKKVYMFHCDKWLSTSEDDKQIIRELTCS---NAAKPAAYDIEITTTDKKEGGTIHNGWIVLEGLKRKSNIFLLENSPQRKILRRGQTDHIKKESLALGKIKTCILG 1998          

HSP 6 Score: 306.22 bits (783), Expect = 1.568e-79
Identity = 256/971 (26.36%), Postives = 452/971 (46.55%), Query Frame = 1
Query: 4873 GSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGG--ETGTNANVFLKVYGENGDSGERQLVDSKTHTDKFEKNNMDEFEWEAVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLYIAGYQGERSNAPSGRSRSIYSGSANSLDSQKDGSHGGTFAFETDENDTAQTEYIAYTITIVTGPEKDMGSSGPFWMRLYGPKNLKTNIIRLQKLET-NYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVTCGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQG---NSSLYPLDK-NEDNFERGHRDHFKLEMEDVGK-IKKIRIQNDGNGDRPHWFLEKLDIT--NESTNES--YQFEYNEFLSKN-------------------VGQKKKLAIDLAPIND-IKKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQNNKPFKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYIEMKEVKTRRSWKFPCNKWLSMTDDDRQIFRELICENAPNPTKTSRN---------------------------------------ETSYEVTVITGDKKNAGMPHDVWFVFYG--EKNYSDKFIMENNVDKEKLFSRSSEDKRKVTCVYLGELKNIKLGAVVNKNELYSDSKKWFCNEVHVKNLATLKTYVFKIQSWIEVHEKIREADGEIFDISNIVEDPNKARVEELKKKGVVKYEILVVTGKGNGCGTDANVFITLFGENSESGKRPL-VQKGRNLFEQGQEDKFILECVDLGKIEKIKIEHDDSRFRSDWFLDRVQVQNLSTNKIWKYPCNEWLSKSKGLWKILTPSE 7563
            G+  +LE V  +  + +  ++  Y F  +RW A++E+DGAI REL+P         +  G  +D  DS+      + YT+++ TG     GT+ANVF+ ++G+ GDSGERQ+ DS  + +KFE N  D F   A++LGK+ K+ +RHDN G     WFL +IE+ID+ + ++Y F C+RWL+  +DD +I R L +   Q  +       S+S+Y+  A                    E   A T    Y + + TG +   G+    ++ L+G ++    I     L   N F  G K+   +EA  +  +K++ I ++      +W+L ++ I+ P+ G+ +   CG WLS    + K  R    Q+      +  I Y I+  T +     T++ +++ L+G        SL P  +  +++F +G+ D F +E+EDVG+ I+KIRI +DG G    W L+K+++   +E+   S  Y F    +L++N                   +G+  ++      I D +K   Y V V T +    GT + V +  +G+ GD+G+ +L   E +   F+  Q D F   + + LG + + ++ H+NS  +  W L+ IE+ + +   ++ F C +WL+   DD +I R L  + +   T  S                                           SY V V TG  ++ G   + W   YG  +K+   +++   ++ ++  F   S +   +  V + E+K I++G     ++       WF  E+ V      K Y F    W+   +K       IF +S+      ++ V   K      YE+ V TG  +  GTD+ + +T+FG  S     P+ + K ++ FE+ + D   ++  D+G ++K+++  D    R  WFL++V+++N+ T  +  +   +WLSK   L + +  +E
Sbjct:  884 GTKSNLESVREEEEVYDGEETEDYWFFVDRWFAKNEDDGAIVRELIP--------TDEKGRPLD--DSL------QEYTVKICTGDVWGAGTDANVFVNLFGDKGDSGERQMKDS-NNANKFETNKEDIFTIRAIELGKLVKLKVRHDNKGGGAA-WFLDRIEVIDEKNKKSYFFPCQRWLAVKEDDGQISREL-VPVDQSLKKKLTRKDSKSVYNEIAL-------------------EQKAAMT---TYNVMVETGKKFGAGTDANVYIILFGEQDTTGKIFLKSSLTNKNKFEKGQKDEFVIEAVQIGELKKIRIGHDNAGGGGAWFLENVGIDAPSLGRKWIFPCGRWLSDKDDDGKLERELYPQELATEEYNPCIPYEITAYTSEKSGASTDADVYIVLYGKDTCTEQKSLCPTKRERKEHFNKGNVDKFIVELEDVGESIEKIRIGHDGTGLGSGWHLDKIEVRKLHETGKGSITYTFPCKRWLARNEEDGAIERELLPDKVVKEVIGKNGEVKAKEVKIKDKLKAKTYTVNVITGDKSGCGTDANVFITVFGDRGDTGERKLHQSETHRDKFERKQTDVFKL-EAVDLGKVYKIKIRHDNSLLNPSWFLDRIEVLDPEDNETFIFHCERWLAKNKDDGKIERTLYVKMSSTGTLRSTKIGSVSSLDSIRTNDPFSKSPRLNRKQLSSSLEDVPEGGPSISYTVKVYTGTGEDNGTDSNAWITIYGPRKKSTGRQYL---DLAQKSGFEPGSLEVFSLEAVDIDEIKKIEIG-----HDGTKPGTGWFIKEMEVDMPTKGKHYHFSCNQWL-ARDKGDGKTSRIFSVSD-----GQSSVVSYKPS---NYELTVYTGDVSDAGTDSKITMTIFG--SRGSTSPIELDKNQDRFERAKVDFMKMDLEDIGDVKKMRLSLDGKGSRPTWFLEKVELRNMETGSLSVFHLKDWLSKDSMLSRDIPATE 1793          

HSP 7 Score: 290.812 bits (743), Expect = 8.398e-75
Identity = 256/874 (29.29%), Postives = 403/874 (46.11%), Query Frame = 1
Query: 4246 LENFNVKVYTTKKMYAGTDANVHIILYGETNDSGIIPLKQSLTHSNKFESGNCDEFQVKCCDLGELKKIRIGHDNSGPNADWHLAKVEIEAEKLGQ-SFVFPCNEWISKSKVDGNLERELYPQLSLTMTKRPKIKYEITTVTSNRKGAGTNANVYIQVYGR-NDCTEKTNLNNASDKSKLQTGCTDVFYVSMEDVDDPIEKIRIGHDNKGLGSAWHLEKVLVKRLLANKNKSIAYEFPCNRWLARDEEDGAIERELLPDKVIRRGSMNALGESIDQVDSVANILQKKAYTIRVYTGGE--TGTNANVFLKVY-GENGDSGERQL-VDSKTHTDKFEKNNMDEFEWE-AVDLGKVFKIDIRHDNSGFFKKDWFLKKIEIIDKFDNETYLFHCERWLSKSKDDKKIQRTLY----------------IAGYQGERSNAPSGRSRSI--YSGSANSLDSQKDG-----SHGGTFAFETDENDTAQTE-YIAYTITIVTGPEKD------MGSSGP----------------------------FWMRLYGPKNLKTN-IIRLQKLETNYFAPGSKEVISVEAPDVENIKQVEICNEGVDRESSWYLNSISIEMPTKGKLYNVT--CGVWLSKFMGERKTSRIFSIQDKMMTNVSKKITYLISVITGDVDQGGTNSTLFLQLFGTQGNSSLYPL---DKNEDNFERGHRDHFKLEMEDVGKIKKIRIQNDGNGDRPHWFLEKLDITNESTNESYQFEYNEFLSKNVGQKKKLAIDLAP-INDI--KKTDYKVIVKTSNVKSAGTSSAVTVKFYGEFGDSGDLELKTPEQ--NNKP--FKINQLDEFIFPDMLSLGDLSRCQVWHNNSGFSSRWHLEYI 6633
            L  + +   T  +   GT+ANV   L+G++  +    LK   T    FE G  D F+     +G +KKIRI HDN+G  A W+L +V +   K     + FPC +W++  + DG++ R+L       M  R   KY++T  T N+KGAGT+ANV I ++G   D  EK     +S K+  +    D F +    +   +E+IRIGHD+ G G  W L+KV+V  +  +K     YEFPC RWLA DE+DG I REL    ++  G  +A               Q   Y I V TG +   GT+A V++ ++ G+NG+    ++ +DS     KFE+N  D F    A  L  + +IDI HDN G     WFL  + I          F C +WL+  + ++ I RTLY                +  Y  +  NA +  +  I  Y     S D Q +G       G    F  +  D    E Y  Y    +   E D      M + GP                             ++ ++G +    N  +R      N F  G  +   +EA  +  +K++ + ++G    S W+L+ I ++     K Y+ T  C  WL++   +    R  +     M + +   +Y + V TGDV   GT++ + L++FGT G++    L   D   + FER   D FKLE  D+GKIK+I+I +DG      WFL+ + I   S  + Y+F  + +L+K+  +   + ++L P +++   K   Y+V + TS++ SAGT + V ++ YGE G       KT EQ   NK   F+  + D+F   +   +G L + ++ H+ +G  + WH E +
Sbjct:    4 LSEYEILTVTGDRSNGGTNANVFCTLFGKSGITKRFHLKS--TEKGLFERGTTDSFRFPSNCVGPMKKIRIEHDNTGIGAGWYLERVVVTDLKNPHWKYFFPCGQWLATDEGDGSICRDLVGSKD-PMAIRKATKYKVTVFTGNKKGAGTDANVSIILFGEFGDSGEK---KLSSRKNNFERNKVDEFLLECPKL-GRLERIRIGHDDTGFGPGWFLDKVIVDDVAVSK----VYEFPCQRWLASDEDDGQISREL----ILNSGPNDA--------------AQGFPYVITVVTGDKVSAGTDARVWIVLHGGKNGNESSGKIWLDS----GKFERNKTDLFNVSIARMLSPLSRIDIGHDNKG-AASGWFLDSVTIYCPMSGIEQFFPCGKWLAIDEGERVISRTLYEQEARRKKKQKKNNWTVWVYTSDTRNAGTDSNVFICLYGDKGKSDDIQLEGKGDSFESGSKDIFNINITDVVSKERYKFYCDKWLANDEGDQQIVREMPAEGPGIKKPLPLEKYKIEVHTGKCKYAGTDANVFVNIFGERGDTGNRFLRHSDSNINKFEKGDVDECEIEAVSLSKLKKIRVGHDGKGPGSGWFLDKIVVKQIGNPK-YDTTFECNRWLAEDEDDGAIEREITASGSQMLSTT---SYHVQVKTGDVRGAGTDANVSLKIFGTNGDTGSIQLRQSDSAANKFERNRTDTFKLEATDIGKIKRIKIGHDGTKPGAGWFLDNIIIDVPSKGKHYEFACHRWLAKDE-EDGLIELELEPSVSEARDKNIPYEVTIWTSDISSAGTDANVFIQMYGENG-------KTDEQFMQNKSDEFERGKCDKFKI-EAADVGRLHKLRIGHDGAGRFAGWHCEKV 830          

HSP 8 Score: 257.299 bits (656), Expect = 1.445e-64
Identity = 225/844 (26.66%), Postives = 371/844 (43.96%), Query Frame = 1
Query:  562 YKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELF------------------AFKSVRT-----------------------------KYEIVVITGDLDDSGTDSKVFISLCG-RTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASR--TRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDI-KNKDGFKEGSIFEHTLPLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERY-QKYKYEMKISTGNRAHASTTSRAYVILKGP--EIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAGINVGGKNQDWFLDDIVIFCPQTGIEQSFICGNWLSPSRPGCQTEVSLVEDLSKRKLKTVIDFTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVI---PADSKLDSGSVVEFRTELAIVG---------IPYKLRAQHDNSGTNSSWNLEKILMTQAVNGDEYQFLCNRWLS-----DSHEDFSTVREIPATGPGIVKP----APICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVT--FRCNCWFDSSEGDGLTVREL 2862
            Y V V T D  G GT   ++I++ GD+ +    +L + +    K          T +F +   DLG +  I I HD      SW L  +E+++ E+   ++F C  WL+  K+DGK+ R L+                  +  S+RT                              Y + V TG  +D+GTDS  +I++ G R   + +  L       F+ G    F + A  +  I KI I  D +   + W++  + + D+      Y F C  WL++D GD  T R    +     + S   + Y+++ YT +   AG+ + I + IFG  G +  I++ KN+D F+   +    + L  +G +KK+++     G +P WFL KV + +++   +  F    WLS  K   L + +P  +  +    K  Y++K+ T +   A T +  Y+++ G   +  D  L K E     +  N   +    D++ V        L+++    +  G    W L  I I   ++     F C  WLS S    Q           R+L          + + I T+D K   T     +VL G   K++  ++   P    L  G     + E   +G         +  + +   D+SG  + W+   + +T    GD+Y+F CN+W+        H+  + V ++     G+V      API KY+V +YTG++   GT+ANV I ++G  GDTG R L     +   FE+ Q+D+F IEA+ LG ++KI++ HD+     GWF+DKV   E  N + +VT  F CN WFD  +GDG   R+L
Sbjct: 1377 YTVNVITGDKSGCGTDANVFITVFGDRGDTGERKLHQSETHRDKFERK-----QTDVFKLEAVDLGKVYKIKIRHDNSLLNPSWFLDRIEVLDPEDNETFIFHCERWLAKNKDDGKIERTLYVKMSSTGTLRSTKIGSVSSLDSIRTNDPFSKSPRLNRKQLSSSLEDVPEGGPSISYTVKVYTGTGEDNGTDSNAWITIYGPRKKSTGRQYLDLAQKSGFEPGSLEVFSLEAVDIDEIKKIEIGHDGTKPGTGWFIKEMEV-DMPTKGKHYHFSCNQWLARDKGDGKTSRIFSVSDGQSSVVSYKPSNYELTVYTGDVSDAGTDSKITMTIFGSRGSTSPIELDKNQDRFERAKVDFMKMDLEDIGDVKKMRLSLDGKGSRPTWFLEKVELRNMETGSLSVFHLKDWLS--KDSMLSRDIPATERGKLVVHKTSYKVKVKTSDLRGAGTDANVYIVMFGTNGDSGDIHLKKPEGGRSPFDNNQLDEFILNDILSV------GELSKVRVWHDNKGFGSAWHLSYIEIEDLRSKKVYMFHCDKWLSTSEDDKQI---------IRELTCSNAAKPAAYDIEITTTDKKEGGTIHNGWIVLEGLKRKSNIFLLENSPQRKILRRGQTDHIKKESLALGKIKTCILGAVEREDQPITDDSGRAAQWHCHDVTITDTSTGDKYKFPCNQWIPICTKISKHD--AVVLKLKDVEEGLVPVVRNLAPI-KYEVIVYTGDEKGCGTNANVSITLFGANGDTGSRPLKQRFRDL--FERNQIDKFQIEALDLGEMTKIRIEHDNSGFRPGWFLDKV---EVINMATNVTSLFPCNKWFDKDKGDGEICRDL 2189          

HSP 9 Score: 253.832 bits (647), Expect = 1.487e-63
Identity = 167/458 (36.46%), Postives = 246/458 (53.71%), Query Frame = 1
Query: 2116 FTENTWMVSIYTSDIKNASTNSKVILVLYGDNGKTDDIVIPADSK--LDSGSVVEFRTELAIVGIPYKLRAQHDNSGTNSSWNLEKILMTQAVNGD-EYQFLCNRWLSDSHEDFSTVREIPAT-GPGIVKPAPICKYKVQIYTGNKMMAGTDANVFINIYGEKGDTGDRFLTHSTTNTNKFEKGQMDEFLIEAVKLGAISKIKLGHDSKLAGSGWFVDKVIIWEEQNPSNSVTFRCNCWFDSSEGDGLTVREL---TGTTLLGK-VTYEVEVKTGKVQGAGTDSNVFIRIFGQTGDTGNVQLKTSMTNKNKFEFGATDLFKIE-AEDIGEIKSIRISHDDTGAGSAWFVDQICVIVPKLGLKYIFFLNKWLD--------SKTLEYDLDPSKIDKIDKTIPYQITVFTGDVMHAGTDSKVFIQIYGKDKKTDQLPLKSKSDTFERGNEDVFKINAADV 3438
            FT + + +   T D  N  TN+ V   L+G +G T    + +  K   + G+   FR     VG   K+R +HDN+G  + W LE++++T   N   +Y F C +WL+    D S  R++  +  P  ++ A   KYKV ++TGNK  AGTDANV I ++GE GD+G++ L   ++  N FE+ ++DEFL+E  KLG + +I++GHD    G GWF+DKVI+ ++   S    F C  W  S E DG   REL   +G     +   Y + V TG    AGTD+ V+I + G  G  GN        +  KFE   TDLF +  A  +  +  I I HD+ GA S WF+D + +  P  G++  F   KWL         S+TL Y+ +  +  K  K   + + V+T D  +AGTDS VFI +YG   K+D + L+ K D+FE G++D+F IN  DV
Sbjct:    2 FTLSEYEILTVTGDRSNGGTNANVFCTLFGKSGITKRFHLKSTEKGLFERGTTDSFRFPSNCVGPMKKIRIEHDNTGIGAGWYLERVVVTDLKNPHWKYFFPCGQWLATDEGDGSICRDLVGSKDPMAIRKA--TKYKVTVFTGNKKGAGTDANVSIILFGEFGDSGEKKL---SSRKNNFERNKVDEFLLECPKLGRLERIRIGHDDTGFGPGWFLDKVIV-DDVAVSKVYEFPCQRWLASDEDDGQISRELILNSGPNDAAQGFPYVITVVTGDKVSAGTDARVWIVLHG--GKNGNESSGKIWLDSGKFERNKTDLFNVSIARMLSPLSRIDIGHDNKGAASGWFLDSVTIYCPMSGIEQFFPCGKWLAIDEGERVISRTL-YEQEARRKKKQKKN-NWTVWVYTSDTRNAGTDSNVFICLYGDKGKSDDIQLEGKGDSFESGSKDIFNINITDV 449          

HSP 10 Score: 227.639 bits (579), Expect = 1.528e-55
Identity = 178/667 (26.69%), Postives = 308/667 (46.18%), Query Frame = 1
Query:  556 ILYKVAVTTADVKGAGTSIPIYISIRGDKANLPRIRLXXXXXXXXXXXXXXLTPGSTQIFPIRCSDLGDLESILIEHDGLEPKDSWLLQGVEIMNVENKRIWLFTCNHWLSLYKEDGKVSRELFAFKSVRTK--------YEIVVITGDLDDSGTDSKVFISLCGRTGISPQIQLFKENTQCFQRGQTSKFVIPATCVGPISKIRIRQDESGSKSSWYLDRVCITDLKNPEWRYFFQCKNWLSKDHGDHATVREIRGAKEIMGIASRTRYKISFYTENKPGAGSHADIYIQIFGENGESDVIDIKNKDG----FKEGSIFEHTL-PLRQLGTLKKIKVGNKNNGPQPRWFLNKVIINDLDQSRVFEFPCGQWLSDVKGEGLEKILPVKKLPERYQKYKYEMKISTGNRAHASTTSRAYVILKGPEIKDKILDKIESTNKIWIENAKFKEGFTDVVPVELNEKLSPLTEIIAG---------INVGGKNQDWFLDDIVI