Cytochrome P450 2K1-like protein

Overview
NameCytochrome P450 2K1-like protein
Smed IDSMED30001471
Length (bp)2542
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome P450 2K1-like protein (SMED30001471) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome P450 2K1-like protein (SMED30001471) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome P450 2K1-like protein (SMED30001471) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome P450 2K1-like protein (SMED30001471) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2B6 (cytochrome P450 family 2 subfamily B member 6 [Source:HGNC Symbol;Acc:HGNC:2615])

HSP 1 Score: 214.157 bits (544), Expect = 2.864e-60
Identity = 127/398 (31.91%), Postives = 214/398 (53.77%), Query Frame = 2
Query:  245 KYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLT-SRRKLFSDIEKV---FEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
            KYG +F++  G R VV+L     I+++L ++ + FSGR +  +V       G++F +G+ W   R F +  +RDFG GK    E ++ E + ++EEL+  +  ++D        TANII   +  KRF   D +   +    +QT        ++  +F +L + F  S F  +   + R+++ +++++       +++H E LD  S   DLID +L+  ++  + +     F+ + L   T  LF AG ETTSTTL +  + M +YPH+ ++V+ EI + IG  + P ++DR  + YT+AV+ EI R S + P+G+ H     TS   + IPK++ +F        DP  + KP  F P+HF+ +  NG LK T  E  +PF +GKR C+GE +A+
Sbjct:   61 KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQT------FSLISSVFGQLFELF--SGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLD-PSAPKDLIDTYLLHMEK--EKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDA--NGALKKT--EAFIPFSLGKRICLGEGIAR 443          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2U1 (cytochrome P450 family 2 subfamily U member 1 [Source:HGNC Symbol;Acc:HGNC:20582])

HSP 1 Score: 211.075 bits (536), Expect = 1.444e-58
Identity = 135/417 (32.37%), Postives = 222/417 (53.24%), Query Frame = 2
Query:  209 GPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFID-GDHWHTQRTFVLKVLRDFGFGK-SRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWL--------TSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            GP  + L +L   YGSIFS   G   VVVL++F  ++++L ++ + FS R +  L++I++   G++F   G  W  QR F    LR FG GK S   +I+E E K++  E++   +     ++ I    +NII      +RF+ T+ + K +   +      S  L+I       L+   ++     WL           R++  DI    ++ I++H E+LD      D ID +L+  +   ++  N   F ++ L ++  +LF AG +TT+ +L W +++M+  P +Q+KV +EI   IG  + P + D+  + YT+A + E+ RL+ V PL I H T  +T +  + IPK +LI PN ++ H DP  W KP +F+P  F+   + G+L    +E  +PFGIGKR C+GE LAKM
Sbjct:  102 GP-QVLLAHLARVYGSIFSFFIGHYLVVVLSDFHSVREALVQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIE-EFKYVKAEMQKHGEDPFCPFSIISNAVSNIICSLCFGQRFDYTNSEFKKMLGFM------SRGLEIC------LNSQVLLVNICPWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLD-RENPQDFIDMYLLHMEEERKNNSNS-SFDEEYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLAIPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLD--DQGQL--IKKETFIPFGIGKRVCMGEQLAKM 498          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2J2 (cytochrome P450 family 2 subfamily J member 2 [Source:HGNC Symbol;Acc:HGNC:2634])

HSP 1 Score: 202.216 bits (513), Expect = 8.903e-56
Identity = 134/413 (32.45%), Postives = 205/413 (49.64%), Query Frame = 2
Query:  218 HIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAI-----EFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKV---FEEEIQEHLENLDFN-SEGNDLIDRFLIEKQRLVQSTGNQ-QGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
            H+ ++    KYG++FS++ G    V++    +IK++L     NF  R  T +   I    G++   G  W  QR F L  LR+FG GK    E ++ E + + E +K       D +  I    +NII      +RFE  D   + +     E    + +K   +  +   +   L                + LFS+ +K+       I +H +  D+N +E  D ID +L E   + + TGN    F ++ LI  T +LF AG ETTSTTL W++++MA YP IQ+KV  EI   IG  + P    R+S+ YT AV+ E+ R+ ++ PL +      DT++  + +PK ++I  N  A H DP  W  P  F P+HF+   ENG+ K   RE  +PF IGKR C+GE LA+
Sbjct:   65 HLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGP------------HQTLFSNWKKLKLFVSHMIDKHRK--DWNPAETRDFIDAYLKE---MSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFL---ENGQFKK--REAFMPFSIGKRACLGEQLAR 455          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2C18 (cytochrome P450 family 2 subfamily C member 18 [Source:HGNC Symbol;Acc:HGNC:2620])

HSP 1 Score: 201.06 bits (510), Expect = 1.330e-55
Identity = 130/404 (32.18%), Postives = 204/404 (50.50%), Query Frame = 2
Query:  227 LKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK--KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQG-FTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            L N    YG +F++ FG++ +VVL+ +  +K++L + G+ FSGR    +   ++   GILF +G  W   R F L  LR+FG GK    + V+ E + ++EEL+    +  D    +     N+I   I + RF+  D +   +     +  +   S  +Q+ +  FP L D    S   +      + F+ I+    E I+EH E+LD NS   D ID FLI   ++ Q   NQQ  FT + LI    ++FGAG ETTSTTL + ++ + +YP +  KV +EI   +G  + P M DR  + YT AV+ EI R   + P  + H    D    N+ IPK + I  +  +   + + +  P  F P HF+  + N    +   +  +PF  GKR C+GE LA+M
Sbjct:   54 LTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCN-NFPALIDYLPGSHNKI-----AENFAYIKSYVLERIKEHQESLDMNS-ARDFIDCFLI---KMEQEKHNQQSEFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGN----FKKSDYFMPFSAGKRMCMGEGLARM 443          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2C19 (cytochrome P450 family 2 subfamily C member 19 [Source:HGNC Symbol;Acc:HGNC:2621])

HSP 1 Score: 196.823 bits (499), Expect = 4.258e-54
Identity = 130/403 (32.26%), Postives = 208/403 (51.61%), Query Frame = 2
Query:  227 LKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK--KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            L NL   YG +F++ FG+  +VVL+ + ++K++L + G+ FSGR    L    +   GI+F +G  W   R F L  LR+FG GK    + V+ E + ++EEL+  + +  D    +     N+I   I  KRF+  D +   +   + +  +   +  +QI +  FP + D F   T    L +   + SDI     E+++EH E++D N+   D ID FLI+ ++  Q+   Q  FT + L+    +L GAG ETTSTTL ++++ + ++P +  KV +EI   IG  + P M DR  + YT AV+ E+ R   + P  + H    D    N+ IPK + I  +  +   D + +  P  F P HF+   E G  K +     +PF  GKR C+GE LA+M
Sbjct:   54 LTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICN-NFPTIIDYFP-GTHNKLLKNLAFMESDIL----EKVKEHQESMDINNP-RDFIDCFLIKMEKEKQN--QQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLD--EGGNFKKS--NYFMPFSAGKRICVGEGLARM 443          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33E1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27482])

HSP 1 Score: 186.037 bits (471), Expect = 1.320e-50
Identity = 120/411 (29.20%), Postives = 218/411 (53.04%), Query Frame = 2
Query:  212 PFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNT-GILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSD---IEKVFEEEIQEHLENLDFNS-EGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            P +   + L  KYG +F+       +V + ++++IK+   ++G NF GR +  +   +     GI+   GD W  QR F L +LRDFG GK+   E V  E   M++ ++   + V D  N       ++I+  +   R++ T+ +    EF   +     +       M   +  +  +     +   +  +  +   + ++F ++  + L ++D++S E +D ++ FL E+++  ++  +  GF  +QL  + F+L+ AG ETTS TL W+++++   P +++KV++E+   IG ++I    DR  L Y  A ++E  RL+++ P+ +   T +D  +  + IPK+++I P   +   DPE + +P+EF PE F+ S  +G LK    E+LVPF IGKRQC+GE LAKM
Sbjct:   47 PGYKMYEKLKDKYGPVFTFWLANLPMVTVTDWKLIKQHFIKDGANFVGRPEFPISMEMRQGPYGIIESHGDRWIQQRRFALHILRDFGLGKNLMEEKVLGEVTAMIDSIRKSMEDV-DMQNIFDASVGSVINNMLFGYRYDETNIE----EFLELKNRMNKHFKLAAEPMGGLIGMNPWLGHLPFFKGYKNVIMHNWMGLMEMFRKQATDRLASIDYDSDEYSDYVEAFLKERKKH-ENEQDFGGFEMEQLDSVCFDLWVAGMETTSNTLNWALLYVLLNPEVRQKVYEELEREIGSDRIITTTDRPKLNYINATVNESQRLANLLPMNLSRSTNADVEIAGYRIPKDTVITPQISSVMYDPEIFPEPYEFKPERFLES--DGSLKKV--EELVPFSIGKRQCLGEGLAKM 447          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33E1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27482])

HSP 1 Score: 186.037 bits (471), Expect = 1.320e-50
Identity = 120/411 (29.20%), Postives = 218/411 (53.04%), Query Frame = 2
Query:  212 PFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNT-GILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSD---IEKVFEEEIQEHLENLDFNS-EGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            P +   + L  KYG +F+       +V + ++++IK+   ++G NF GR +  +   +     GI+   GD W  QR F L +LRDFG GK+   E V  E   M++ ++   + V D  N       ++I+  +   R++ T+ +    EF   +     +       M   +  +  +     +   +  +  +   + ++F ++  + L ++D++S E +D ++ FL E+++  ++  +  GF  +QL  + F+L+ AG ETTS TL W+++++   P +++KV++E+   IG ++I    DR  L Y  A ++E  RL+++ P+ +   T +D  +  + IPK+++I P   +   DPE + +P+EF PE F+ S  +G LK    E+LVPF IGKRQC+GE LAKM
Sbjct:   47 PGYKMYEKLKDKYGPVFTFWLANLPMVTVTDWKLIKQHFIKDGANFVGRPEFPISMEMRQGPYGIIESHGDRWIQQRRFALHILRDFGLGKNLMEEKVLGEVTAMIDSIRKSMEDV-DMQNIFDASVGSVINNMLFGYRYDETNIE----EFLELKNRMNKHFKLAAEPMGGLIGMNPWLGHLPFFKGYKNVIMHNWMGLMEMFRKQATDRLASIDYDSDEYSDYVEAFLKERKKH-ENEQDFGGFEMEQLDSVCFDLWVAGMETTSNTLNWALLYVLLNPEVRQKVYEELEREIGSDRIITTTDRPKLNYINATVNESQRLANLLPMNLSRSTNADVEIAGYRIPKDTVITPQISSVMYDPEIFPEPYEFKPERFLES--DGSLKKV--EELVPFSIGKRQCLGEGLAKM 447          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33E2 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27499])

HSP 1 Score: 184.882 bits (468), Expect = 3.622e-50
Identity = 127/415 (30.60%), Postives = 217/415 (52.29%), Query Frame = 2
Query:  212 PFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKL-VTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQI-------LHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEG-NDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            P +    NL  +YG +++       +V + ++ +IK+   ++G NF GR +  + + +     GI+   GD W  QR F L VLRDFG GK+   E V  E   ML+ L+     V D  +       ++I+  +   R++ T+      EF   +  K +N  Q+       L  M P L        F+ +     + +  + ++F ++  E L  +D+ S+  +D ++ FL E+++  ++  +  GF  +QL  + F+L+ AG ETTS TL W+++++ R P +++KV++E+   IG ++I   +D+  L Y  A ++E  RL+++ P+ +   T  D  +  + I KN++I P       +PE + +P+EF PE F+ S  +G LK    E+LVPF IGKRQC GE LAKM
Sbjct:   47 PGYSLFSNLKEQYGHVYTFWMASLPIVHVTDWNLIKQHFIKDGGNFVGRPEFPMSIELRQGPYGIIESHGDRWVQQRRFALHVLRDFGLGKNLMEEKVLGEVTAMLDRLRKTMDEV-DMQSVFDASVGSVINNLLFGYRYDETN----IAEFLDLKE-KLNNHFQLAAKPIGGLIGMNPWLG---YFPYFSGYKNVMIQNWMGLVEMFRKQANEKLATIDYESDDYSDYVEAFLKERKKH-ENEKDFGGFEMEQLDSVCFDLWVAGMETTSNTLNWALLYVLRNPEVRQKVYEELDREIGSDRIITTSDKPKLNYINATINESQRLANLLPMNLARSTTKDVEIAGYHIKKNTVIIPQISLVLYNPEIFPEPYEFKPERFLES--DGSLKKV--EELVPFSIGKRQCPGEGLAKM 447          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-14A5 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27531])

HSP 1 Score: 181.03 bits (458), Expect = 7.567e-49
Identity = 129/434 (29.72%), Postives = 210/434 (48.39%), Query Frame = 2
Query:  176 IPIFGILFQ-KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTII---SLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQ-KTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLT-----------SRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            +P FG L Q        +L  L   YG  F++ +     VVL ++  IK++   +GD F  R Q +L  I+     NTG++F  GD+W  QR   LK+LRDFG G++   E V      ML +L+ +  K  +D Y  I +   N+I++ +    ++  D    A  F  F            HL   + + S ++S F  WL            S +      ++  EEE+   L+N D  SE  + +  ++   Q++ Q+       T+  L     + + AG ET S +L W + FM +YP +Q KV +EI ENIG  ++P M+D++++ YTQAV+ E+ R S++ P+   H    D  V    IP  +L+F   ++   +   + +  +F P+ ++   +   L  T  E  +PF +GKR C+GE LA+M
Sbjct:   33 LPFFGNLLQFPADNIQEHLDKLSKTYGPCFTV-WTPLPAVVLTDYEHIKEAFVTQGDAFVNRAQ-RLPEILFQPHPNTGVVFSSGDNWKIQRRTALKILRDFGLGRNLMEEQVMRSVHEMLAQLEHISDKKNVDMYWPIQLCVGNVINESLFGYHYKYED----AGRFEKFVKVVDR------HLKIAQGNASLLVSAFP-WLRHLPVIGNLGYHSIKNNIKSYQQFIEEEVTSQLKNYDGESEPENFVHAYM---QQMKQTGNPNLDMTN--LCASVLDFWLAGMETASNSLRWHLAFMMKYPEVQDKVRNEIFENIGTARLPSMSDKQNMPYTQAVIHEVQRCSNMVPILATHMNTEDVLVKEHNIPTGTLLFAQIWSVLKNDPVFEENSKFNPDRYLMP-DGKTLNKTVLERTIPFSVGKRNCVGEGLARM 447          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-14A1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27506])

HSP 1 Score: 172.17 bits (435), Expect = 8.078e-46
Identity = 118/410 (28.78%), Postives = 199/410 (48.54%), Query Frame = 2
Query:  224 YLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLN--TGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQ-KTVLDFYNFIPIYTANIISKFIMNKRFERTDPK-----IKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            Y   L   YG  F+I       +VL ++  IK +   +GD F+ R      T++ ++  TGIL  DGDHW  QR   LK+LRDFG G++   E V      ML +L+++  K  +D +  I +   N+I++ +    ++  D +     +K ++  +     K   + +L   FP L    I+    +   + +   S      EEE+   ++  D  SE  + +  ++    + ++ TGN  G     L     + + AG ETTS +L W + FM +YP +Q KV  EI +N+G  ++P M+D+ ++ YTQAV+ E+ R S++ P    H+   +T +    +P  SL+F   ++   +   +  P  F P  ++ S +         E  +PF IGKR C+GE LA+M
Sbjct:   50 YFDVLSKTYGPCFTIWIPF-PAIVLTDYEHIKDAFVNQGDTFTYRAHRSPETLLPVHDHTGILASDGDHWRLQRRTSLKILRDFGLGRNLMEEQVIRSVHEMLIQLENINDKKNVDVFWPIQLCVGNVINETLFGFHYKYEDSEKFKTFVKIVDKHLRHLQGK---MPLLVSAFPWLKHVPIVGD--IGYHNIKNNISSYHTFIEEEVATQVKKYDGESEPENFVHAYM----QQMKQTGNP-GLDITNLCATVLDFWLAGMETTSNSLRWHLAFMMKYPEVQDKVRKEILDNVGTARLPSMSDKPNMPYTQAVIHEVQRCSNMIPFLGSHQCKEETEIHGNRVPAGSLVFAQLWSVMRNDTVFEDPETFNPSRYLQS-DGKTFDKAVLEKTIPFSIGKRNCVGEGLARM 447          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074610)

HSP 1 Score: 191.045 bits (484), Expect = 7.420e-52
Identity = 124/428 (28.97%), Postives = 211/428 (49.30%), Query Frame = 2
Query:  173 GIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGF-----GKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDK----QLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            G+P+ G L       H     L  +YGS+FS + G +  VV++++++I++  + E   F+GR  T  +  ++   GI+   G  W  QR F+   LR FG      GK +  + + +E    +  L +     +D    I +  +N+I   +M+ RF   DPK +   F I +  +    +  +  + P +     IST    +   R   +++++ +++ I +H  + D N+   DL+D +L E ++      + + F  K    QL+ +  +LF AG ET  TTL W  VFM R P   ++V DE+ + +G  ++P + D + L  T++ + E +R SS+ PL   H    D  ++ + IP  S + P   + H DP  W KP EF P  FI +    E K    E  +PFG+G+R C+G+ LA+M
Sbjct:   59 GLPVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRRE--EFTGRPDTPFMQTLN-GYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYI-PTMQCFPSISTAKNKIAQNR---AEMQRFYQDVIDDHKRSFDPNNI-RDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDT----EGKVRKPEYFIPFGVGRRMCLGDVLARM 474          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074609)

HSP 1 Score: 191.045 bits (484), Expect = 7.420e-52
Identity = 124/428 (28.97%), Postives = 211/428 (49.30%), Query Frame = 2
Query:  173 GIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGF-----GKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDK----QLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            G+P+ G L       H     L  +YGS+FS + G +  VV++++++I++  + E   F+GR  T  +  ++   GI+   G  W  QR F+   LR FG      GK +  + + +E    +  L +     +D    I +  +N+I   +M+ RF   DPK +   F I +  +    +  +  + P +     IST    +   R   +++++ +++ I +H  + D N+   DL+D +L E ++      + + F  K    QL+ +  +LF AG ET  TTL W  VFM R P   ++V DE+ + +G  ++P + D + L  T++ + E +R SS+ PL   H    D  ++ + IP  S + P   + H DP  W KP EF P  FI +    E K    E  +PFG+G+R C+G+ LA+M
Sbjct:   59 GLPVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRRE--EFTGRPDTPFMQTLN-GYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYI-PTMQCFPSISTAKNKIAQNR---AEMQRFYQDVIDDHKRSFDPNNI-RDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDT----EGKVRKPEYFIPFGVGRRMCLGDVLARM 474          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0343812)

HSP 1 Score: 166.392 bits (420), Expect = 1.423e-43
Identity = 116/416 (27.88%), Postives = 209/416 (50.24%), Query Frame = 2
Query:  221 IYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNT--GILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSL------QKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLW---LTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQG--FTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMN-DRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
            ++ +   + YG  + +K G  +VV+      I + +  E  +  GR       + + N+  G+L  DG+ W  QR F+L+ L++FGF +S   +IV +E   +L++LK        ++T ++ ++   +Y  N +   +  +R+E   P+I  +    F+  K  +++  L   FP L   FI   F+ +   + S R L++ + K    EI+ H        E  DL+D +L       Q  GN +   F+D+ L+ +  ++F AG ETT+ +LG+  + +   P IQ++ F EI+E +GLE+IP  + DR  L Y +A+  E +R+  +   GI HR   DT +  + IPK++++   +     +P  +  P  F P+ ++    +G LK    E   PFG G+ +C+G+ L +
Sbjct:   59 VFARQYVNPYG-FYGLKIGKDKVVIAYTNDAISEMMTNE--DIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLL--RFIAPNFSGYNGFVESHRSLYTFMSK----EIELHRLTYKNYDEPRDLMDSYL-----RAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLF---DGHLKLP--EAFNPFGFGRHRCMGDLLGR 455          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0080828)

HSP 1 Score: 166.392 bits (420), Expect = 1.423e-43
Identity = 116/416 (27.88%), Postives = 209/416 (50.24%), Query Frame = 2
Query:  221 IYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNT--GILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSL------QKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLW---LTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQG--FTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMN-DRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
            ++ +   + YG  + +K G  +VV+      I + +  E  +  GR       + + N+  G+L  DG+ W  QR F+L+ L++FGF +S   +IV +E   +L++LK        ++T ++ ++   +Y  N +   +  +R+E   P+I  +    F+  K  +++  L   FP L   FI   F+ +   + S R L++ + K    EI+ H        E  DL+D +L       Q  GN +   F+D+ L+ +  ++F AG ETT+ +LG+  + +   P IQ++ F EI+E +GLE+IP  + DR  L Y +A+  E +R+  +   GI HR   DT +  + IPK++++   +     +P  +  P  F P+ ++    +G LK    E   PFG G+ +C+G+ L +
Sbjct:   59 VFARQYVNPYG-FYGLKIGKDKVVIAYTNDAISEMMTNE--DIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLL--RFIAPNFSGYNGFVESHRSLYTFMSK----EIELHRLTYKNYDEPRDLMDSYL-----RAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLF---DGHLKLP--EAFNPFGFGRHRCMGDLLGR 455          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp305a1 (gene:FBgn0036910 transcript:FBtr0074925)

HSP 1 Score: 147.902 bits (372), Expect = 2.536e-37
Identity = 117/453 (25.83%), Postives = 214/453 (47.24%), Query Frame = 2
Query:   98 LYFLINLKNRNTSISVGLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGS-IFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNT--GILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERT-DPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENL--DFNSEGNDLIDRFLIE-KQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGL---EKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
            +Y LI+   R  +   G + +P +     F       G  HI  +     + S +  +K G   VVV     ++K+   +E   F GR     + + ++ T  GI   DG  W+  R F +K +R+ G+G+S+    +E E + +L +L+  ++  ++   ++     N++   I  KR  R  D  ++ +   + + +K  +I   L   FP L     ++         ++L +++   F + I+EH   L  D +   +DLI  +L E K R   + G    F + QL+    + F AG +TTS T+  +++ +A  P +Q+K+F ++  ++     +  P ++ R++  Y  A + E+ R   + P+    R    T +  + IPKN+ I  +  + H D E W+ P EF PE FI S      K    E  +PFG+G+R+C+G++LA+
Sbjct:   16 IYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQHILFERWAKDFRSDLVGLKLGREYVVVALGHEMVKEVQLQE--VFEGRPDNFFLRLRTMGTRKGITCTDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKLFDICGGLLAQFPWLRH---VAPDRTGYNLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDR--SAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAG----KCFKDEYFMPFGMGRRRCLGDALAR 457          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2v1 (cytochrome P450, family 2, subfamily V, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040912-139])

HSP 1 Score: 224.557 bits (571), Expect = 5.642e-64
Identity = 155/453 (34.22%), Postives = 236/453 (52.10%), Query Frame = 2
Query:  110 INLKNRNTSISVGLKNLPI-VRGIPIFGILFQ-KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYN--FIPIY-----TANIISKFIMNKRFERTDPKIKAIEFAIFQTTK-KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKV---FEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            + L+NRN       KNLP     +P  G +F       HI L  +   YG+IFS++ G    VV+N + ++KK L ++G++F  R    +   IS   G+ F +G  W   R F L  L+ FG GK RS E +      ++EE K L ++++D     F P Y      +NII   +  +RFE TD +   +   I +  K ++++   L+  FP+L D        L     ++LFS   +V    +EE+ +H  + D  S   D ID +L E ++  +    + GF D+ L +   +LF AG ETTSTTL W+ V+M +YP IQ+KV  EI + +G  + P M+DR  + YT AV+ EI R+ +V PL +   T  DT ++ +FIPK + I PN  +   D   W+    F P++F+    N + K+   E  +PF +GKR C GESLA+M
Sbjct:   33 VKLRNRNKP----HKNLPPGPTPLPFIGNVFNLDTSQPHIDLTKMSDHYGNIFSLRLGSLNTVVVNTYSMVKKVLNDQGNSFMYRPVNDITERISKCQGLTFNNGYSWKQHRRFTLSTLKFFGVGK-RSLEFI------IMEEYKFLHQSIMDTNGLPFNPHYIINNGVSNIICSMVFGRRFEYTDQRFLNMLSLISKALKLQTSVFIQLYAAFPRLMD--------LLPGPHKELFSCFHQVRAFIKEEVDKHRADWD-PSSPRDFIDCYLTEIEK--KKDDLEAGFHDEGLQYAVLDLFVAGTETTSTTLLWAFVYMMKYPEIQEKVQAEIDKVVGRYRRPSMDDRPCMPYTDAVIHEIQRMGNVVPLSVPRMTNEDTILEGYFIPKGTQIIPNLTSVLFDQTKWKTQHSFDPQNFL----NAQGKFEKPEAFIPFSLGKRSCPGESLARM 459          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2k6 (cytochrome P450, family 2, subfamily K, polypeptide 6 [Source:NCBI gene;Acc:393481])

HSP 1 Score: 220.705 bits (561), Expect = 1.348e-62
Identity = 131/409 (32.03%), Postives = 218/409 (53.30%), Query Frame = 2
Query:  218 HIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQI-LHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVF---EEEIQEHLENLD-FNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            ++ L  L  KYG I+++  G ++VV+L+ ++I+K++L    + F  R  + +    +   GI F +G++W   R F L  LRDFG G+ RS E++  E K++ EE +       +    + +  +NII+  + + RFE ++ K+  +    ++  K +    + ++ MFP L            + +R ++  ++   F   EE I   ++ LD FN  G  ++D FLI +Q+  +S      +    L      LFGAG +TT TTL W ++ MA+YP IQ KV DEI   IG  + P++ DRK+L YT AV+ EI R + + P+G   +T  D  ++ +FI K + +FP   +   D   W  P  F P+HF+    N + ++  ++  +PFG G+R CIGESLA+M
Sbjct:   64 YLSLLELSKKYGPIYTVYLGPKKVVILSGYKIVKEALVNLSEEFGDRDISPIFHDFNRGYGIAFSNGENWREMRRFALSTLRDFGMGRKRSEELIIEEIKYVKEEFEKFGGNPFETKLPLALAISNIIASIVFSVRFEYSNTKLHRMVGRAYENMKLTGSPSVQIYNMFPWLRP---------IVANRNQIVKNLRDTFKQNEELINGVMKTLDPFNPRG--IVDSFLIRQQKDEESGKTDSLYNSNNLYCTVNNLFGAGTDTTVTTLRWGLLLMAKYPEIQAKVQDEIERVIGGRQ-PVVEDRKNLPYTDAVIHEIQRFADISPIGAPRQTTCDVHLNGYFIKKGTPVFPLLVSVLRDENEWETPDSFNPKHFL----NKQGQFVKKDAFMPFGAGRRVCIGESLARM 456          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2k6 (cytochrome P450, family 2, subfamily K, polypeptide 6 [Source:NCBI gene;Acc:393481])

HSP 1 Score: 220.705 bits (561), Expect = 1.348e-62
Identity = 131/409 (32.03%), Postives = 218/409 (53.30%), Query Frame = 2
Query:  218 HIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQI-LHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVF---EEEIQEHLENLD-FNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            ++ L  L  KYG I+++  G ++VV+L+ ++I+K++L    + F  R  + +    +   GI F +G++W   R F L  LRDFG G+ RS E++  E K++ EE +       +    + +  +NII+  + + RFE ++ K+  +    ++  K +    + ++ MFP L            + +R ++  ++   F   EE I   ++ LD FN  G  ++D FLI +Q+  +S      +    L      LFGAG +TT TTL W ++ MA+YP IQ KV DEI   IG  + P++ DRK+L YT AV+ EI R + + P+G   +T  D  ++ +FI K + +FP   +   D   W  P  F P+HF+    N + ++  ++  +PFG G+R CIGESLA+M
Sbjct:   64 YLSLLELSKKYGPIYTVYLGPKKVVILSGYKIVKEALVNLSEEFGDRDISPIFHDFNRGYGIAFSNGENWREMRRFALSTLRDFGMGRKRSEELIIEEIKYVKEEFEKFGGNPFETKLPLALAISNIIASIVFSVRFEYSNTKLHRMVGRAYENMKLTGSPSVQIYNMFPWLRP---------IVANRNQIVKNLRDTFKQNEELINGVMKTLDPFNPRG--IVDSFLIRQQKDEESGKTDSLYNSNNLYCTVNNLFGAGTDTTVTTLRWGLLLMAKYPEIQAKVQDEIERVIGGRQ-PVVEDRKNLPYTDAVIHEIQRFADISPIGAPRQTTCDVHLNGYFIKKGTPVFPLLVSVLRDENEWETPDSFNPKHFL----NKQGQFVKKDAFMPFGAGRRVCIGESLARM 456          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2k16 (cytochrome P450, family 2, subfamily K, polypeptide16 [Source:ZFIN;Acc:ZDB-GENE-041010-37])

HSP 1 Score: 219.935 bits (559), Expect = 1.993e-62
Identity = 137/408 (33.58%), Postives = 213/408 (52.21%), Query Frame = 2
Query:  218 HIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQI-LHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDL---IDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            H+ L  +  ++G +F + FG ++VVVL  ++ +K++L    + F  R    L    +   GI+F +G+ W   R F L  LRDFG GK +  E +  E   + EE +  +    +    +    +++IS  +  +RFE TDP+++ +     ++ + S    + L+ MFP     F+      W    + L  DI     EEI E +  L       DL   +D FL+ KQ    S      F ++ LI+    LF AG +TTSTTL WS++ MA+YPHIQ +V +EI + IG  + P+  DRK+L YT AV+ E  RL+++ P+ I H T SD + + +FI K + IFP   +   D + W  P  F P HF+   E G  ++  R+  +PF  G+R C+GESLA+M
Sbjct:   61 HLSLCEMAKQFGPVFKVYFGPKKVVVLAGYKAVKQALVNYAEAFGDREIMPLFHDFTKGHGIIFANGESWREMRRFALTNLRDFGMGKKKIEEKIIEETCHLREEFEKFEGKPFETAQLMNYAASSVISSIVYGRRFEYTDPQLRTMVDRANESVRLSGSASVQLYNMFP-----FLGPLLKNWRQLMKNLHLDI-----EEISELVNGLHQTLNHQDLRGFVDSFLVRKQYAEDSGEKDSHFHEQNLIYTVGNLFVAGTDTTSTTLRWSLLLMAKYPHIQDRVQEEIDQVIG-GRQPVSEDRKNLPYTDAVIHETQRLANIVPMSIPHMTSSDITFNGYFIKKGTCIFPLLTSVLWDEDEWETPHIFNPNHFLD--EQG--RFVKRDAFMPFSAGRRICLGESLARM 453          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2n13 (cytochrome P450, family 2, subfamily N, polypeptide 13 [Source:ZFIN;Acc:ZDB-GENE-041001-158])

HSP 1 Score: 218.779 bits (556), Expect = 4.930e-62
Identity = 142/445 (31.91%), Postives = 226/445 (50.79%), Query Frame = 2
Query:  116 LKNRNTSISVGLKNLPIVRGIPIFGILFQ--KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTK-LVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK-KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFS--DIEKVFEEE-IQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            LKNRN       K  P    +P+ G +F    K P H+YL  LGH Y +IFS++ G  + V +  ++++K++L  + +NF  R  +  L  + S N G+ F +G+ W  QR F L  LR+FG GK      +  E +F+LEE+   +    D    +    +NII + +  +RF+  D + K +   I ++ + + ++   ++  FP +                  +FS  D+ K F  E I +H   LD  SE  D ID FLIE +       N  GF +  L+    +LF AG E+TS TL W ++++  YP +Q+KV +EI   IG  + P + D+ ++ YT+AV+ EI+R   V PL        DT++   FIPK + + P   +   D   W  P++F P HF+    + E K+  R+  +PF  GKR C+GE +A++
Sbjct:   29 LKNRNPP-----KYPPSPFSVPLLGNIFNVDSKEP-HLYLTKLGHAYNNIFSLRLGSDKTVFITGYKMVKEALVTQAENFVDRPNSPVLARVYSGNAGLFFSNGEMWKKQRRFALSTLRNFGLGKKTMELAICEESRFLLEEIDEQKGAAFDPTILLYNAVSNIICQMVFGQRFDYADHQFKTMLKYISKSIQLEGSVWGQIYEAFPAIMKHLP--------GPHNDIFSNYDLLKSFVHEVIVKHKAKLD-PSEPRDYIDTFLIEMKEKPHERVN--GFEEPNLVACVLDLFLAGTESTSNTLCWGLIYLIMYPDVQEKVQEEIDRVIGNSREPSIADKPNMPYTEAVIHEIMRFGDVIPLNGLRVAARDTTLGECFIPKGTTVLPILHSVLFDENEWETPYKFNPGHFL----DKEGKFVRRDAFMPFSAGKRVCLGEQIARI 452          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 242.662 bits (618), Expect = 1.510e-70
Identity = 150/434 (34.56%), Postives = 231/434 (53.23%), Query Frame = 2
Query:  146 GLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQT-----KLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK-KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            G K LP++  + I  +    K PF  +++ L  KYG +FS++ G ++VVVL     +K +L    D FSGR +       L  +I + +G++F DG++W   R F L  LRDFG GK    + +  E   ++E  KS +    D    +    ANII   ++N RFE  DP +  +  ++ +  +     + +L+  +P +      S  +++  S+  L        +E   EH   LD N +  DLID FL+++Q   + + + + F D+ L  +   LFGAG ETTSTTL W ++ M +YP IQKKV DEI + IG  + P +  RK + YT AV+ EI R +++ P G+ H T +D +   +FIPK + + P   +   D   ++KP EF+PEHF+ S    E K+   E  +PF  GKR C GE+LAKM
Sbjct:   33 GPKPLPLIGNLHIMNM----KKPFLTFME-LAEKYGPVFSVQLGTKKVVVLCGTDAVKDALVNHADEFSGRPKIPIYVFSLTHVIPICSGVIFADGENWKVMRRFTLSTLRDFGMGKKTLEDRIGEESGCLVETFKSHEGKPFDNTMILNASVANIIVHILLNHRFEYQDPTLLKLIKSVSENVRIGGRPIVMLYNTYPSIMQWVPGSHKSIYENSQNLL-----NFLKETFTEHRHQLDVNDQ-RDLIDTFLVKQQE--EKSSSTKFFHDENLTILLSNLFGAGMETTSTTLRWGILLMMKYPDIQKKVQDEIDQVIGSAE-PRLEHRKQMPYTDAVIHEIQRFANLAPNGLPHATTTDVTFRGYFIPKGTQVIPVLTSVLRDKAYFKKPEEFYPEHFLDS----EGKFLKNEAFLPFSAGKRICAGETLAKM 448          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2e1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100494424])

HSP 1 Score: 238.039 bits (606), Expect = 5.912e-69
Identity = 148/433 (34.18%), Postives = 224/433 (51.73%), Query Frame = 2
Query:  146 GLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPK-IKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRK-LFSDIEKVFE---EEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            G K LP++  + +  +    K P H+    L  KYGS++S+K G R+VVVL     ++ +L    + FSGR +  +   +S   GI+F  G++W   R F L  LRDFG GK    + +  E   ++   KS +    D    +    ANII   ++N RFE  DP  +K I+          + + +L+  +P +           W+  R K + ++  K+++   E    H E+LD N +  DLID FL+++Q   +   + + F D+ L  +   LFGAG ETTSTTL W ++ M +YP +QKKV D+I   IG  + P +  RK + YT AV+ EI R +++ P  + H T  D +   FFIPK + I P   +   D   ++KP EF+PEHF+ S  N    +   E  +PF  GKR C GE+LAKM
Sbjct:   33 GPKPLPLIGNLHMINM----KKP-HLTFMELAEKYGSVYSVKLGTRDVVVLCGTDTVRDALINHAEEFSGRAKIPVFDEVSNGHGIVFAHGENWKVMRRFTLSTLRDFGMGKKTIEDRISEESDCLVGVFKSYEGKPFDNTMIMNAAVANIIVHILLNHRFEYQDPTLLKLIKIVSENIRIGGSPIVMLYNTYPSI---------MRWIPGRHKTVGANTAKLYDFLKETFTRHREHLDVNDQ-RDLIDVFLVKQQE--EKLSSTKFFHDENLTVLLGNLFGAGMETTSTTLRWGLLLMMKYPEVQKKVQDDIDRVIGSAE-PRLEHRKLMPYTDAVIHEIQRFANIAPTNVPHATTKDVTFRGFFIPKGTQIMPLLTSVLRDKAYFKKPEEFYPEHFLDSDGN----FVKNEACLPFSAGKRSCAGETLAKM 443          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 236.498 bits (602), Expect = 2.328e-68
Identity = 151/439 (34.40%), Postives = 228/439 (51.94%), Query Frame = 2
Query:  119 KNRNTSISVGLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYE-IVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK-KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            K  + +   G K LP++  + +  +    K P H+    L  KYG +FS+  G  + VVL     +K +L    D FSGR +T L        GI+F DG++W   R F +  LRDFG GK    + I+E  C  ++E  KS +    D    +    ANII   ++N RFE  DP +  +  ++ +  +     + +L+  +P +      S  +++  S+  L        +E   EH   LD N +  DLID FL+++Q   + + + + F D+ L  +   LFGAG ETTSTTL W ++ M +YP IQKKV DEI + IG  + P +  RK + YT AV+ EI R +++ P G+ H T +D +   +FIPK + + P   +   D   ++KP EF+PEHF+ S    E K+   E  +PF  GKR C GE+LAKM
Sbjct:   24 KGASQNFPPGPKPLPLIGNLHMMNM----KKP-HLTFMELAEKYGPVFSVHLGANKAVVLCGTDAVKDALINYADEFSGRPKTPLFEQTFKGNGIVFADGENWKVMRRFTISTLRDFGMGKKTIEDRIIEESC-CLVETFKSHKGKPFDNTMILNASVANIIVHILLNHRFEYQDPTLLKLIKSVSENVRIGGRPIVMLYNTYPSIMQWVPGSHKSIYENSQNLL-----NFLKETFTEHRHQLDVNDQ-RDLIDTFLVKQQE--EKSSSTKFFHDENLTILLSNLFGAGMETTSTTLRWGILLMMKYPDIQKKVQDEIDQVIGSAE-PRLEHRKQMPYTDAVIHEIQRFANLAPNGLPHATTTDVTFRGYFIPKGTQVIPVLTSVLRDKAYFKKPEEFYPEHFLDS----EGKFLKNEAFLPFSAGKRICAGETLAKM 443          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 235.728 bits (600), Expect = 3.528e-68
Identity = 143/442 (32.35%), Postives = 233/442 (52.71%), Query Frame = 2
Query:  119 KNRNTSISVGLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK-KSNILQILHLMFPKLDDSFIISTFTLWLT-SRRKLFSDIEKV---FEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            K  + +   G K LP++  + +  +    K P H+       KYG +FSI+ G+ + +VL     +K +L   GD FSGR +  +   IS   G++F DG++W   R F L  LRDFG G+    + +  E   ++E  KS +    D    +    ANII   ++N RFE  DP +  +  ++ +  K   + + +L+  +P +           W+  S + +F + +K+    +E   +  + LD N +  DLID FL+++Q   + + +++ F D+ L  +  +LF AG ETTSTTL W ++ M +YP IQKKV DEI   IG  + P +  RK + YT AV+ EI R +++ P+ + H    D +   +F+PK + + P   +   D + ++KP EF+PEHF+ S  N    +   E  +PF +GKR C+GE+LAKM
Sbjct:   24 KGASQNFPPGPKPLPLIGNLHMMNM----KKP-HLTFMEFSKKYGPVFSIQLGLNKAIVLCGADAVKDALINHGDEFSGRPKIPVFDQISKGYGVVFADGENWKVMRRFALSTLRDFGMGRKTIEDTIVEESGCLVETFKSHEAKPFDNTLILNAAVANIIVHILLNHRFEYQDPTLIKLIKSVSENVKIAGSPIVMLYNTYPSI---------MGWIPGSHKTVFENFQKLSNFLKETFTKRRDQLDVNDQ-RDLIDAFLVKQQE--EKSSSKKFFHDENLKVLLGDLFAAGMETTSTTLRWGILMMMKYPDIQKKVQDEIDRVIGSAE-PRLEHRKQIPYTDAVIHEIQRFANLVPIVLPHSITEDVTFRGYFLPKGTQVIPLLISVMQDKDYFQKPEEFYPEHFLDSKGN----FVKNEAFLPFSVGKRSCVGETLAKM 443          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 234.572 bits (597), Expect = 9.339e-68
Identity = 149/430 (34.65%), Postives = 227/430 (52.79%), Query Frame = 2
Query:  146 GLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYE-IVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK-KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            G K LP++  + +  +    K P+  +++ L  KYG +FS+  G  + VVL     +K +L    D FSGR +T L        GI+F DG++W   R F +  LRDFG GK    + I+E  C  ++E  KS +    D    +    ANII   ++N RFE  DP +  +  ++ +  +     + +L+  +P +      S  +++  S+  L        +E   EH   LD N +  DLID FL+++Q   + + + + F D+ L  +   LFGAG ETTSTTL W ++ M +YP IQKKV DEI + IG  + P +  RK + YT AV+ EI R +++ P G+ H T +D +   +FIPK + + P   +   D   ++KP EF+PEHF+ S    E K+   E  +PF  GKR C GE+LAKM
Sbjct:   33 GPKPLPLIGNLHMINM----KKPYLTFME-LAEKYGPVFSVHLGANKAVVLCGTDAVKDALINYADEFSGRPKTPLFEQTFKGNGIVFADGENWKVMRRFTISTLRDFGMGKKTIEDRIIEESC-CLVETFKSHKGKPFDNTMILNASVANIIVHILLNHRFEYQDPTLLKLIKSVSENVRIGGRPIVMLYNTYPSIMQWVPGSHKSIYENSQNLL-----NFLKETFTEHRHQLDVNDQ-RDLIDTFLVKQQE--EKSSSTKFFHDENLTILLSNLFGAGMETTSTTLRWGILLMMKYPDIQKKVQDEIDQVIGSAE-PRLEHRKQMPYTDAVIHEIQRFANLAPNGLPHATTTDVTFRGYFIPKGTQVIPVLTSVLRDKAYFKKPEEFYPEHFLDS----EGKFLKNEAFLPFSAGKRICAGETLAKM 443          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b19 (cytochrome P450, family 2, subfamily b, polypeptide 19 [Source:MGI Symbol;Acc:MGI:107303])

HSP 1 Score: 222.631 bits (566), Expect = 1.990e-63
Identity = 136/429 (31.70%), Postives = 225/429 (52.45%), Query Frame = 2
Query:  161 PIVRGIPIFGILFQ--KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNIL--QILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFE---EEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
            P  R +P  G L Q  ++G    +++ L  KYG +F++  G R VV+L     I+++L  + + FSGR    ++  I    G++F  G+ W T R F L  +RDFG GK    E ++ E + ++EELK  +   L+   +     ANII   +  +RF+  D +   +   I+QT    + L  Q+  L       S I+  F     + R++  +++++ +     +++H   LD  S   D ID +L+  ++  + + +   F  + L+     LF AG ETTSTTL +S + M +YPH+ +KV  EI + IG  ++P ++DR  + YT AV+ EI R + + P+G+ H+   DT    + IPKN+ ++P   +   DP  + +P  F PEHF+ +  NG LK    E  +PF  GKR C+GE +A+
Sbjct:   33 PGPRPLPFLGNLLQMDRRGLLSSFIQ-LQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQVFELF------SAILKYFP---GAHRQISKNLQEILDYIGHSVEKHRATLD-PSAPRDFIDTYLLRMEK--EKSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHFLDA--NGALKTN--EAFMPFSTGKRICLGEGIAR 444          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b13 (cytochrome P450, family 2, subfamily b, polypeptide 13 [Source:MGI Symbol;Acc:MGI:88599])

HSP 1 Score: 219.164 bits (557), Expect = 3.674e-62
Identity = 136/411 (33.09%), Postives = 207/411 (50.36%), Query Frame = 2
Query:  233 NLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFP--KLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQE-----------HLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
            +L  K+G +F++  G R VVVL   + I+++L    + FSGR       ++  + GI F  G+ W T R F L  +++FG GK    E ++ E + ++EELK  Q   LD   F    TANII   +  +RF+ TD                   L++L+LM+    L  SF    F L+ +   K F  + +   +  QE           H   LD  SE  D ID +L+  ++  + + +   F  + L+     LF AG ETTSTTL    + M  YPH+ +KV  EI + IG  ++P ++DR  + YT AV+ EI R S + P G  HR   DT    + +PKN+ ++P   +   DP+ + +P  F P+HF+ +  NG LK +  E  +PF  GKR C+GES+A+
Sbjct:   57 HLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVNNAEAFSGRGTIAAAQLVMQDYGIFFSSGERWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGAPLDPTFFFQCVTANIICSIVFGERFDYTD----------------EQFLRLLNLMYQIYSLLRSFSCQMFELF-SGLLKYFPGVHRQIAKNQQEILNFITHRVEKHRATLD-PSEPRDFIDTYLLRMEK--EKSNHNTEFHHQNLMMSVLSLFFAGTETTSTTLCCGFLLMLMYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDIVPTGAPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHFLDA--NGALKKS--EAFLPFSTGKRICLGESIAR 443          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b23 (cytochrome P450, family 2, subfamily b, polypeptide 23 [Source:MGI Symbol;Acc:MGI:3646735])

HSP 1 Score: 218.394 bits (555), Expect = 7.482e-62
Identity = 131/412 (31.80%), Postives = 210/412 (50.97%), Query Frame = 2
Query:  236 LGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWL------------TSRRKLFSDIEKVFE---EEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
            L  K+G +F++  G R VV+L     IK++L +  D FSGR    ++  I  + G++F  G+ W T R F L  +RDFG GK    E ++ E + ++EELK  +   LD        TANII   +  +RF+ TD                   L +L L +  L    +IS+F+  L             + R++  +I+++       +++H   LD  S   D ID +L+  ++  + + +   F  + L+     LF AG ETTSTTL +  + M +YPH+ +KV  EI + I    +P + DR  + YT+AV+ EI R S + P+G+ H    DT    + +PKN+ ++P   +   DP+ + +P +F PEHF+ +  NG LK +  E  +PF  GKR C+GE +A+
Sbjct:   58 LRDKHGDVFTVHLGPRPVVMLYGTETIKEALVDHSDAFSGRGAIAVIQPIVQDYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYEGAPLDPTFLFQCITANIICSIVFGERFDYTD----------------HQFLHLLDLFYQTLS---LISSFSSQLFELFSAVLKYFPGTHRQISKNIQEILNYIGHSVEQHKATLD-PSAPRDFIDTYLLRMEK--EKSNHHTEFHHQNLLISVLSLFFAGTETTSTTLRYGFLLMLKYPHVAEKVQKEIDQVISAHHVPTLEDRIKMPYTEAVIHEIQRFSDLAPIGLPHTVTKDTVFRGYLLPKNTEVYPILSSALHDPQYFEQPDKFNPEHFLDA--NGALKKS--EAFLPFSTGKRICLGEGIAR 443          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b10 (cytochrome P450, family 2, subfamily b, polypeptide 10 [Source:MGI Symbol;Acc:MGI:88598])

HSP 1 Score: 217.238 bits (552), Expect = 1.508e-61
Identity = 134/403 (33.25%), Postives = 213/403 (52.85%), Query Frame = 2
Query:  233 NLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLT-SRRKLFSDIEKVFE---EEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQG-FTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
             L  KYG +F++  G R VV+L     I+++L  + + FSGR    +V       G++F +G+ W T R F L  +RDFG GK    E ++ E + ++EEL+  Q   LD        TANII   +  +RFE TD +   +    +QT   S I      MF       + S F  +   + R++  +++++ +     +++H   LD  S   D ID +L+   R+ +   NQ   F  + L+     LF AG ET+STTL +  + M +YPH+ +KV  EI + IG  ++P ++DR  + YT AV+ EI R S + P+G+ HR   DT    + +PKN+ ++P   +   DP+ + +P  F P+HF+ +  NG LK +  E  +PF  GKR C+GES+A+
Sbjct:   57 QLREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVAVVEPTFKEYGVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIICSIVFGERFEYTDRQFLRLLELFYQTF--SLISSFSSQMFE------LFSGFLKYFPGAHRQISKNLQELLDYIGHSVEKHRATLD-PSVPRDFIDIYLL---RMEKEKSNQHTEFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHFLDA--NGALKKS--EAFLPFSTGKRICLGESIAR 443          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b9 (cytochrome P450, family 2, subfamily b, polypeptide 9 [Source:MGI Symbol;Acc:MGI:88600])

HSP 1 Score: 216.468 bits (550), Expect = 3.635e-61
Identity = 131/410 (31.95%), Postives = 210/410 (51.22%), Query Frame = 2
Query:  233 NLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFP--KLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGN----------DLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
             L  K+G +F++  G R VVVL   + I+++L +  + FSGR       ++  + GI F  G  W T R F L  +++FG GK    E ++ E + ++EELK  Q   LD        TANII   +  +RF+ TD                   L +L+LM+    L  SF    F L+ +   K F  + +   ++ QE L+ +  + E +          D ID +L+  ++  + + +   F  + L+     LF AG ETTS TL + ++ M +YPH+ +KV  EI + IG  ++P ++DR  + YT AV+ EI R S + P+G+ H+   DT    + +PKN+ ++P   +   DP+ + +P +F PEHF+ +  NG LK    E  +PF  GKR C+GES+A+
Sbjct:   57 QLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSGRGTIAAAQLVMQDYGIFFASGQRWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGVPLDPTFLFQCITANIICSIVFGERFDYTD----------------DQFLHLLNLMYKIFSLLSSFSGQMFELF-SGFLKYFPGVHRQIVKKQQELLDYIAHSVEKHKATLDPSAPRDYIDTYLLRMEK--EKSNHNTEFHHQNLMMSVLSLFFAGTETTSATLHYGVLLMLKYPHVTEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLVPIGLPHKVIKDTLFRGYLLPKNTEVYPVLSSALHDPQYFEQPDKFNPEHFLDA--NGALKKC--EAFLPFSTGKRICLGESIAR 443          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P24460|CP2BB_CANLF (Cytochrome P450 2B11 OS=Canis lupus familiaris OX=9615 GN=CYP2B11 PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 2.219e-64
Identity = 138/434 (31.80%), Postives = 225/434 (51.84%), Query Frame = 2
Query:  161 PIVRGIPIFGILFQ--KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPK------IKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKV---FEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            P  R +PI G   Q  +KG    +L+ L  KYG +F++  G R  V+L     I+++L +  + FSGR +  +V  +    G++F +G+ W T R F L  +RDFG GK    E ++ E + ++EEL+  +  + D   F    TANII   +  KRF   DP+      +  + FA+  ++  S + ++ H            S    +  + R+++++++++       +++H E LD  S   D ID +LI   +      ++  F  + LI     LF AG ETTSTTL +  + M +YPHI ++++ EI + IG  ++P ++DR  + YT AV+ EI R   + P+G+ H    D     + IPK + +FP   +   DP  + KP  F P+HF+ +  NG LK    E  +PF IGKR C+GE +A+M
Sbjct:   32 PGPRPLPILGNFLQMDRKGLLKSFLR-LQEKYGDVFTVYLGPRRTVMLCGIDAIREALVDNAEAFSGRGKIAVVEPVFQGYGVVFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKTEGVLQDPTFFFHSMTANIICSIVFGKRFGYKDPEFLRLMNLFYVSFALI-SSFSSQMFELFH------------SFLKYFPGTHRQVYNNLQEIKAFIARMVEKHRETLD-PSAPRDFIDAYLIRMDKEKAEPSSE--FHHRNLIDTALSLFFAGTETTSTTLRYGFLLMLKYPHIAERIYKEIDQVIGPHRLPSLDDRAKMPYTDAVIHEIQRFGDLLPIGVPHMVTKDICFRGYIIPKGTEVFPILHSALNDPHYFEKPDVFNPDHFLDA--NGALKKN--EAFIPFSIGKRICLGEGIARM 444          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|O55071|CP2BJ_MOUSE (Cytochrome P450 2B19 OS=Mus musculus OX=10090 GN=Cyp2b19 PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.392e-62
Identity = 136/429 (31.70%), Postives = 225/429 (52.45%), Query Frame = 2
Query:  161 PIVRGIPIFGILFQ--KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNIL--QILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFE---EEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
            P  R +P  G L Q  ++G    +++ L  KYG +F++  G R VV+L     I+++L  + + FSGR    ++  I    G++F  G+ W T R F L  +RDFG GK    E ++ E + ++EELK  +   L+   +     ANII   +  +RF+  D +   +   I+QT    + L  Q+  L       S I+  F     + R++  +++++ +     +++H   LD  S   D ID +L+  ++  + + +   F  + L+     LF AG ETTSTTL +S + M +YPH+ +KV  EI + IG  ++P ++DR  + YT AV+ EI R + + P+G+ H+   DT    + IPKN+ ++P   +   DP  + +P  F PEHF+ +  NG LK    E  +PF  GKR C+GE +A+
Sbjct:   33 PGPRPLPFLGNLLQMDRRGLLSSFIQ-LQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQVFELF------SAILKYFP---GAHRQISKNLQEILDYIGHSVEKHRATLD-PSAPRDFIDTYLLRMEK--EKSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHFLDA--NGALKTN--EAFMPFSTGKRICLGEGIAR 444          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|F1Q8C3|CP2K6_DANRE (Cytochrome P450 2K6 OS=Danio rerio OX=7955 GN=cyp2k6 PE=1 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.017e-61
Identity = 131/409 (32.03%), Postives = 218/409 (53.30%), Query Frame = 2
Query:  218 HIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQI-LHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVF---EEEIQEHLENLD-FNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            ++ L  L  KYG I+++  G ++VV+L+ ++I+K++L    + F  R  + +    +   GI F +G++W   R F L  LRDFG G+ RS E++  E K++ EE +       +    + +  +NII+  + + RFE ++ K+  +    ++  K +    + ++ MFP L            + +R ++  ++   F   EE I   ++ LD FN  G  ++D FLI +Q+  +S      +    L      LFGAG +TT TTL W ++ MA+YP IQ KV DEI   IG  + P++ DRK+L YT AV+ EI R + + P+G   +T  D  ++ +FI K + +FP   +   D   W  P  F P+HF+    N + ++  ++  +PFG G+R CIGESLA+M
Sbjct:   64 YLSLLELSKKYGPIYTVYLGPKKVVILSGYKIVKEALVNLSEEFGDRDISPIFHDFNRGYGIAFSNGENWREMRRFALSTLRDFGMGRKRSEELIIEEIKYVKEEFEKFGGNPFETKLPLALAISNIIASIVFSVRFEYSNTKLHRMVGRAYENMKLTGSPSVQIYNMFPWLRP---------IVANRNQIVKNLRDTFKQNEELINGVMKTLDPFNPRG--IVDSFLIRQQKDEESGKTDSLYNSNNLYCTVNNLFGAGTDTTVTTLRWGLLLMAKYPEIQAKVQDEIERVIGGRQ-PVVEDRKNLPYTDAVIHEIQRFADISPIGAPRQTTCDVHLNGYFIKKGTPVFPLLVSVLRDENEWETPDSFNPKHFL----NKQGQFVKKDAFMPFGAGRRVCIGESLARM 456          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P00178|CP2B4_RABIT (Cytochrome P450 2B4 OS=Oryctolagus cuniculus OX=9986 GN=CYP2B4 PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.237e-61
Identity = 134/423 (31.68%), Postives = 219/423 (51.77%), Query Frame = 2
Query:  176 IPIFGILFQ--KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPK-IKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKV---FEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
            +P+ G L Q  +KG    +L+ L  KYG +F++  G R VVVL     I+++L ++ + FSGR +  +V  I    G++F +G+ W   R F L  +RDFG GK    E ++ E + ++EEL+  +  +LD        T+NII   +  KRF+  DP  ++ ++      +  S+    +  +FP     F          + R+++ +++++     + +++H   LD  S   D ID +L+  ++    +     F  + LI     LF AG ETTSTTL +  + M +YPH+ ++V  EI + IG  + P ++DR  + YT AV+ EI RL  + P G+ H    DT    + IPKN+ +FP   +   DP  +  P  F P HF+ +  NG LK    E  +PF +GKR C+GE +A+
Sbjct:   37 LPVLGNLLQMDRKGLLRSFLR-LREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGERWRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFPGFLKHFP--------GTHRQIYRNLQEINTFIGQSVEKHRATLD-PSNPRDFIDVYLLRMEK--DKSDPSSEFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDA--NGALKRN--EGFMPFSLGKRICLGEGIAR 443          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|Q0IIF9|CP2U1_BOVIN (Cytochrome P450 2U1 OS=Bos taurus OX=9913 GN=CYP2U1 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 6.707e-61
Identity = 134/414 (32.37%), Postives = 224/414 (54.11%), Query Frame = 2
Query:  218 HIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFID-GDHWHTQRTFVLKVLRDFGFGK-SRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWL--------TSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
             + L +LG  YG+IFS   G   VVVLN+F  ++++L ++ + FS R +  L +I++   GI+F   G  W  QR F    LR FG GK S   +I+E E +++ EE++       + +  +    +NII      +RF+ T+ + K +          S  L++       L+   ++     WL           R++  D+    ++ I++H E+LD  +   D ID +L+  +   ++  N  GF +  L ++  +LF AG +TT+ +L W +++M+ +P+IQ+K+ +EI   IG ++ P + D+  + YT+A + E+ RLS+V PL I H T   T +  F IPK ++I PN ++ H DP  W KP +F+P+ F+   + G+L    +E  +PFGIGKR C+GE LAKM
Sbjct:  104 QLLLADLGRVYGNIFSFLIGHYLVVVLNDFHSVREALVQQAEVFSDRPRVPLTSIMTKGKGIVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIE-EFRYVKEEMQKHGDAPFNPFPIVNNAVSNIICSLCFGRRFDYTNSEFKQM------LNFMSRALEVC------LNTQLLLVNICSWLYYLPFGPFKELRQIEKDLTLFLKKIIKDHRESLDVENP-QDFIDMYLLHVEEEKKNNSNS-GFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLHPNIQEKIHEEIARVIGADRAPSLTDKAQMPYTEATIMEVQRLSTVVPLSIPHMTSEKTVLQGFTIPKGTIILPNLWSVHRDPAIWEKPNDFYPDRFLD--DQGQL--IKKETFIPFGIGKRVCMGEQLAKM 498          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A2U8U473 (Cytochrome P450 2K1-like protein OS=Dugesia japonica OX=6161 GN=P450 PE=2 SV=1)

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 320/482 (66.39%), Postives = 395/482 (81.95%), Query Frame = 2
Query:  125 RNTSISVGLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKMXXXXXXXXXXXXXXXKFAENISDKLYQENLEGNDGIIRYSKIKNFIF 1570
            +  SI  GLK  PI  G PI GI+ + KGP   YL  L  K+G IF I+ GMR+VV+L N++ I+K+L ++   FSGRW+ KLV++++ ++GI+F DG  W TQR+F+LKVLRDFG GKS S +IV+ EC F+L EL SLQ  ++DF   IPIYTANIISKFIMNKRF+R+DP+IK IE+AIFQT+K+S+I+Q LHLMFP  D S IIS F LW+TS+ +LFS +E+VF +EI+EH  NLD+NSEG+DLIDRFL+E+ RL QSTG  + FTDKQLIFMTFE+FGAGYETTSTTLGWSM+FM+RY  IQKKV++EI   IG E++P MND+KSL YTQAVMDEILRLSSV PLGI+HRTF+DTSVDN+FIPKNSL+F NY+ACHTDP+ W KP EF+PEHF+   EN ELKY+PRE+L+PFGIGKRQCIGESLA+ME+FIFFVSI Q ++V F+ENISD L++E L GN+GIIRYSKIKNFIF
Sbjct:   22 KRRSIPNGLKETPIEYGWPILGIIPKIKGPMQNYLLELSRKHGPIFRIRLGMRDVVILGNYQTIRKALVDDAQIFSGRWKMKLVSVVTHDSGIVFKDGPVWSTQRSFILKVLRDFGMGKSISQDIVQGECLFLLNELDSLQGEIIDFSKIIPIYTANIISKFIMNKRFDRSDPRIKFIEYAIFQTSKQSDIVQRLHLMFPIFDKSTIISKFNLWITSKLQLFSKVERVFHDEIEEHKTNLDYNSEGDDLIDRFLLEQNRLSQSTGIVESFTDKQLIFMTFEMFGAGYETTSTTLGWSMLFMSRYKDIQKKVYEEILNVIGEERMPTMNDKKSLNYTQAVMDEILRLSSVAPLGIFHRTFNDTSVDNYFIPKNSLVFANYYACHTDPDIWLKPVEFYPEHFLIKCENDELKYSPREELIPFGIGKRQCIGESLARMEYFIFFVSILQRYQVDFSENISDSLFEETLRGNEGIIRYSKIKNFIF 503          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A4P8NYX5 (P450 2B-like protein OS=Dugesia japonica OX=6161 GN=p4502B PE=2 SV=1)

HSP 1 Score: 525.398 bits (1352), Expect = 2.057e-175
Identity = 273/486 (56.17%), Postives = 363/486 (74.69%), Query Frame = 2
Query:  125 RNTSISVGLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKMXXXXXXXXXXXXXXXKFAENISDKLYQENLEGNDGIIRYSKIKNFIFHKRD 1582
            +  SI  GLK  PI  G+PI GI+ + K P H YL  L  K+G IF IK GMR+V++L+N+ IIKK+L ++G NFSGRW+ KL+++I+ ++GI+F DG  W TQR+FVLKVLRDFG GKS+S ++V++EC F+LEEL+SL+  ++DF   IPIYTANIISKFIMNKRFER +PKI  IE  + +  KK +I+Q+LH+MFPK D S +     +  TS+ K F +I+  F+EEI EHL+ +DFNSEG DL+DRFLI++ +L Q   +   F D QLI  + ELF AGYETTSTTL WS +FM+++  IQ+KV +EI E IG E++P MND+KS+ YTQAVMDEI R+SSV PL + HRT +D ++D +FIPKN+LIFPN +ACH D + W KP  F+PEHF++  +NG LKYTPR++L+ F IGKRQC+GESLA+MEFFIFF SI Q F VK  + +++K Y+E L G DGIIR S + +FIF K++
Sbjct:   22 KRNSIPKGLKETPIEYGLPILGIIHKIKEPMHNYLLKLSKKHGPIFRIKLGMRDVLILSNYDIIKKALVDDGQNFSGRWRMKLISLITHDSGIIFKDGQDWSTQRSFVLKVLRDFGLGKSKSVDLVQNECSFLLEELESLEGKIIDFSKIIPIYTANIISKFIMNKRFERENPKIARIEKMLSEEIKKKDIIQLLHIMFPKCDTSGLFCELIINFTSKWKEFLEIQNYFKEEIDEHLKTIDFNSEGEDLMDRFLIKQNQLKQQNIDVGSFNDWQLIRSSLELFYAGYETTSTTLCWSFLFMSKHQDIQQKVHNEIIEIIGKERLPTMNDKKSMNYTQAVMDEIFRMSSVAPLALIHRTLNDANIDGYFIPKNTLIFPNLYACHFDRDIWEKPMIFYPEHFLTEDDNGNLKYTPRDELILFSIGKRQCLGESLARMEFFIFFTSILQRFRVKLVKELNEKEYEEALLGKDGIIRGSIVNDFIFTKQN 507          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A3P9JKM7 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 2.676e-70
Identity = 153/434 (35.25%), Postives = 229/434 (52.76%), Query Frame = 2
Query:  161 PIVRGIPIFGILFQ-KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTL--WLTSR-----RKLFSDIEKVFE---EEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            P  R +P  G L + +    H+  K    KYG++FS+     + VVLN  +++K++L ++GD+F  R Q  L + +  N GI+  +G+ W  QR F L  LR+FG GK    + ++ EC ++ +     Q    D +  +    +NII   +  +RFE +D + +              ILQ L+    KL  SF    + +  WL  R     +KLF+ I+K+ +    +I+EH ENLD  S   D ID FLIE ++   + G   GF  K L   T +LFGAG ETT+TTL W ++FM  YP IQ+KV +EI   +G  + P M D++++ YT AV+ EI R+  + P+G+      DT +DN+ IPK ++I P       D   W  P  F P+HF+    N +  +  RE   PFG GKR C+GE LA+M
Sbjct:   42 PGPRSLPFIGDLHRIRPAILHLQFKEFAAKYGNVFSLNIFGGKTVVLNGTKLLKEALIQKGDDFVDRPQIPLFSDLIENRGIVMTNGNQWKHQRRFALHTLRNFGLGKKTMEKYIQEECHYITQAFAEHQGKPFDAHPLLNSAVSNIICCLVFGERFEYSDKEYQ-------------QILQDLNEAV-KLQGSFSALAYNVFPWLMKRFPGPLQKLFTLIQKLMDFVKVKIEEHKENLDPASP-KDYIDSFLIEMEK---NQGEDFGFDIKNLCACTLDLFGAGSETTTTTLYWGLLFMIHYPDIQEKVQEEIDAVVGSSRQPSMADKENMPYTDAVVHEIQRMGDIVPIGVARMASRDTILDNYTIPKGTIIIPALHNVLHDESVWETPHSFNPQHFL----NQDGTFRKREAFFPFGAGKRVCLGEQLARM 453          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A3Q0S764 (Uncharacterized protein OS=Amphilophus citrinellus OX=61819 PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 5.971e-70
Identity = 150/449 (33.41%), Postives = 231/449 (51.45%), Query Frame = 2
Query:  113 NLKNRNTSISVGLKNLPIVRGIPIFGILFQK--KGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK--KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSE------GNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            NL  +N       K  P  R  P+ G L Q   K P+H  L+ L  KYGS+F+I  G ++VVVL  ++ +K++L    D F  R   ++V  ++   G+++ +GD W   R F L  LRDFG GK    + +  EC+ ++E  K  +    D    +    +NII   +   RFE  DP+  +    I +  K   S  +Q+L+ MFP L           W+  R++L     ++    ++++L   D   E          +D FL+ KQ L +S      F    L+    +LF AG ETTSTTL W+++FMA+YP IQ +V +E+R  IG  ++ +  DRK+L +T AV+ E  RLSS+ P G+ H+T  D +    FI K + +FP   +   DP+ W +P  F+P HF+    + E K+  R+  +PF  G+R C+GE LA+M
Sbjct:   24 NLSTKNNG-----KEPPGPRSFPVLGNLLQLDLKKPYHTLLE-LSRKYGSVFTIHLGPQKVVVLAGYKTVKEALVTYDDVFGDRNPMRIVHEMAHGHGVVWSNGDSWKEMRRFALTNLRDFGMGKRACEDKITEECQHLIEVFKKFKGEAFDTTQSLSYAVSNIICSIVYGSRFEYNDPEFTSXVNRISRGGKLLGSPSIQVLYNMFPSLFK---------WICDRKELL----QISVINVKQNLAIFDRLKETLNPQMCRGFVDAFLVHKQNLEESGTTNSHFHTDNLLMTVIQLFAAGTETTSTTLRWALLFMAKYPKIQDEVQEELRRVIGDRQVQVA-DRKNLPFTDAVIHETQRLSSIVPTGLPHKTTRDITFHGHFIEKGTTVFPLLTSVLHDPDEWERPHSFYPAHFL----DKEKKFVKRDAFIPFSAGRRVCLGEGLARM 448          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: R9S288 (Cytochrome P450 OS=Oryzias melastigma OX=30732 GN=CYP2P15v1 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 8.239e-70
Identity = 150/434 (34.56%), Postives = 231/434 (53.23%), Query Frame = 2
Query:  161 PIVRGIPIFGILFQ-KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTL--WLTSR-----RKLFSDIEKVFE---EEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            P    +P+ G L + K    H+ +K    KYG++FS+     + VVLN  +++K++L ++GD+F  R +  L + ++ N GI+  +G+ W  QR F L  LR+FG GK    + ++ EC ++ +     Q    D    +    +NII   +  +RFE +D + K              ILQ L+    KL  SF    + +  WL  R     +KLF+ +EK+ +    +I+EH E LD +S   D ID FLIE ++   +     GF  K L   T +LFGAG ETT+TTL W ++FM   P IQ+KV  EI   IG  + P M D++++ YT+AV+ EI R+  + P+G+      DT+++N+ IPK ++I P      +D   W+ P  F P+HF+    N +  +  RE   PFG GKR C+GE LA+M
Sbjct:   42 PGPHSLPLIGDLHRIKPAILHLQVKEFAAKYGNVFSLNIFGGKTVVLNGSKLLKEALIQQGDDFVDRPEIPLFSELTENRGIVMSNGNQWKHQRRFALHTLRNFGLGKKTMEKYIQEECHYVTQAFADHQGKPFDAQPLLNSAVSNIICCLVFGERFEYSDEEYK-------------QILQDLNEAV-KLQGSFAALAYNICPWLMKRFPGPLQKLFAVVEKLMDFVKVKIEEHKEKLDPSSP-KDYIDSFLIEMEK---NHDEDAGFDIKNLCACTLDLFGAGSETTTTTLYWGLLFMIHNPEIQEKVQAEIDAVIGSSRQPSMADKENMPYTEAVIHEIQRMGDIVPIGVARVASRDTTLNNYTIPKGTMIMPALHTVLSDESVWKTPHTFNPQHFL----NPDGTFRKREAFFPFGAGKRVCLGEQLARM 453          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000052034.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000046.1:5870600:5884237:1 gene:ENSAMXG00000018921.2 transcript:ENSAMXT00000052034.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.402 bits (568), Expect = 5.671e-64
Identity = 137/405 (33.83%), Postives = 209/405 (51.60%), Query Frame = 2
Query:  236 LGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQI-LHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEE------EIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            L   YGS+F + FG ++VVVL  ++ +K++L    + F  R   KL   +S   GILF +G++W   R F L  LRDFG GK  S E +  E ++++EE    +    D    +    +NIIS  +   RFE +DP+ K +     +  +      I L+ +FP +           +L S+RKL  + EK  +E       +QE L   D        ID FL+ KQ   +S      F DK L+     LF AG +TT TTL W ++ MA+ PHIQ +V +EI   IG  ++ ++ DRKSL YT AV+ EI R +++ P+ + H T  D   + FFI K + ++P   +   D   W  P  F P+HF+    + + ++  ++  +PF  G+R C+GESLA+M
Sbjct:   42 LAKTYGSVFKVYFGPKKVVVLAGYKTVKQALVNHAEEFGEREIGKLFKNLSEEHGILFSNGENWREMRRFALTNLRDFGMGKRGSEEKIVEEIQYIVEEFGKFEGKAFDTTQPVNNAVSNIISSIVYGSRFEYSDPQFKEMVNRANENVRIGGSAPIRLYNVFPWIGP---------FLKSKRKLERNTEKNRKEINGIISSLQETLHPDDRRG----FIDSFLVRKQSDEKSGQKNSRFNDKNLLSTVLNLFVAGTDTTGTTLRWGLLLMAKNPHIQDRVHEEIDRVIGGRQV-VVEDRKSLPYTDAVIHEIQRCANIVPMSLPHVTSCDVHFNGFFIKKGTTVYPLLTSVLRDESEWESPQTFNPDHFL----DKQGRFAKKDAFMPFSAGRRVCLGESLARM 428          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000019491.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000046.1:5874953:5884237:1 gene:ENSAMXG00000018921.2 transcript:ENSAMXT00000019491.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.402 bits (568), Expect = 5.974e-64
Identity = 137/405 (33.83%), Postives = 209/405 (51.60%), Query Frame = 2
Query:  236 LGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQI-LHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEE------EIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            L   YGS+F + FG ++VVVL  ++ +K++L    + F  R   KL   +S   GILF +G++W   R F L  LRDFG GK  S E +  E ++++EE    +    D    +    +NIIS  +   RFE +DP+ K +     +  +      I L+ +FP +           +L S+RKL  + EK  +E       +QE L   D        ID FL+ KQ   +S      F DK L+     LF AG +TT TTL W ++ MA+ PHIQ +V +EI   IG  ++ ++ DRKSL YT AV+ EI R +++ P+ + H T  D   + FFI K + ++P   +   D   W  P  F P+HF+    + + ++  ++  +PF  G+R C+GESLA+M
Sbjct:   40 LAKTYGSVFKVYFGPKKVVVLAGYKTVKQALVNHAEEFGEREIGKLFKNLSEEHGILFSNGENWREMRRFALTNLRDFGMGKRGSEEKIVEEIQYIVEEFGKFEGKAFDTTQPVNNAVSNIISSIVYGSRFEYSDPQFKEMVNRANENVRIGGSAPIRLYNVFPWIGP---------FLKSKRKLERNTEKNRKEINGIISSLQETLHPDDRRG----FIDSFLVRKQSDEKSGQKNSRFNDKNLLSTVLNLFVAGTDTTGTTLRWGLLLMAKNPHIQDRVHEEIDRVIGGRQV-VVEDRKSLPYTDAVIHEIQRCANIVPMSLPHVTSCDVHFNGFFIKKGTTVYPLLTSVLRDESEWESPQTFNPDHFL----DKQGRFAKKDAFMPFSAGRRVCLGESLARM 426          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: cyp2n13 (cytochrome P450 2J6-like [Source:NCBI gene;Acc:103035066])

HSP 1 Score: 223.402 bits (568), Expect = 9.885e-64
Identity = 147/447 (32.89%), Postives = 234/447 (52.35%), Query Frame = 2
Query:  116 LKNRNTSISVGLKNLPIVRGIPIFGILFQKKGP-FHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVT-IISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHL---MFPKLDDSFIISTFTLWLTSRRK-LFSDIEKVFE---EEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            LKN+N   S+   + P+   +P  G +     P  HIYL  LG  Y +IFS++ G +++++L  ++++K++L  + DNF  R  + L   I S N G+   +G+ W  QR F L  LR+FG GK      +  E  F+L+E+   +    D         +NII + +  +R++  D       +   Q  K ++  + +HL   ++ +L +SF        L  R   +FS+ E + E   + + +H  NLD  S   D +D FLIEK+    S     GF+DK L+  T +LF AG ETT+T+LGW+++++A+ P IQ KV +EI   IG  + P M D+ ++ YT+AV+ EILR   + PL        DT++  + IPK + I P   +   D + W  P  F P+HF+    + E K+  R+  + F  GKR C+GE LA+M
Sbjct:   29 LKNKN---SLNFPSGPLA--LPFLGNILDIASPQPHIYLTKLGKAYNNIFSMRIGQQKMILLTGYKMVKEALVNQTDNFVDRPYSPLAERIYSGNGGLFTSNGNLWKKQRRFALSTLRNFGLGKKTMELAICEESHFLLDEMDRHKGQAFDPSGLFNNAVSNIICQLVFGQRYDYAD-------YDFQQMLKYTS--EAIHLEGSIWGRLYESF--PNIMKHLPGRHNVIFSNYEHISEFIKKNLDKHKANLD-PSNPRDYMDSFLIEKE---NSHDPADGFSDKNLVRCTLDLFLAGTETTTTSLGWALIYLAKNPEIQDKVQEEIDRVIGQSRQPGMADKPNMPYTEAVIHEILRRGDIVPLSGPRVAAKDTTLGGYAIPKGTTIMPILHSVLFDEDEWETPNSFNPQHFL----DKEGKFVRRDAFLAFSAGKRVCLGEQLARM 451          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: cyp2v1 (cytochrome P450, family 2, subfamily V, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040912-139])

HSP 1 Score: 216.853 bits (551), Expect = 2.833e-61
Identity = 143/446 (32.06%), Postives = 227/446 (50.90%), Query Frame = 2
Query:  116 LKNRNTSISVGLKNLPI-VRGIPIFGILFQ-KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK-KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKV---FEEEIQEHLENLDFNSEGNDLIDRFL--IEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            LKNR        KN P     +P+FG  F       HI+L  +  KYG I+S++ G    VV+N++ ++K++L ++ + F+ R    +   I+   GI F +G  W  QR F L  L+ FG GK      +  E  F+ + + +++    + + FI    +NII   +  +RFE TD K   +   I +  + + ++   L+  FP            L     +++FS+ ++V     EEI++H    D  S   D ID +L  IEK+R       + GF  + L +   +LF AG ETTSTTL W+ VFM +YP IQ+KV  EI   IG  + P M DR ++ YT AV+ E+ R  ++ PL +   +  +T++  + IPK + I PN  +   D   W+ P  F P++F+    N + ++   +  +PF  GKR C+GESLA+M
Sbjct:   34 LKNRKP------KNFPPGPTSLPLFGNFFNLDHKQLHIHLTKMSRKYGRIYSLQLGGTHFVVVNSYSLVKEALVDQAETFADRPPNAVFHKINKCQGIAFNNGYSWKQQRRFTLSTLKSFGIGKRNLESSITQEFDFLHQAIINMKGESFNPHFFINNAVSNIICSLVFGRRFEYTDKKFLTMLSLISRAIQLEGSVWAQLYNAFPHF--------MGLMPGPHQEMFSNFKQVEVFLNEEIEKHRAEWD-PSSPRDYIDCYLSEIEKRR----DDEEAGFNTEGLCYSVLDLFVAGTETTSTTLLWAFVFMMKYPEIQEKVQAEIDRVIGHSRQPSMADRPNMPYTDAVIHEVQRRGNIVPLNVPRMSTKETTLGGYSIPKGTQIIPNLTSVLFDETQWKSPHSFDPQNFL----NNQGEFIRPDAFIPFSAGKRLCLGESLARM 456          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000019474.2 (cytochrome P450 2K1-like [Source:NCBI gene;Acc:103034280])

HSP 1 Score: 211.846 bits (538), Expect = 1.487e-59
Identity = 133/407 (32.68%), Postives = 209/407 (51.35%), Query Frame = 2
Query:  218 HIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQIL-HLMFPKLDDSFIISTFTLWLTSRRKLFSDIEK--VFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            H  L  L   YGS+F + FG ++VVVL  ++ +K++L    + F  R  + +    +   GILF +G++W   R F L  LRDFG GK  S E +  E +++ E  +S      D    +    +NIIS  +   RFE +DP+ K +     +  +      +L + MFP             +L S +KLF + EK  V   E+ + L+      E    +D FL+ KQ + +S      F +K LI     LF AG +T+ TTL W ++ MA+ PHIQ +V +EI   IG  ++ ++ DRKSL YT AV+ EI R +++ P+ + H T  D   + FFI K + ++P   +   D   W  P  F P+HF+    + + ++  ++  +PF  G+R C+GESLA+M
Sbjct:   63 HESLCELAKTYGSVFKVYFGPKKVVVLAGYKTVKQALVNHAEEFGEREVSPMFKKYNEEHGILFSNGENWREMRRFALSNLRDFGMGKRGSEEKIIEEIQYLKEVFESFGGKAFDTTQPVNNAVSNIISSIVYGSRFEYSDPQFKEMVNRANENVRIGGSASVLVYNMFPWTGR---------FLRSVQKLFVNNEKNRVQIRELVKGLQETLNTEERRGFVDSFLLRKQ-IDESNEKASYFNEKNLIVTVGNLFVAGTDTSGTTLRWGLLLMAKNPHIQDRVHEEIDRVIGGRQV-VVEDRKSLPYTDAVIHEIQRCANIVPMSLPHVTSCDVHFNGFFIKKGTTVYPLLTSVLRDESEWESPRTFNPDHFL----DKQGQFLKKDAFMPFSAGRRVCLGESLARM 454          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011254.1 (pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 gene:ENSPMAG00000010227.1 transcript:ENSPMAT00000011254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.134 bits (505), Expect = 1.037e-55
Identity = 127/409 (31.05%), Postives = 205/409 (50.12%), Query Frame = 2
Query:  218 HIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFID-GDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAI-FQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLF---SDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            HI ++ L  KYG + +I  G   VV+++ +  +K+ L   G  F+ R  T + T ++ N GI     GD W  QR F L  LR+FGFGK+   + +  E K+++E  K  + +  D +  +     NII   +   R++  + + + +   + +    ++  L IL  +FP     F++     W    +K+F   S ++ +  + + EH    D      DLID +L +  +  +       FT + LI +  ELF  G ETTS TL W ++FM   P IQ +   EI   +G E+ P M DR+SL Y  AV+ EI R  +V PLG+ H T  D   +++  PK + +  N  +   D   W+ P +F P+HF+   ++G+   +  +  +PF  G R C+GESLAKM
Sbjct:   60 HIAMQELAKKYGEVCTIMLGSTPVVLVSGYEAVKEVLVNRGHEFADRPITPIFTKLTQNIGIALAPYGDPWKQQRRFALSTLRNFGFGKATIADKISIEAKYLIETFKQ-ETSAFDPHLNLNNALGNIICCLLNRNRYDYDNEQFQKLTHLLEYLVQLQAEPLVILCNVFP-----FLLKLPGPW----QKVFHIHSKLQCLLNDIVSEHRATKD-QHNPRDLIDSYLAQIDK--EKDNPNSSFTHQSLIQILIELFIGGLETTSNTLRWGLLFMMMNPDIQARCHGEIDRVVGSERPPCMTDRRSLPYLDAVIHEIQRFGNVLPLGVLHATSKDVQFNDYLFPKGTHVMVNLMSALHDDIHWKTPNKFNPDHFLD--KDGQCIQS--DAFLPFSAGPRVCLGESLAKM 451          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011205.1 (pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1 gene:ENSPMAG00000010178.1 transcript:ENSPMAT00000011205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.512 bits (493), Expect = 6.226e-54
Identity = 129/425 (30.35%), Postives = 212/425 (49.88%), Query Frame = 2
Query:  161 PIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFID-GDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK-KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            P  + IP  G +   K P  + L  +  +YG + S+  G   +V ++ ++ +K+ L  +G  F+ R  T     ++   GI+F   G +W   R F L  LR+FG GKS   + +++E  F++E  K  + +  D +  +     NII   +  KR+E +D + +     +    + +S +L  L  +FP L D            ++ K F        + I E     D   +   LID +L    +L +       F+++ LI +  +LF AG ETTSTTL W +++M  +P IQ +  +EI + +G +++P M DR SL Y  AV+ EI R S++ P G  H T +D     + IPK ++I  N  +  +D   W+ P+EF PE+F+   E+G  K+   +  +PF  G R C+GE+LAKM
Sbjct:   55 PGPKVIPFLGNVSLFKKP-DVALDEVTKQYGEVCSVMVGKISMVFVSGYQAVKEVLVHQGHEFADRPNTPFNKKVNGGLGIIFAPYGKYWMQHRRFTLSTLRNFGLGKSSIEQTIQAEVGFLIEAFKQ-KGSAFDPHYDLNSAVGNIICSMVKGKRYEYSDKQFQDFLHLVENNLQLQSGLLGTLCNIFPFLMDFPGPQQIIFKSMAKSKQF------IRDIISERHATRD-PIKPMCLIDAYL---SQLEKEDNPNSSFSEQSLIMLALDLFIAGAETTSTTLRWGLLYMMMHPEIQAQCHEEIDKIVGSDRLPCMEDRHSLPYLDAVIHEIQRFSNIVPFGAPHATTADVKFRQYLIPKGTIIMVNMKSVLSDENHWKTPYEFSPENFLD--EDG--KFVKPDAFLPFSAGPRVCLGENLAKM 463          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011204.1 (pep scaffold:Pmarinus_7.0:GL477378:78074:79555:1 gene:ENSPMAG00000010177.1 transcript:ENSPMAT00000011204.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 184.496 bits (467), Expect = 1.156e-50
Identity = 132/435 (30.34%), Postives = 216/435 (49.66%), Query Frame = 2
Query:  140 SVGLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFID-GDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK-KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLF---SDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            S G K LP++  I  F      K P HI ++ L  KYG + +I  G   VV+++ ++ +K+ L   G  F+ R  T L T ++ N GI     GD W  QR F L  LR+FGFGK+   + +  E ++++E  K  + +  D    +     NII   +   R++  + + + +   +    + ++  L IL  +FP     F+I     W    +K+F   + ++ + ++ + EH    D      DLID +L    +  +     + FTD+ LI +  ELF  G ETTS TL W ++FM   P IQ +  +EI + +G ++ P M DR+SL Y  AV+ EI R  ++ P G+ H T  D   + +  PK + +  N  +   D   W+ P +F P++F+   ++G+   +  +  +PF  G   C GESLAKM
Sbjct:   35 SPGPKPLPLLGNITAFSC----KNP-HIGMQELAKKYGEVCTIMLGSTPVVLVSGYQAVKEVLVNRGHEFADRPITPLFTKLTHNIGIALAPYGDTWKQQRGFALSTLRNFGFGKATITDKISIEARYLIETFKQ-ETSEFDPKFILNSAVGNIICSLLNGIRYDYNNEQFQKLTHLLEHLVQLQAEPLVILCNVFP-----FLIKLPGPW----QKVFHIHTKLQCLLKDIVSEHRATKD-QHNPRDLIDSYLAHIDK--EKDNPNRSFTDQTLILLLIELFIGGMETTSNTLCWGLLFMMMNPDIQARCHEEIDKVVGSQRPPCMKDRRSLPYLDAVIHEIQRFGNILPFGVLHPTSKDVQFNEYVFPKGTHVMVNLMSAFYDDIHWKTPHKFNPDNFLD--KDGQCIKS--DAFLPFPAGPCVCFGESLAKM 447          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: cyp17a1 (cytochrome P450, family 17, subfamily A, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040213-2])

HSP 1 Score: 173.326 bits (438), Expect = 1.729e-46
Identity = 119/413 (28.81%), Postives = 191/413 (46.25%), Query Frame = 2
Query:  215 FHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDH---WHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHL-MFPKLDDSFIISTFTLWLTSRRKLFSDIEK---VFEEEIQEHLENLDFNSEGN--DLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAK 1426
             HI+L  L   YG+++ ++ G  ++VVLNN   IK+ L ++  +F+GR QT     I+   G     GD+   W  QR   L  L     G +R+ EIV+ E + ++E+L        D +  I +   N+I       ++++ D +   I   +    +      I  L  FP L     +     W    R L + + K   V   +I  H      +   +  D + +F    +   +S       T++++     + F AG ETT+T + W++ ++  +P +Q ++++E+ + +     P + DR  L Y  A + EILRL  V PL I HR   D+SV  FFI K S +  N +A H D   W  P  F P  F+  +     +  P   L+PFG GKR C+GESLAK
Sbjct:   64 LHIHLTQLARTYGAVYCLRVGGEDIVVLNNVESIKEMLIKKSADFAGRPQTYAGGKIT-GGGKDIALGDYSAVWRRQRRAALSALH--CVGTARTEEIVQGEAQRLVEDLTQYIGRPTDIHTDISMRVCNVICSVAFGTKYDKHDTEFLDIHCCLDSLVRLWGSPAIRALDCFPVLR----LFPNPAW----RDLMAAVRKRDEVVWRQILLHKAKPSSSPSSDMTDFLLKFTRHSRNEEESEARGGILTEERVHLSIMDTFIAGVETTATLIEWALAYLVLHPEVQDQIYEEMEQKLQPGLGPSLADRDKLLYLDATIKEILRLCPVAPLAIPHRALRDSSVGGFFICKGSTVIANLWAAHRDHAHWDNPSVFQPGRFLGESLE---RRNPASLLLPFGAGKRVCLGESLAK 462          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001876.1 (pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 gene:ENSPMAG00000001674.1 transcript:ENSPMAT00000001876.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.007 bits (419), Expect = 3.198e-44
Identity = 124/432 (28.70%), Postives = 196/432 (45.37%), Query Frame = 2
Query:  161 PIVRGIPIFGILFQ---KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLN-TGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPK-IKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDF---NSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPF-GIGKRQCIGESLAKM 1429
            P  RG+P+ G LFQ   K  P    L  L   YG I+S+  G   VVVL    IIK++L  + + F  R +  +      N  G+L   G  W  +R F L +LR+FG G     E +  E +F++  +++ Q+   D ++ I    AN+I       R++  +   +K ++          N    +   FP L           +     +  +  + V    IQ  +E  D      E  D +D F+   +R+  S      F+D  LI  T  LF AG ETTS TL W ++ M  YP +Q++V +EI   +G  + P   DR  + YT A + EI R +++ P+   H T  DT +  +F+PK + +     +   +   W  P +F P HF+    N    +  R D + F  +G R C+G++LA+M
Sbjct:   42 PGPRGLPLVGNLFQLDLKALP--ASLDKLSETYGPIYSVSLGQTRVVVLVGNEIIKEALVTQAEMFIDRPEIPVFKKSLGNYEGLLLSHGWQWRARRRFTLMMLRNFGMGTKSIEEKIAEEAEFLVRAIENKQEKPFDAHSEINKSAANVICSITFGDRYDWNNKTFVKLMDIITENVELSGNDWSQIFNSFPVLK----------YFPGPHQRINKNKVVLNAFIQARIEEHDMARIQGEPRDYLDAFI--DKRIEDSMNPDTAFSDIALINTTANLFVAGSETTSATLKWGILLMLTYPKVQEQVQEEIDRVVGSNRRPACADRACMPYTNATVHEIQRYANILPMAFPHATTCDTKLRGYFLPKGTQVIALIHSALREKSLWEAPEQFNPGHFLDIDGN----FYNRNDFMAFSAVGPRICLGKNLARM 455          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Match: ERG5 (C-22 sterol desaturase; a cytochrome P450 enzyme that catalyzes the formation of the C-22(23) double bond in the sterol side chain in ergosterol biosynthesis; may be a target of azole antifungal drugs [Source:SGD;Acc:S000004617])

HSP 1 Score: 57.3806 bits (137), Expect = 6.364e-9
Identity = 41/170 (24.12%), Postives = 75/170 (44.12%), Query Frame = 2
Query:  932 FTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDE---IREN-----IGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGES 1417
            FT+K++    F    A  + +S+   W    +A  P +  K+ +E   +R N     + L+ I      + + YT  V+ E LR      +  Y    +     N+  PK +++ P  +    DPE +  P EF PE ++  ++  E K    ++ + FG G   C+G++
Sbjct:  321 FTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLI------EKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAK----KNWLVFGCGPHVCLGQT 480          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Match: ERG11 (Lanosterol 14-alpha-demethylase; catalyzes C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in ergosterol biosynthesis pathway; transcriptionally down-regulated when ergosterol is in excess; member of cytochrome P450 family; associated and coordinately regulated with the P450 reductase Ncp1p; human CYP51A1 functionally complements the lethality of the erg11 null mutation [Source:SGD;Acc:S000001049])

HSP 1 Score: 50.0618 bits (118), Expect = 1.014e-6
Identity = 84/364 (23.08%), Postives = 137/364 (37.64%), Query Frame = 2
Query:  473 FGKSRSYEIVESECKFMLEELKSLQKTVLD---FYNFIPIYTANIISKFIMNKRF---ERT----DPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEG---------------NDLIDRFLIEKQRLVQSTGNQQG--FTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDE-IRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHF-----------ISSTENGE--------LKYTPREDLVPFGIGKRQCIGESLA 1423
            FGK   Y+   S     L E K   K  L    F +++P+    +   F  +K F   ERT    D  +   E  IF  ++      +   M  KLD     + F    +   K F+ I  VF     EH    D   +                ND+ DR LI+   L++++  + G   TD+++  +   +   G  T++ T  W ++ +A  P +Q+++++E +R   G +K    +  + +      + E LR+    PL   H  F     D   +P  S + P  +     P       E+FP               SS   GE        +        +PFG G+ +CIGE  A
Sbjct:  134 FGKGVIYDCPNSR----LMEQKKFVKGALTKEAFKSYVPLIAEEVYKYFRDSKNFRLNERTTGTIDVMVTQPEMTIFTASRS----LLGKEMRAKLD-----TDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNNDIQDRDLIDS--LMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLLQEMPLLNQTIKETLRMHH--PL---HSLFRKVMKD-MHVPNTSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFA 476          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Match: DIT2 (N-formyltyrosine oxidase; sporulation-specific microsomal enzyme involved in the production of N,N-bisformyl dityrosine required for spore wall maturation, homologous to cytochrome P-450s; SWAT-GFP and mCherry fusion proteins localize to the endoplasmic reticulum and vacuole respectively [Source:SGD;Acc:S000002810])

HSP 1 Score: 47.7506 bits (112), Expect = 6.166e-6
Identity = 67/261 (25.67%), Postives = 107/261 (41.00%), Query Frame = 2
Query:  686 KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQS----TGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPH-IQKKVFDE---IRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLG-IYHRTFSDTSV--DNFFIPKNSLIFPNYFACHTDPETW-RKPFEFFPEHFISSTENGELKY---TPREDLVPFGIGKRQCIGESLA 1423
            K  I     L FP LD         L + SR+K F D+   F E + + +++        +L++ +  E+     S      N +    KQL      +  AG+E        S+  +A+Y +  Q+K+  E   I +  GL  +P++N         A + E++R+    PL  I +R  + T        IPK   +  N F    DP+TW     +F PE + S  E     +     R  +  F  G+R C+GE LA
Sbjct:  209 KKQIFHPFFLTFPFLD--------VLPIPSRKKAFKDVVS-FRELLVKRVQD--------ELVNNYKFEQTTFAASDLIRAHNNEIIDYKQLTDNIVIILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDPKGLADLPLLN---------AFLFEVVRMYP--PLSTIINRCTTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTADDFKPERWGSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLA 441          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO48191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK60])

HSP 1 Score: 174.866 bits (442), Expect = 2.208e-47
Identity = 114/410 (27.80%), Postives = 201/410 (49.02%), Query Frame = 2
Query:  209 GPF-HIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLN-TGILFID-GDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            GP  H+ L  L   YG +F +K G   +VV+N+    +++L    ++F+GR      ++IS N T I F D G  W  QR      LR FG G     E +  E   +++ L  ++    +  + + +   NII  F+   R++  DP+   +     Q  +      ++   FP     ++       L   ++   + + V +++ QEHL   + +    DL D  L+   +  Q        T+  +I    ++F AG ETT+T++ WS+V++ R P +Q+++  +I E +G ++ P ++DR++L   +A + E+LR SS+ PL   H T +DT +  + +PK++++  N +  H DP+ W  P EF P  F+   + G+         +PF  G+R C+ ESL KM
Sbjct:    5 GPTPHLGLTELAKSYGEVFRLKVGSHRIVVVNSIEAAREALVRRANDFAGRPMLYTASLISRNGTDIAFGDFGPLWKQQRKIAHSALRMFGSGLKPLEEKITVEADELIKRLSLVEGRAHNPKDDVNLAVLNIICSFVFGSRYDMDDPEFHTVVDYTEQFVQGFRAASLVD-YFP-----WLRHLPNKGLRQIKEACQNRDVVLQKKYQEHLVTYE-HGVIRDLTDA-LLSANKASQEESAYLPMTEDHIIMTMNDIFSAGLETTATSILWSLVYLIRNPKVQEQLHQQIDEVVGRDRAPELSDRENLPLIEATIAEVLRSSSLVPLLFPHSTTTDTHLRGYEVPKDTIVLFNVWNMHHDPQRWSNPDEFDPTRFLD--DKGKFICPATLSYLPFSAGRRVCLAESLGKM 404          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO37670 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF10])

HSP 1 Score: 162.925 bits (411), Expect = 6.858e-44
Identity = 116/409 (28.36%), Postives = 197/409 (48.17%), Query Frame = 2
Query:  227 LKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQ---RTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKS-LQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLI----EKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            +  L  KYG I+S+    ++ VVLN+  + +++L    D FSGR  T +   I+ ++  + I  DH  T    R    K L+ +G G  R            LE L + L+++ L F++      A+++SK              + I++A                   K+ D  +           RK     EK FE      +EN + N E NDL D  L     EK+ L ++    +  T+  ++    ++F AG+ETT+T + W + +++++P +Q K+  E+ E IG  ++P + DR ++ Y +A + EILR+ S+ PL + H+   DT++  + +PK + +  N +A H DPE W  P EF P  F+ +  +G  +    +  +PF  G+R C+GE+LAKM
Sbjct:    1 MTELAKKYGKIYSLTLPGQQCVVLNSSELAREALLTRKDEFSGRPSTFVGDFITRSSADI-ICADHTQTMVRLRKIAHKALQMYGRGMQR------------LEALSTNLRRSKLHFFS----DPASLVSK------------SSRLIKYAC------------------KIRDDILT----------RKYLEHKEK-FE------IENANNNFEVNDLTDALLQAFADEKRELRKA----EALTEDNIMMTMNDVFNAGFETTTTAILWLIAYLSKHPDVQDKIHAELDEVIGGSRMPQLKDRHNMPYIEATIAEILRIRSIVPLALPHKATCDTTLSGYDVPKGTTVIVNLWAIHHDPEEWLNPEEFDPSRFLDA--DGSYRAAGEKSFLPFSAGRRSCLGEALAKM 339          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO40930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T4])

HSP 1 Score: 163.696 bits (413), Expect = 3.471e-43
Identity = 122/448 (27.23%), Postives = 215/448 (47.99%), Query Frame = 2
Query:  131 TSISVGLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGR-WQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEE----LKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSR-RKLFSDIEKV----FEEEIQEHLENLDFNSEGNDLIDRF---LIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEK--IPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            +++  G +  P++   P+    F      H+ L  L   YGS++++    +  V++ + +  ++ L E  D  +GR +   L  + + +  I F D        TF+LK  R       R Y  VE +    LEE    +K+L  T  D ++ + + T N+++       +   DP+   +   I  +T+    +  L  MFP          F + L  R  KL   I K     F +++Q H+++ D  S   DL D +   L E ++  +     +  + + +  +  ++   G ET+STT+GW + ++A YP +Q ++  ++ + IG +K  +  + DR  L Y +AV+ E +R+S+  PL I H+   DT+++ +FIPK++ +  N +  H DP  W  P  F P  F+   E+G  K+   E L+PFG G+R C GE +AKM
Sbjct:   26 SNLPPGPRPYPLIGNTPLLIGSFSS---LHVKLTELAKIYGSVYTLYLNGQRSVIVCSAKAAREGLVERKDAIAGRPYSFTLDYVTNGSKNITFSD-----FCPTFLLKK-RIAQSSMRRYYPQVEDKVNNQLEEVLARIKALDGTAFDPHHLLSLVTLNLVTSMTFGTNYTLDDPEFLLLVQMIDDSTRSIGSMSTLD-MFP----------FLMHLPIRTSKLLKSITKTVNEYFMKQVQRHIDSNDGKSI-RDLTDGYIKGLTEAEK--EDASVHEVNSIEHIAMVMADMIVPGSETSSTTMGWMIAYLAVYPEVQARLHQQLDDVIGRDKNTVITLKDRDRLPYVEAVIAETMRISTAVPLAIPHKATCDTTINGYFIPKDTTVIFNLWGVHLDPTEWADPHVFNPARFLD--EDG--KFIKSEKLLPFGAGRRVCPGEKIAKM 446          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO46605 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPN7])

HSP 1 Score: 160.614 bits (405), Expect = 2.473e-42
Identity = 120/438 (27.40%), Postives = 211/438 (48.17%), Query Frame = 2
Query:  152 KNLPIVRGIPIFGIL--FQKKGP-FHIYLKNLGHKYG-SIFSIKFGMREVVVLNNFRIIKKSL-KEEGDNFSGRWQTKLVTIISLNTGILFIDGDH---WHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPK---IKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGF-TDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            KN P   G P++  +  F + GP  H  L +LG +YG  +F ++   +  V+++N ++ ++ L K+ G + + R    ++  IS N G   I G +   W  QR  V   LR +G G      ++  E   + +   + Q   +D    + +   N+I   +  KR+   D +   I A   ++ +     N L  +++ + +     ++      +T+R       +++ + +I EH E      E  DL D  L   +   Q   N     T+  L+    ++F AG+ETT+T L W  +++A YP +Q ++  E+ + I   + P++ DRKSL Y +A + E+LR+S V PL I  +     ++  + IP+ + ++ N +A H D   W  P++F P  F+  T N    Y+    ++PFG G R C+GESLAKM
Sbjct:   26 KNAP--PGPPLYPFVGNFPQIGPVLHKSLTSLGKQYGRGVFQVQLLGKRFVIIDNIKLARQVLLKKNGRDVADRTSAYVIDAISRN-GCSVIFGKYSPTWKLQRRVVHSALRMYGSGVRILEALILQEVDNLCDIFANSQGAPVDTKLPLTLSVMNVICALVFGKRYGLDDAEFTDIVATTESMAKLASPENPL--IYMPWLRFFPLQVVKKMKETVTAR-------DRLIQRKITEHRETYK-EGEIRDLTDALLKSLEDAKQEDNNAMSLLTEDHLLIAINDVFMAGFETTTTALRWIFLYVAAYPEVQARIHQELDDVISFGRDPLIADRKSLPYLEATILEVLRISPVFPL-IRRKARKQLNIGGYCIPEETFVYVNLWAIHHDEAEWVDPYKFRPSRFLEGT-NSASAYS----MLPFGAGVRVCVGESLAKM 444          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO42736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0I4])

HSP 1 Score: 159.458 bits (402), Expect = 6.492e-42
Identity = 136/485 (28.04%), Postives = 231/485 (47.63%), Query Frame = 2
Query:  155 NLPI-VRGIPIFGILFQKKGP-FHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKS-LKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHT---QRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAI-EFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGN--DLIDRFLIEKQRLVQSTGNQQGF-TDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKMXXXXXXXXXXXXXXXKFAENISDKLYQENLEGNDGIIRYSKIKNFIFHKR 1579
            NLP   + +P+ G L    G   H+ +  L   YG +F+++     +V +N+    K++ L +  D+F+GR +      I+ N   + + GD+      +R      LR +     R   I+  +       + + +   +D  +   +   NII  F+  K +   DP+ K I +F I+  + +  +   +  +FP L   F + +  L+   R      ++K+F       L + +   EGN  DL D  L  K  + +      G  TD  +I M  ++FG G E+T ++L W + F+  +P +Q +   E+ + IG EK P + DR+ L Y +AV+ E LR+ S  PL I H+   DT+     IPK + +  N +A H DP+ W  P EF+P  FI+S  NGE +   +   +PF +G+R C+G+S+AK E F+    + Q +  +   +      +  LEG  G+ RY  I++F F  R
Sbjct:    6 NLPDGPKPLPLIGNLHNIAGSEIHLAVTKLVKDYGDVFTLRILGESIVFINSGAAAKEAMLGKHMDDFAGRPKKFTFDYITRNCQDIIL-GDYSRALNWRRKVFHSALRMYA---PRFDNIIREQIVAFESRMDASEGLPVDSRDEFALLILNIICSFVCGKTYSLDDPEFKKIKQFNIY--SAEVPVATCILNIFPWLI-HFPLKSSRLFKGFRNTRDEVLDKIF-------LAHKETFQEGNIRDLADALLQAKIEIEREDKKAVGMVTDDHVIMMLSDIFGGGLESTISSLRWCVAFLIYHPEVQARAQAELDDVIG-EKFPTLADREKLPYIEAVIAETLRMGSNVPLAIPHKAIRDTAFRERAIPKGTTVLLNLWAIHRDPKEWSNPEEFYPGRFINS--NGEFEVPSKLSFLPFSLGRRVCVGQSVAKAELFLIVARMIQRYTFETPRDTP----RPCLEGVVGVTRY--IEDFKFCAR 467          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000018818.2 (cytochrome P450 2J2 [Source:NCBI gene;Acc:101157767])

HSP 1 Score: 244.973 bits (624), Expect = 1.071e-71
Identity = 151/434 (34.79%), Postives = 226/434 (52.07%), Query Frame = 2
Query:  161 PIVRGIPIFGILFQ-KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTL--WLTSR-----RKLFSDIEKVFE---EEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            P  R +P  G L + +    H+  K    KYG++FS+     + VVLN  +++K++L ++GD+F  R Q  L + +  N GI+  +G  W  QR F L  LR+FG GK    + ++ EC ++ +     Q    D    +    +NII   +  +RFE +D + +              ILQ L  +  KL  SF    + +  WL  R     +KLF+ ++K+ +    +I+EH ENLD  +   D ID FLIE ++   + G   GF  K L   T +LFGAG ETT+TTL W ++FM  YP IQ++V  EI   IG  + P M D++++ YT AV+ EI R+  + P+G+      DT +DN+ IPK ++I P       D   W  P  F P+HF+    N +  +  RE   PFG GKR C+GE LA+M
Sbjct:   42 PGPRSLPFIGDLHRIRPTILHLQFKEFAAKYGNVFSLNIFGGKTVVLNGTKLLKEALIQKGDDFVDRPQIPLFSDLIENKGIVMTNGIQWKHQRRFALHTLRNFGLGKKTMEKYIQEECHYITQAFAEHQGKPFDAQPLLNSAVSNIICCLVFGERFEYSDKEYQ-------------QILQDLTEVV-KLQGSFSALAYNVFPWLMKRFPGPLQKLFTLVDKIMDFVKIKIEEHKENLD-PACPKDYIDSFLIEMEK---NQGEDFGFDIKNLCACTLDLFGAGSETTTTTLYWGLLFMIHYPDIQEEVHAEIDAVIGSSRQPSMADKENMPYTDAVIHEIQRMGDIVPIGVARMASRDTMLDNYTIPKGTMIMPALHTVLHDESVWETPHSFNPQHFL----NQDGTFKKREAFFPFGAGKRVCLGEQLARM 453          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000020799.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101155419])

HSP 1 Score: 236.498 bits (602), Expect = 3.622e-68
Identity = 145/411 (35.28%), Postives = 215/411 (52.31%), Query Frame = 2
Query:  209 GPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSF--IISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQG--FTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            G  H     L  +YG ++S++FG R  VVLN  + +K++L  +GD+   R    L   I+   G++F +G +W  QR F L  LR FGFGK     ++ +E     EELK  +   LD +  I    +NII   +   RF   D K K +             LQI   ++ +L +SF  I+        + + ++ +++    EE++EH ++ D  S+  D ID +L E    +Q T  Q+G  F ++ LI    +LF AG ETTSTTL W+ ++MA+YP IQ+KV  EI + IG  + P M DR  L YT AV+ E+ R+ ++ PL + H T  D  +  F IPK  LI PN  +   D + W  P  F P HF+    N + K+  R   +PF  GKR C+GE+LA+M
Sbjct:   83 GRPHESFSKLAAEYGDLYSLRFGQRWTVVLNGHKALKEALVTKGDSVVDRPHLPLQDEIAKGLGVIFSNGANWTEQRRFALSTLRYFGFGKKSLEPVILNEFAHCAEELKRFKGEPLDPHLIINNTVSNIICHLVFGHRFNYGDKKFKKLMLLF------DRALQIEASIWAQLYNSFTLIMRCLPGPHKTLQHIWREVQDFIGEELKEHKKSWD-PSDARDYIDFYLTE----IQKTKGQEGSTFDEENLIMCVLDLFVAGSETTSTTLRWAFLYMAKYPEIQEKVQAEIHKVIGKSRPPCMEDRAELPYTDAVIHEVQRIGNIVPLSLPHATNKDVQLGGFTIPKGVLIIPNLTSVLFDEKEWETPHAFNPGHFL----NKDGKFVKRGAFIPFSAGKRLCLGENLARM 478          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000019638.2 (cytochrome P450 2K1 [Source:NCBI gene;Acc:101157991])

HSP 1 Score: 235.343 bits (599), Expect = 4.709e-68
Identity = 139/427 (32.55%), Postives = 217/427 (50.82%), Query Frame = 2
Query:  161 PIVRGIPIFGILFQ--KKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLF--SDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            P  R +PI G L Q   K P+   L+     YG +F++ FG  +VVVL  ++ +K +L    + F  R    ++  ++   G+L+ +GD W   R F L  LRDFG GK    + +  EC+++LE  K  +    D    +    +NII   +   RFE  DPK  ++     +  + S          P L    ++     W+ SRR++   +   +   + I  HL+           +D FL++ Q L +S      F D+ L+     LF AG ETTSTTL W ++ MA+YP IQ +V DE+R  IG +++  ++DRK+L +T AV+ EI RL+S+ P  + H+T  D +   +FI K + +FP   +   D   W KP  F+P HF+    + + K+  RE  +PF  G+R C+GESLA+M
Sbjct:   42 PGPRPLPIIGNLMQIDLKRPYKT-LEEFSKTYGPVFTVFFGGEKVVVLAGYKTVKNALVNHDEEFGERAIPPIIQELNKGLGVLWSNGDIWRDIRRFALTNLRDFGMGKKACEDKITEECQYLLEVFKKFKGNAFDTTKPLNYAVSNIICSMVYGSRFEYDDPKFTSMVDRTNRNIQLSGS--------PTLQAYNMVPWLFKWVASRREVHECAAANRKQNQSIFSHLKETLNPQMCRGFVDAFLVKGQTLEKSGVTNSAFNDENLLMTVIHLFAAGTETTSTTLRWGLLLMAKYPKIQDQVQDELRRVIG-DRMVQVSDRKNLPFTDAVIHEIQRLASIVPTALPHKTSKDVTFQGYFIKKGTTVFPLLTSVLHDANEWEKPHTFYPAHFL----DKDGKFVKREAFIPFSAGRRICLGESLARM 454          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000010152.2 (cytochrome P450 2K1 [Source:NCBI gene;Acc:101174506])

HSP 1 Score: 224.942 bits (572), Expect = 3.158e-64
Identity = 133/407 (32.68%), Postives = 223/407 (54.79%), Query Frame = 2
Query:  218 HIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTK-KSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEE--EIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            H  L  L   YG +F++ FG+++VVVL  ++ +K++L    + F  R  T +   ++   GILF +G+ W   R F L  LRDFG GK  + E +  EC ++++ L+  Q   +D    +   T+NIIS  +   RF+  DP+ + +     +T +   + L  L+ MFP+         +  W+ +R+ + +++E   ++  ++ +HL+     S     +D FLI+KQ+   S   +  FT++ L+F    LF AG +TT+TTL W ++ MA+YPHIQ KV +E+ + +G  ++ + +DRK+L Y  AV+ EI R++++ P+ I H+T  D +   + I K + + P   +   D   W  P  F P HF+S     E K+  R+  +PF  G+R C+GESLAKM
Sbjct:   61 HKALCELSKSYGPVFTVYFGIQKVVVLAGYKTVKEALVNNAEEFGDRDITPMFQDMNKGHGILFANGESWKELRRFALTTLRDFGMGKRIAEEKILEECDYLIQGLEKHQGNPVDLTCPLNYATSNIISSIVYGSRFDYDDPRFRNLVSRANETIRINGHPLTHLYNMFPR---------WFRWIKNRKIILNNVEMTVKDVKDLVKHLKETLNPSVCRGFVDCFLIKKQKEEDSCVKESHFTEQNLVFSVSNLFAAGTDTTATTLRWGLLLMAKYPHIQDKVHEELAKVLGGRQVRV-DDRKNLPYADAVIHEIQRVANIIPMSIPHKTNRDVTFHGYLIQKGTTVIPLLASVLNDENEWESPHTFNPHHFLSK----EGKFVKRDAFMPFSAGRRACLGESLAKM 453          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000010094.2 (cytochrome P450 2K1 [Source:NCBI gene;Acc:101174266])

HSP 1 Score: 218.779 bits (556), Expect = 4.450e-62
Identity = 140/407 (34.40%), Postives = 221/407 (54.30%), Query Frame = 2
Query:  227 LKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAI---EFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKV---FEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKM 1429
            L +L  KYG +F + FG ++VVVL  +R +K++L  +   F  R  T +    +   GILF +G+ W+  R F L  LRDFG GK  S + +  EC++++EEL+ LQ    D  + I    +N++S  +  KRF+  DP ++AI   +  I   T   +IL  L+ MFP L           WL + + L  ++E      ++ I E  + LD ++     +D FL +KQ L +  G+   + D  L++    LF AG +TT+TT+ W ++FMA+YPHIQ++V +E+   +G  ++ I  DRK+L +T AV+ E  RL+++ P+ I H T  D +   +FI K + + P   +   D   W  P  F P HF+    + E K+  R   +PF  G+R C+GESLA+M
Sbjct:   64 LFDLSKKYGPVFVVNFGPKKVVVLAGYRTVKQALVNQAKEFGNREVTPIFYDFNKEHGILFANGESWNEMRRFALSTLRDFGMGKRISEQNIIEECRWLIEELEKLQGKPFDNTHTISYAVSNVLSGLMFGKRFDYQDPLLQAIVDRDNEIIYLTGTVSIL--LYNMFPWLGP---------WLKNWKTLMKNMEAAKTDMKKIIAELKDTLDPDTR-RCFVDAFLTQKQNLKEVNGSH--YHDDNLLYTVMNLFAAGTDTTATTIEWCLLFMAKYPHIQERVQEELNWVVGSRQVRI-EDRKNLPFTDAVIHESQRLANIAPMAIPHTTSKDVTFQGYFIKKGTTVLPLLTSVLYDESEWESPRTFNPSHFL----DKEGKFLKRGAFMPFSAGRRVCLGESLARM 451          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000022100.1 (SMESG000022100.1)

HSP 1 Score: 943.34 bits (2437), Expect = 0.000e+0
Identity = 479/498 (96.18%), Postives = 487/498 (97.79%), Query Frame = 2
Query:   92 CGLYFLINLKNRNTSISVGLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKMXXXXXXXXXXXXXXXKFAENISDKLYQENLEGNDGIIRYSKIKNFIFHKRDV 1585
            CGLYFLINLKNRNTSISVGLKNLPIVRGIPIFGILFQKK P HI+LKNLGHKYGSIFSIKFGMREVVVLNNFRIIKK+LK+EGDNFSGRWQTKL T+ISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKF+LEELKSLQ+TV+D    IPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFS IEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGN QGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQ KVFDEIRENIGLEKIPIMND+KSLTYTQAVMDEILRLSSV PLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKMEFFIFFVSIFQSFEVKFAENISDKLYQENLEGNDGIIRYSKIKNFIFHKRDV
Sbjct:   24 CGLYFLINLKNRNTSISVGLKNLPIVRGIPIFGILFQKKEPLHIFLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKTLKDEGDNFSGRWQTKLKTVISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFILEELKSLQETVVDISKLIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSGIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNHQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQNKVFDEIRENIGLEKIPIMNDKKSLTYTQAVMDEILRLSSVAPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKMEFFIFFVSIFQSFEVKFAENISDKLYQENLEGNDGIIRYSKIKNFIFHKRDV 521          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000022101.1 (SMESG000022101.1)

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 291/297 (97.98%), Postives = 293/297 (98.65%), Query Frame = 2
Query:  521 MLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIG 1411
            MLEELKSLQKT+LDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFS IEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGN QGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQ KVFDEIRENIGLEKIPIMND+KSLTYTQAVMDEILRLSSV PLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIG
Sbjct:    1 MLEELKSLQKTILDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSGIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNHQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQNKVFDEIRENIGLEKIPIMNDKKSLTYTQAVMDEILRLSSVAPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIG 297          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078091.1 (SMESG000078091.1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 274/494 (55.47%), Postives = 356/494 (72.06%), Query Frame = 2
Query:   98 LYFLINLKNRNTSISVGLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKMXXXXXXXXXXXXXXXKFAENISDKLYQENLEGNDGIIRYSKIKNFIFHKR 1579
            LYFL  +  R   I  GLK +P+  G+PI G + + + P H YL  LG K G IF IK GMR++VVLNN+ +IKK+L ++ +NFSGRW  + +  I+ ++GI+F DG  W TQR+F+LKVLRDFG GKS+S EIV++EC   L+EL +L   ++DF   IPIYT NIIS+FIMNKRF R DP I+ IE  I  +TK  +I+Q++ LMFP  D+S +I      LTS+ K F  I+  F EEI+EH  NLD  SEG DL+DRFLI++  L QSTGN + F D QLI  + ELF AGYETTSTTL W  +FM++YP IQ+KV  EI E IG E++P MND+K+L YTQAVMDE+LRLSSV P+G+ HRTF D +++ F+IPK+SLIFPN +ACH DPE W  P  F+PEHF+S   NG  KY PRE+L+PF +GKRQC+GESLA+ E+FIFFVS+ Q F++ FAE IS+  Y + + GN+G+IR S IKNF+F +R
Sbjct:   14 LYFLYWV-CRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSQRFIKEITHDSGIIFKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNIQLIEETINNSTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSKWKSFVKIQNYFGEEIEEHRTNLDLTSEGEDLMDRFLIKQHELKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSVAPMGLIHRTFDDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGVIRTSDIKNFLFKRR 506          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078100.1 (SMESG000078100.1)

HSP 1 Score: 521.161 bits (1341), Expect = 2.568e-177
Identity = 268/494 (54.25%), Postives = 348/494 (70.45%), Query Frame = 2
Query:   98 LYFLINLKNRNTSISVGLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKMXXXXXXXXXXXXXXXKFAENISDKLYQENLEGNDGIIRYSKIKNFIFHKR 1579
            LYFL  +  R   I  GLK +P+  G+PI G + + + P H YL  LG K G IF IK GMR++VVLNN+ +IKK+L ++ +NFSGRW  K++T +S ++GI+F DG    TQR+F+LKVLRDFG GKS+S EI+++EC  +L+EL +L   ++DF  F PIYT NIIS+FIMNKRF R DP I+ I   +    K  +I  ++ LMFP LD SFI++       S  K F  I+  F EEI+EH   LDF SEG DL+DRFLI++  L QSTGN + F D QLI  + EL  AGYETTSTTL W  +FM++YP IQ+KV +EI E IG E++P MND+K+L YTQAVMDE+LRLSSV P+G+ HRTF D +++ F+IPK+SLIFPN +ACH DPE W  P  F+PEHF+S   NG  KY PRE+L+PF +GKRQCIGESLA+ E+FIFFVS+ Q F++ FAE IS++ Y + + GN+G IR S I  F F  R
Sbjct:   14 LYFLYWV-CRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKIITEVSHDSGIMFKDGQGLATQRSFILKVLRDFGLGKSKSLEIIQNECLNLLDELDTLSDQIVDFSEFFPIYTTNIISRFIMNKRFTRDDPNIQFIWKTMDNLAKNKDIFHLILLMFPCLDQSFIVARLLFLFVSDWKRFVKIQDYFAEEIKEHRNALDFTSEGEDLMDRFLIKQHELKQSTGNVESFVDWQLIRNSLELIIAGYETTSTTLNWCCLFMSKYPDIQEKVHEEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSVAPMGLMHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCIGESLARSEYFIFFVSMVQRFQISFAEEISEEKYLQTIIGNEGHIRTSDITKFKFKNR 506          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078094.1 (SMESG000078094.1)

HSP 1 Score: 519.62 bits (1337), Expect = 7.488e-177
Identity = 262/494 (53.04%), Postives = 351/494 (71.05%), Query Frame = 2
Query:   98 LYFLINLKNRNTSISVGLKNLPIVRGIPIFGILFQKKGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSGRWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVESECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKAIEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEKVFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIFMTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIMNDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFPNYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQCIGESLAKMXXXXXXXXXXXXXXXKFAENISDKLYQENLEGNDGIIRYSKIKNFIFHKR 1579
            LYFL  +  R   I  GLK +P+  G+PI G + + + P H YL  LG K G IF IK GMR++VVLNN+ +IKK+L ++ +NFSGRW  K++T +S ++GI+F DG    TQR+F+LKVLRDFG GK++S EI+++EC  +L+EL +    ++DF  F PIYT NIIS+FIMNKRF R DP I+ I   +    K  +I  ++ LMFP LD SFI++       S  K F  I+  F EEI+EH   LDF SEG D++DRFLI++  L QSTGN + F D QLI  + ELF AG+ETTSTTL W  +FM++YP IQ+KV+ EI E IG E++P MND+K++ YTQ+VMDE+LRLSSV PL + HRTF D +++ F+IPK+SLIFPN +ACH DPE W  P  F+PEHF+S   NG  KY PRE+L+PF +GKRQC+GESLA+ E+FIFFV++ Q F++ F E IS++ Y + + GN+G+IR S IKNF+F +R
Sbjct:   14 LYFLYWV-CRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKIITEVSHDSGIMFKDGQGLATQRSFILKVLRDFGLGKAKSLEIIQNECLNLLDELDTFSDQIVDFSEFFPIYTTNIISRFIMNKRFTRDDPNIQFIWKTMDNLAKNKDIFHLILLMFPCLDQSFIVARLLFLFVSDWKRFVKIQDYFAEEIKEHRNALDFTSEGEDIMDRFLIKQHELKQSTGNVESFVDWQLIRNSVELFIAGFETTSTTLNWCCLFMSKYPDIQEKVYKEISEIIGKERLPTMNDKKAMNYTQSVMDEVLRLSSVSPLSLIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVTMVQRFQISFGEEISEEKYLQTIIGNEGLIRTSDIKNFLFKRR 506          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP2B62.864e-6031.91cytochrome P450 family 2 subfamily B member 6 [Sou... [more]
CYP2U11.444e-5832.37cytochrome P450 family 2 subfamily U member 1 [Sou... [more]
CYP2J28.903e-5632.45cytochrome P450 family 2 subfamily J member 2 [Sou... [more]
CYP2C181.330e-5532.18cytochrome P450 family 2 subfamily C member 18 [So... [more]
CYP2C194.258e-5432.26cytochrome P450 family 2 subfamily C member 19 [So... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-33E11.320e-5029.20CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33E11.320e-5029.20CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33E23.622e-5030.60CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-14A57.567e-4929.72CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-14A18.078e-4628.78CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp18a17.420e-5228.97gene:FBgn0010383 transcript:FBtr0074610[more]
Cyp18a17.420e-5228.97gene:FBgn0010383 transcript:FBtr0074609[more]
Cyp303a11.423e-4327.88gene:FBgn0001992 transcript:FBtr0343812[more]
Cyp303a11.423e-4327.88gene:FBgn0001992 transcript:FBtr0080828[more]
Cyp305a12.536e-3725.83gene:FBgn0036910 transcript:FBtr0074925[more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2v15.642e-6434.22cytochrome P450, family 2, subfamily V, polypeptid... [more]
cyp2k61.348e-6232.03cytochrome P450, family 2, subfamily K, polypeptid... [more]
cyp2k61.348e-6232.03cytochrome P450, family 2, subfamily K, polypeptid... [more]
cyp2k161.993e-6233.58cytochrome P450, family 2, subfamily K, polypeptid... [more]
cyp2n134.930e-6231.91cytochrome P450, family 2, subfamily N, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2f11.510e-7034.56cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
cyp2e15.912e-6934.18cytochrome P450 2K1 [Source:NCBI gene;Acc:10049442... [more]
cyp2f12.328e-6834.40cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
cyp2f13.528e-6832.35cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
cyp2f19.339e-6834.65cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp2b191.990e-6331.70cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b133.674e-6233.09cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b237.482e-6231.80cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b101.508e-6133.25cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b93.635e-6131.95cytochrome P450, family 2, subfamily b, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24460|CP2BB_CANLF2.219e-6431.80Cytochrome P450 2B11 OS=Canis lupus familiaris OX=... [more]
sp|O55071|CP2BJ_MOUSE1.392e-6231.70Cytochrome P450 2B19 OS=Mus musculus OX=10090 GN=C... [more]
sp|F1Q8C3|CP2K6_DANRE1.017e-6132.03Cytochrome P450 2K6 OS=Danio rerio OX=7955 GN=cyp2... [more]
sp|P00178|CP2B4_RABIT1.237e-6131.68Cytochrome P450 2B4 OS=Oryctolagus cuniculus OX=99... [more]
sp|Q0IIF9|CP2U1_BOVIN6.707e-6132.37Cytochrome P450 2U1 OS=Bos taurus OX=9913 GN=CYP2U... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2U8U4730.000e+066.39Cytochrome P450 2K1-like protein OS=Dugesia japoni... [more]
A0A4P8NYX52.057e-17556.17P450 2B-like protein OS=Dugesia japonica OX=6161 G... [more]
A0A3P9JKM72.676e-7035.25Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
A0A3Q0S7645.971e-7033.41Uncharacterized protein OS=Amphilophus citrinellus... [more]
R9S2888.239e-7034.56Cytochrome P450 OS=Oryzias melastigma OX=30732 GN=... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000052034.15.671e-6433.83pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000019491.25.974e-6433.83pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
cyp2n139.885e-6432.89cytochrome P450 2J6-like [Source:NCBI gene;Acc:103... [more]
cyp2v12.833e-6132.06cytochrome P450, family 2, subfamily V, polypeptid... [more]
ENSAMXT00000019474.21.487e-5932.68cytochrome P450 2K1-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011254.11.037e-5531.05pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 ge... [more]
ENSPMAT00000011205.16.226e-5430.35pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1... [more]
ENSPMAT00000011204.11.156e-5030.34pep scaffold:Pmarinus_7.0:GL477378:78074:79555:1 g... [more]
cyp17a11.729e-4628.81cytochrome P450, family 17, subfamily A, polypepti... [more]
ENSPMAT00000001876.13.198e-4428.70pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 ... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ERG56.364e-924.12C-22 sterol desaturase; a cytochrome P450 enzyme t... [more]
ERG111.014e-623.08Lanosterol 14-alpha-demethylase; catalyzes C-14 de... [more]
DIT26.166e-625.67N-formyltyrosine oxidase; sporulation-specific mic... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481912.208e-4727.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376706.858e-4428.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409303.471e-4327.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466052.473e-4227.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427366.492e-4228.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000018818.21.071e-7134.79cytochrome P450 2J2 [Source:NCBI gene;Acc:10115776... [more]
ENSORLT00000020799.23.622e-6835.28cytochrome P450 2J6 [Source:NCBI gene;Acc:10115541... [more]
ENSORLT00000019638.24.709e-6832.55cytochrome P450 2K1 [Source:NCBI gene;Acc:10115799... [more]
ENSORLT00000010152.23.158e-6432.68cytochrome P450 2K1 [Source:NCBI gene;Acc:10117450... [more]
ENSORLT00000010094.24.450e-6234.40cytochrome P450 2K1 [Source:NCBI gene;Acc:10117426... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022100.10.000e+096.18SMESG000022100.1[more]
SMESG000022101.10.000e+097.98SMESG000022101.1[more]
SMESG000078091.10.000e+055.47SMESG000078091.1[more]
SMESG000078100.12.568e-17754.25SMESG000078100.1[more]
SMESG000078094.17.488e-17753.04SMESG000078094.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001471 ID=SMED30001471|Name=Cytochrome P450 2K1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2542bp
CTGATGTGAAGTGCAACTAGAAAATGTTTACAATCAAATATCTTTTAAAT
TTGAAATGATATTTATAATATTTATAAGCTTTATCGGTATTTGCGGTTTG
TATTTTTTAATTAATTTAAAAAATAGGAATACTTCCATTTCTGTGGGATT
GAAAAACTTACCGATTGTCAGAGGAATCCCAATTTTTGGAATTCTCTTTC
AAAAAAAAGGACCTTTTCATATTTATTTAAAAAATCTTGGTCATAAGTAT
GGAAGTATTTTTTCAATAAAATTTGGAATGAGAGAAGTAGTTGTCCTTAA
CAATTTTCGAATAATTAAAAAATCTCTGAAAGAAGAAGGTGATAATTTTT
CAGGACGTTGGCAAACAAAATTGGTAACAATAATATCCTTGAACACGGGA
ATTCTTTTCATTGACGGGGATCATTGGCATACACAAAGAACCTTTGTTTT
AAAGGTTTTACGAGATTTTGGATTCGGAAAATCTCGATCGTATGAAATTG
TTGAGTCAGAATGTAAATTTATGTTGGAAGAATTAAAAAGCCTTCAGAAA
ACTGTTTTAGACTTCTACAATTTTATTCCAATTTATACGGCAAATATCAT
ATCTAAATTTATAATGAATAAAAGATTTGAAAGAACTGATCCAAAAATAA
AAGCCATTGAATTTGCAATATTTCAAACGACTAAAAAGTCAAATATCTTG
CAAATATTGCATTTGATGTTTCCGAAATTGGATGATTCTTTTATTATTTC
AACATTTACCTTATGGCTCACATCAAGAAGGAAACTTTTTTCAGACATAG
AAAAAGTATTCGAGGAAGAAATTCAGGAACATTTAGAAAATTTGGATTTT
AACTCCGAAGGAAATGATTTAATTGACAGATTTTTAATTGAAAAACAACG
ACTTGTTCAATCAACTGGGAATCAACAAGGTTTCACTGATAAACAGTTGA
TATTTATGACATTTGAACTTTTTGGAGCGGGGTATGAGACCACCTCCACC
ACACTGGGTTGGAGCATGGTATTCATGGCAAGATATCCTCACATTCAAAA
AAAGGTGTTCGATGAAATCCGTGAAAATATTGGATTAGAGAAAATACCTA
TAATGAATGATAGAAAGTCTTTAACTTATACACAAGCAGTAATGGATGAA
ATATTGAGACTAAGTTCAGTTGGACCTTTGGGTATATATCATCGAACATT
TTCCGATACGAGTGTTGATAATTTTTTTATTCCTAAAAACAGTTTGATAT
TCCCTAACTACTTTGCATGTCACACTGATCCGGAAACTTGGAGGAAACCA
TTTGAATTCTTTCCGGAACATTTTATAAGCTCAACAGAAAACGGTGAATT
AAAATATACTCCAAGAGAAGATTTGGTCCCTTTTGGAATCGGGAAACGGC
AATGTATTGGGGAATCATTAGCTAAAATGGAATTTTTCATATTTTTTGTT
TCAATCTTTCAAAGCTTTGAAGTAAAATTCGCTGAAAATATTTCGGATAA
ATTGTATCAAGAAAATTTAGAAGGAAATGACGGAATTATTAGATATTCAA
AGATTAAAAATTTTATTTTTCACAAAAGGGATGTTAATAATTGAAGAAAT
CTGTTGCTCAATATTTTACATGAATAAGTGAATAACAAAATAAGCCCGTG
CTGCGAAATAATAATTGAAAAAATAATTGAAATAATAATTGAAAAAGTTT
CGCTTTTCGATCCTCGATTAATGCAAGAAAAGAGGCATATCCGTTTACAC
ACATCTGAGAAGTATTTGATGAATTTTCGTGACACTGCCTCAAATACTAT
GTTCCAAATTACTCTGTTTGTTTCAATGAGCAATTTATACCTCTCAAGTG
TCGAAGATTTGTCGTATTCATGCTAAACAAACCAGATAAATTTGGTATGA
ATTTTGGCTCCTTGTTGATAGCCAATCGAAGTAATATGCATTTCAATTCG
AGTATTGACATTGTTGAAAAACAATAACCGCAAAGGATTCACTATTACAG
CCGAAGTAAATGTGGTGTAGATTCAGTGCTTTGATTTTACAGTTCGACAT
ACCTAACAAGAAGGTGGCAATTTGGGATAATCTTCTGGATATCTCAATCC
AGAATTTCTGGGTCAGCTTCAAAGAAGTTTTACAAACCAAATAATCATTC
CAAAATGCGAGCATTCAAAATTTTTTAAGAACTCAAATTTGGCACTATTA
AGCGACAAAATTCCTGCATTAAATTGTGCAAAATTTAAAGCAAAATATTT
AATAGATTGTTCCAATCACTTCTCCCAGTGATATAGTGTATTTGTTTGGG
TTTTGTCTTTCGTCAGCTAATAAAAATCTTCTCAAACTATATTATTCCGA
TATCTAATCTTTTGATCCATATCGTCTCACTGACATTGCAATGATTATAG
GTCTTATTAAGACAATTGTAGTGGATATGCCTTGCTTCTTTTGCATGCAC
AAAATAATTTTGGTTGATGTATTGCCCTTTGGAATATTCTATTTTGGAAT
TGATTACTAGTTTGTTTTTGGGAATATTTTTGCTCTCTACTA
back to top

protein sequence of SMED30001471-orf-1

>SMED30001471-orf-1 ID=SMED30001471-orf-1|Name=SMED30001471-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=513bp
MIFIIFISFIGICGLYFLINLKNRNTSISVGLKNLPIVRGIPIFGILFQK
KGPFHIYLKNLGHKYGSIFSIKFGMREVVVLNNFRIIKKSLKEEGDNFSG
RWQTKLVTIISLNTGILFIDGDHWHTQRTFVLKVLRDFGFGKSRSYEIVE
SECKFMLEELKSLQKTVLDFYNFIPIYTANIISKFIMNKRFERTDPKIKA
IEFAIFQTTKKSNILQILHLMFPKLDDSFIISTFTLWLTSRRKLFSDIEK
VFEEEIQEHLENLDFNSEGNDLIDRFLIEKQRLVQSTGNQQGFTDKQLIF
MTFELFGAGYETTSTTLGWSMVFMARYPHIQKKVFDEIRENIGLEKIPIM
NDRKSLTYTQAVMDEILRLSSVGPLGIYHRTFSDTSVDNFFIPKNSLIFP
NYFACHTDPETWRKPFEFFPEHFISSTENGELKYTPREDLVPFGIGKRQC
IGESLAKMEFFIFFVSIFQSFEVKFAENISDKLYQENLEGNDGIIRYSKI
KNFIFHKRDVNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001128Cyt_P450
IPR002401Cyt_P450_E_grp-I
IPR017972Cyt_P450_CS
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0005506iron ion binding
GO:0020037heme binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0016712oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane