wntP-3

Overview
NamewntP-3 (ABY85209.1)
Smed IDSMED30001470
Length (bp)1173
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of wntP-3 (SMED30001470) t-SNE clustered cells

Violin plots show distribution of expression levels for wntP-3 (SMED30001470) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of wntP-3 (SMED30001470) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for wntP-3 (SMED30001470) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001470

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
esophagusSMED30001470SMESG000067888.1 EU296632.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
esophagusSMED30001470SMESG000067888.1 EU296632.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30001470SMESG000067888.1 EU296632.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30001470SMESG000067888.1 EU296632.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30001470SMESG000067888.1 ABY85209.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
esophagusSMED30001470SMESG000067888.1 ABY85209.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30001470SMESG000067888.1 ABY85209.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30001470SMESG000067888.1 ABY85209.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30001470SMESG000067888.1 SmedASXL_001649SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30001470SMESG000067888.1 SmedASXL_001649SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30001470SMESG000067888.1 dd_Smed_v4_14865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001470SMESG000067888.1 dd_Smed_v4_14865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001470SMESG000067888.1 dd_Smed_v4_14865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30001470SMESG000067888.1 dd_Smed_v4_14865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
esophagusSMED30001470SMESG000067888.1 EU296632smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30001470SMESG000067888.1 Smed-wntP-3smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30001470SMESG000067888.1 OX_Smed_1.0.07540ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
esophagusSMED30001470SMESG000067888.1 EU296632.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30001470SMESG000067888.1 EU296632.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30001470SMESG000067888.1 EU296632smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30001470SMESG000067888.1 EU296632smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of wntP-3 vs. Ensembl Human
Match: WNT4 (Wnt family member 4 [Source:HGNC Symbol;Acc:HGNC:12783])

HSP 1 Score: 256.914 bits (655), Expect = 2.569e-82
Identity = 139/341 (40.76%), Postives = 201/341 (58.94%), Query Frame = 3
Query:   87 FFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV---RMNDFK-LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEIL 1097
            +  L KL          T      L++ Q  +C R++ ++ SV  G  + I+ECQ+QF N  WNC+  + S+P                  ++ +G  E+AF+ +++SA VA  V++ACSSG+ + CGCDRT++      FQW+GCSDN+ +G AFS+ F+D   + K   + S  L+NLHN+ AG K ++ +M ++CKCHGVSGSCE KTC+RA+P  R+VG  LKEKF  A  V   R+   + LVP ++     T+ DL YL+ SP+FC  +   G LGT+GR CN T     + ++G C  LCC RGF T Q  + E+C CKF WCC V+C+ C+ L
Sbjct:   25 WLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLD-SLP--------------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSK-GASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS----KAIDG-CELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRL 344          
BLAST of wntP-3 vs. Ensembl Human
Match: WNT7B (Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:12787])

HSP 1 Score: 239.58 bits (610), Expect = 8.968e-76
Identity = 132/330 (40.00%), Postives = 182/330 (55.15%), Query Frame = 3
Query:  138 TNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV--------RMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
             NI CN++  L   QR+IC      I  +  G  +GI ECQ+QF    WNC+                   KT     +  G  E+AF  ++T+A VAH V+ ACS G    CGCDR    Y    + ++W GCS +V +G  FS+RF+D+   R+IK+N    L+NLHN+ AG K++ D M ++CKCHGVSGSC TKTC+  LP  R+VG +LKEK++ A+ V        R   F  +       +  E DL Y+++SPN+C  + + GS+GTQGRLCN T           C  +CC RG++T Q+    +C CKF WCC V+C TC
Sbjct:   18 ANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALG---------------EKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDA---REIKKNARR-LMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGAD-----GCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTC 323          
BLAST of wntP-3 vs. Ensembl Human
Match: WNT7B (Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:12787])

HSP 1 Score: 239.195 bits (609), Expect = 1.953e-75
Identity = 132/331 (39.88%), Postives = 182/331 (54.98%), Query Frame = 3
Query:  135 NTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV--------RMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
              NI CN++  L   QR+IC      I  +  G  +GI ECQ+QF    WNC+                   KT     +  G  E+AF  ++T+A VAH V+ ACS G    CGCDR    Y    + ++W GCS +V +G  FS+RF+D+   R+IK+N    L+NLHN+ AG K++ D M ++CKCHGVSGSC TKTC+  LP  R+VG +LKEK++ A+ V        R   F  +       +  E DL Y+++SPN+C  + + GS+GTQGRLCN T           C  +CC RG++T Q+    +C CKF WCC V+C TC
Sbjct:   37 GANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALG---------------EKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDA---REIKKNARR-LMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGAD-----GCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTC 343          
BLAST of wntP-3 vs. Ensembl Human
Match: WNT7B (Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:12787])

HSP 1 Score: 239.195 bits (609), Expect = 2.176e-75
Identity = 132/330 (40.00%), Postives = 182/330 (55.15%), Query Frame = 3
Query:  138 TNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV--------RMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
             NI CN++  L   QR+IC      I  +  G  +GI ECQ+QF    WNC+                   KT     +  G  E+AF  ++T+A VAH V+ ACS G    CGCDR    Y    + ++W GCS +V +G  FS+RF+D+   R+IK+N    L+NLHN+ AG K++ D M ++CKCHGVSGSC TKTC+  LP  R+VG +LKEK++ A+ V        R   F  +       +  E DL Y+++SPN+C  + + GS+GTQGRLCN T           C  +CC RG++T Q+    +C CKF WCC V+C TC
Sbjct:   34 ANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALG---------------EKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDA---REIKKNARR-LMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGAD-----GCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTC 339          
BLAST of wntP-3 vs. Ensembl Human
Match: WNT3 (Wnt family member 3 [Source:HGNC Symbol;Acc:HGNC:12782])

HSP 1 Score: 228.024 bits (580), Expect = 4.713e-71
Identity = 131/352 (37.22%), Postives = 186/352 (52.84%), Query Frame = 3
Query:   66 VNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK--------LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            V +G  ++++L   Q+ T   L +  + C  +  L   Q   C  ++ ++PSV  GV +GIQECQHQF    WNC     +I D                 +++K   ESAF+ ++ SA VA  V+++C+ G +  CGCD      P + ++W GCS++  FG   S+ F D+   R   R+     +N HN+ AG   ++D+M +KCKCHG+SGSCE KTC+ A PD R +GD LK+K+  A  + +   +        L   +S     TE DL Y + SPNFC  NP  GS GT+ R CN T       ++G C  LCC RG +T+    KEKC C F WCC V CQ C
Sbjct:   19 VLAGYPIWWSLALGQQYTS--LGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCT----TIDDSLA----------IFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARS----AMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTS----HGIDG-CDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQEC 345          
BLAST of wntP-3 vs. Ensembl Celegans
Match: cwn-1 (pep chromosome:WBcel235:II:130983:133598:-1 gene:WBGene00000857.1 transcript:K10B4.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-1)

HSP 1 Score: 207.608 bits (527), Expect = 2.092e-63
Identity = 123/356 (34.55%), Postives = 191/356 (53.65%), Query Frame = 3
Query:  114 STKFDLNNTNIFCNQLMKLQRS---ICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNC-----AGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYE-TPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVG---------------LVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVR------MNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCE 1091
            + +FD +     C  L  L R     C +++ L+ SV  G      ECQ QF    WNC       H + IPD F+ ++ +                ESAF+ +++SAAVA++V++ C+ G ++ CGCD +  + + +  FQ+ GCSDNV FG   SK F+DS  +R +      G               ++NLHN+ AG +++  ++  +CKCHG+SGSCE +TC+ +LP+ R +G  +K+KF  A  V+      +   ++V  +S   R T  DL Y+  SP+FC  +P  G LGT+GR C     L    ++  C+ LCC RG+  K  +V+EKC CKF++CC V+C+ C+
Sbjct:   30 ANRFDRDKPGTSCKSLKGLTRRQMRFCKKNIDLMESVRSGSLAAHAECQFQFHKRRWNCTLIDPVTHEV-IPDVFLYENTR----------------ESAFVHAISSAAVAYKVTRDCARGISERCGCDYSKNDHSGKSQFQYQGCSDNVKFGIGVSKEFVDSAQRRVLMMKDDNGTSLLGPSQLSADGMHMINLHNNQAGRQVLEKSLRRECKCHGMSGSCEMRTCWDSLPNFRHIGMAIKDKFDGAAEVKVVKEDGIEKPRIVMKNSQFKRHTNADLVYMTPSPDFCESDPLRGILGTKGRQC----TLAPNAID-DCSLLCCGRGYEKKVQIVEEKCNCKFIYCCEVRCEPCQ 363          
BLAST of wntP-3 vs. Ensembl Celegans
Match: cwn-2 (pep chromosome:WBcel235:IV:10067824:10070251:1 gene:WBGene00000858.1 transcript:W01B6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-2)

HSP 1 Score: 198.364 bits (503), Expect = 7.141e-60
Identity = 124/339 (36.58%), Postives = 169/339 (49.85%), Query Frame = 3
Query:  108 QESTKFDLNNTNIFCN--QLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGC-DRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKR-KIKRNPSVG--LVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGES------RITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            Q ST    +N    C    L   Q  +C      +P+V  G    IQECQ QF    WNC+ H               +    L  +      E+AF  ++ SA V H++ + C  G    CGC D T  +    ++ W GC DNV +G  FS+ F+D   K    KRN   G  L+N  N+ AG KI+  +   KCKCHGVSG+C  KTC+  LP + +VG IL+ K+ KAI V++ND   + + + E+      R    DL ++  SP++C  +   G+LGT+GR+C           EG C  LCC RG++T    VK KC CKF WCC V CQTC
Sbjct:   32 QLSTALAGHNVKPVCELPGLSPGQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTH---------------YSTGMLGPIHKMATREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNVPTDWSWGGCGDNVEYGYKFSRDFIDIREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMKTCWMQLPSMEQVGKILRNKYDKAIRVQINDRGNLQLLADEATKERKTRALPTDLVFMDDSPDYCRFDRHSGTLGTEGRVCKRGS----GGAEG-CDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVCQTC 350          
BLAST of wntP-3 vs. Ensembl Celegans
Match: egl-20 (Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05])

HSP 1 Score: 191.43 bits (485), Expect = 7.105e-57
Identity = 106/321 (33.02%), Postives = 174/321 (54.21%), Query Frame = 3
Query:  171 QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCD------RTIYET----PEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVG-LVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFS--KAILVRMNDFKLVPMHSGESRIT--EHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            Q+++C  +   IP V  GV   I+EC+++F    WNC+  +       V++++    +  L   +     E+AFL ++ +A++ H ++K C++G    CGCD      R   E+      D F W GCSDNV  G  ++K+FLD     +  +  +V  LV  HN+  G + +  N+  +C+CHGVSGSCE KTC+  +    +V D+LK+++      + R    +L      E +I    +++ Y+ RSP++C  N + G LGT GR C     + + +   SC  LCC RG++T+  + + +C+CKFVWCC V+C+TC
Sbjct:   74 QQALCAENPFSIPFVARGVREAIRECENKFKFERWNCSSRDE------VTETRHGKFQDILGKTLRSANKEAAFLNAIMAASIVHSITKGCNTGNLTECGCDSKPGMQRYQAESDPSMSRDQFSWGGCSDNVPHGIRYAKKFLDDWETAQFDKTKNVAHLVRRHNNFVGREAIAQNIRRQCRCHGVSGSCEFKTCWLQMQKFSQVSDLLKKRYDHFAVQVTRKATKRLRRKERTERKIPLRGNEMAYVHRSPSYCEKNLTAGILGTSGREC-----IHNSYSSESCDLLCCGRGYNTRLEIRQTQCECKFVWCCEVKCKTC 383          
BLAST of wntP-3 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355988:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 175.637 bits (444), Expect = 3.134e-51
Identity = 112/377 (29.71%), Postives = 182/377 (48.28%), Query Frame = 3
Query:   90 FTLMKLQESTKFDLNNTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPED---------------NFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHS-----------------GESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRC 1115
            + L+   +++  +  ++ I C  +  L   Q+ +C  +  +I  +I G+   +  C++ F    WNC    L++P    S  +   R             ESA++ ++++A V+H +++ACS G    CGC     ETP+                +F WAGCSDNV FG  F ++F+D  + R+    P   + NLHN+  G +++++ M  +CKCHGVSGSC TKTC++ +P   +    L +K+  A LV  ND KL    S                   S+   ++L YL  SPN+C       ++  + R C             +C ++CC RG+ T + +V E C C+FVWCC V+C+TC+ L   + C
Sbjct:   25 WWLLSKTDTSSANSGSSPILCKNVPGLTPQQKRMCHENPNIIKYLISGLRSALHTCEYTFQREAWNCT---LTLPGVGTSPLQIASR-------------ESAYVYAISAAGVSHSLARACSKGLIDDCGCG----ETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQ-YDRQHATEPRSQM-NLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYC-------AIDVKDRECGE-----------NCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLVERNYC 361          
BLAST of wntP-3 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355953:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 175.637 bits (444), Expect = 3.134e-51
Identity = 112/377 (29.71%), Postives = 182/377 (48.28%), Query Frame = 3
Query:   90 FTLMKLQESTKFDLNNTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPED---------------NFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHS-----------------GESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRC 1115
            + L+   +++  +  ++ I C  +  L   Q+ +C  +  +I  +I G+   +  C++ F    WNC    L++P    S  +   R             ESA++ ++++A V+H +++ACS G    CGC     ETP+                +F WAGCSDNV FG  F ++F+D  + R+    P   + NLHN+  G +++++ M  +CKCHGVSGSC TKTC++ +P   +    L +K+  A LV  ND KL    S                   S+   ++L YL  SPN+C       ++  + R C             +C ++CC RG+ T + +V E C C+FVWCC V+C+TC+ L   + C
Sbjct:   25 WWLLSKTDTSSANSGSSPILCKNVPGLTPQQKRMCHENPNIIKYLISGLRSALHTCEYTFQREAWNCT---LTLPGVGTSPLQIASR-------------ESAYVYAISAAGVSHSLARACSKGLIDDCGCG----ETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQ-YDRQHATEPRSQM-NLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYC-------AIDVKDRECGE-----------NCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLVERNYC 361          
BLAST of wntP-3 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0339383)

HSP 1 Score: 172.555 bits (436), Expect = 2.525e-50
Identity = 116/340 (34.12%), Postives = 176/340 (51.76%), Query Frame = 3
Query:  144 IFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCD------RTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRM----NDFKLV---PMHSGESRITEH--------DLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCE 1091
            + C ++  L   QR++C      + ++  G  +G QECQHQF    WNC+               +  ++    ++I     E+A+  ++ SA  A+ V+ AC+ G    CGCD       T   TP++ ++W GCS +V FG  +++RF+D+   R+++R+ S  L+NLHN+ AG  +V   +   CKCHGVSGSC  KTC+++LP  R VGD L  K+ KA  V+        +LV     H+G +R  +         +L YL+ SPN+C  +   GS GT GR C  T          SC  LCC RG +T+      +C+C+F WCC V+C  C+
Sbjct:    1 MLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCS---------------EVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDA---RELERD-SRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTG-----HGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECD 316          
BLAST of wntP-3 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0088512)

HSP 1 Score: 172.17 bits (435), Expect = 7.150e-50
Identity = 116/340 (34.12%), Postives = 176/340 (51.76%), Query Frame = 3
Query:  144 IFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCD------RTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRM----NDFKLV---PMHSGESRITE--------HDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCE 1091
            + C ++  L   QR++C      + ++  G  +G QECQHQF    WNC+               +  ++    ++I     E+A+  ++ SA  A+ V+ AC+ G    CGCD       T   TP++ ++W GCS +V FG  +++RF+D+   R+++R+ S  L+NLHN+ AG  +V   +   CKCHGVSGSC  KTC+++LP  R VGD L  K+ KA  V+        +LV     H+G +R  +         +L YL+ SPN+C  +   GS GT GR C  T          SC  LCC RG +T+      +C+C+F WCC V+C  C+
Sbjct:   28 MLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCS---------------EVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDA---RELERD-SRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTG-----HGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECD 343          
BLAST of wntP-3 vs. Ensembl Fly
Match: wg (gene:FBgn0284084 transcript:FBtr0079432)

HSP 1 Score: 150.599 bits (379), Expect = 8.670e-41
Identity = 86/262 (32.82%), Postives = 138/262 (52.67%), Query Frame = 3
Query:   72 SGRG---MFFTLMKLQESTKFD--LNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRT-IYETPEDN-----------FQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMND 806
            SGRG   M++ + K+ E       +       + L + QR +   + G++ +++ G ++ I ECQHQF N  WNC+  N S              K     ++++G  E++F+ ++TSAAV H +++ACS G  + C CD +    +P+ N           ++W GCSDN+ FG  FS+ F+D+  + +  R      +NLHN+ AG   V   M  +CKCHG+SGSC  KTC+  L + R +GD LK +F  A  V++ +
Sbjct:   30 SGRGRGSMWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFS------------RGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERGRNLREK----MNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTN 275          

HSP 2 Score: 79.7221 bits (195), Expect = 5.948e-16
Identity = 42/103 (40.78%), Postives = 55/103 (53.40%), Query Frame = 3
Query:  807 FKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRC 1115
            F+L P +         DL YL+ SP+FC  N   G LGT GR CN T +     V+G C  +CC RG+   + +V E+C C F WCC V+C+ C   KV   C
Sbjct:  370 FQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSL----GVDG-CGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC 467          
BLAST of wntP-3 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0334800)

HSP 1 Score: 148.288 bits (373), Expect = 3.072e-40
Identity = 77/202 (38.12%), Postives = 113/202 (55.94%), Query Frame = 3
Query:  495 PEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKA--ILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGS--CAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            PE  ++W GCSDNV+FG   S+ FLD+  K++ +R+    LV  HN++AG   + D M ++CKCHG+SGSC  KTC+  +P  R+V   L++++  A  + +R +    +P         ++ L +   SP+FC  N   G+LGTQGR CN T         GS  C  LCC RG + +    +  C+C F WCC V C+ C
Sbjct:  218 PEGQWEWGGCSDNVNFGLRHSRVFLDA--KQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTS-------SGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKC 410          

HSP 2 Score: 56.6102 bits (135), Expect = 1.643e-8
Identity = 35/122 (28.69%), Postives = 62/122 (50.82%), Query Frame = 3
Query:  129 LNNTNIFCNQLMKLQ---RSICLRHVGLIPSVI-HGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRT 482
            L + N+ C +  +L+     IC     L+  +I +G+++G +EC+ QF N  WNC            +  +K  RK     ++ +   E+ F+ ++T+A V + V+KAC+ GQ   C CD+ 
Sbjct:   28 LLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNC------------TVLRKSMRK-----ILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKA 132          
BLAST of wntP-3 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0303251)

HSP 1 Score: 148.288 bits (373), Expect = 3.072e-40
Identity = 77/202 (38.12%), Postives = 113/202 (55.94%), Query Frame = 3
Query:  495 PEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKA--ILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGS--CAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            PE  ++W GCSDNV+FG   S+ FLD+  K++ +R+    LV  HN++AG   + D M ++CKCHG+SGSC  KTC+  +P  R+V   L++++  A  + +R +    +P         ++ L +   SP+FC  N   G+LGTQGR CN T         GS  C  LCC RG + +    +  C+C F WCC V C+ C
Sbjct:  218 PEGQWEWGGCSDNVNFGLRHSRVFLDA--KQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTS-------SGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKC 410          

HSP 2 Score: 56.6102 bits (135), Expect = 1.643e-8
Identity = 35/122 (28.69%), Postives = 62/122 (50.82%), Query Frame = 3
Query:  129 LNNTNIFCNQLMKLQ---RSICLRHVGLIPSVI-HGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRT 482
            L + N+ C +  +L+     IC     L+  +I +G+++G +EC+ QF N  WNC            +  +K  RK     ++ +   E+ F+ ++T+A V + V+KAC+ GQ   C CD+ 
Sbjct:   28 LLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNC------------TVLRKSMRK-----ILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKA 132          
BLAST of wntP-3 vs. Ensembl Zebrafish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 256.144 bits (653), Expect = 3.290e-82
Identity = 130/315 (41.27%), Postives = 196/315 (62.22%), Query Frame = 3
Query:  159 LMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNP-SYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            L++ Q  IC R+V ++ +V  G  + I ECQ+QF N  WNC+    S+P                  ++ +G  E+AF+ ++++A+VA  V++ACSSG+   CGCDR ++    + FQW+GCSDN+ +G AFS+ F+D   + K  ++ +  L+NLHN+ AG K ++++M ++CKCHGVSGSCE KTC++A+P  RKVG+++KEKF  A  V +        LVP +S     T+ DL YL  SP+FC H+P + G +GT GR CN T     + ++G C  +CC RGF T++  V ++C CKF WCC V+C+ C
Sbjct:   49 LIQRQVQICKRNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLE-SVP--------------VFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELDKCGCDRNVHGVSPEGFQWSGCSDNIAYGVAFSQSFVDIRERSK-GQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVELRKVGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCEHDPRTPGIMGTAGRFCNKTS----KAIDG-CELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQC 342          
BLAST of wntP-3 vs. Ensembl Zebrafish
Match: wnt7ba (wingless-type MMTV integration site family, member 7Ba [Source:ZFIN;Acc:ZDB-GENE-041210-178])

HSP 1 Score: 240.736 bits (613), Expect = 2.161e-76
Identity = 131/331 (39.58%), Postives = 185/331 (55.89%), Query Frame = 3
Query:  135 NTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV--------RMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
              NI CN++  L   QR+IC      I  +  G  +GI ECQ+QF    WNC+                   +T     +  G  E+AF  ++T+A VAH V+ ACS G   +CGCDR    Y   E+ ++W GCS +V +G  FS+RF+D+   R+IK+N    L+NLHN+ AG K++ + M ++CKCHGVSGSC TKTC+  LP  R++G +LKE+++ A+ V        R   F  +    G  + T+ DL +L+RSPN+C  +   GS GT+GRLCN+T  L        C  +CC RG +T Q+    +C CKF WCC V+C TC
Sbjct:   22 GANIICNKIPGLAPRQRAICQSRPDAIIIIGEGAQLGINECQYQFRYGRWNCSALG---------------ERTVFGQELRVGSKEAAFTYAITAAGVAHAVTAACSQGNLSHCGCDREKQGYHDQEEGWKWGGCSADVKYGVEFSRRFVDA---REIKKNARR-LMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYVLKERYTTALEVEAVRATRFRQPSFLRLKQSRGYIKPTDTDLVFLERSPNYCEEDTVTGSAGTRGRLCNHTSPLTD-----GCNLMCCGRGHNTHQYTRVWQCNCKFQWCCFVKCNTC 328          
BLAST of wntP-3 vs. Ensembl Zebrafish
Match: wnt7ba (wingless-type MMTV integration site family, member 7Ba [Source:ZFIN;Acc:ZDB-GENE-041210-178])

HSP 1 Score: 240.736 bits (613), Expect = 4.189e-76
Identity = 131/331 (39.58%), Postives = 185/331 (55.89%), Query Frame = 3
Query:  135 NTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV--------RMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
              NI CN++  L   QR+IC      I  +  G  +GI ECQ+QF    WNC+                   +T     +  G  E+AF  ++T+A VAH V+ ACS G   +CGCDR    Y   E+ ++W GCS +V +G  FS+RF+D+   R+IK+N    L+NLHN+ AG K++ + M ++CKCHGVSGSC TKTC+  LP  R++G +LKE+++ A+ V        R   F  +    G  + T+ DL +L+RSPN+C  +   GS GT+GRLCN+T  L        C  +CC RG +T Q+    +C CKF WCC V+C TC
Sbjct:   37 GANIICNKIPGLAPRQRAICQSRPDAIIIIGEGAQLGINECQYQFRYGRWNCSALG---------------ERTVFGQELRVGSKEAAFTYAITAAGVAHAVTAACSQGNLSHCGCDREKQGYHDQEEGWKWGGCSADVKYGVEFSRRFVDA---REIKKNARR-LMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYVLKERYTTALEVEAVRATRFRQPSFLRLKQSRGYIKPTDTDLVFLERSPNYCEEDTVTGSAGTRGRLCNHTSPLTD-----GCNLMCCGRGHNTHQYTRVWQCNCKFQWCCFVKCNTC 343          
BLAST of wntP-3 vs. Ensembl Zebrafish
Match: wnt7bb (wingless-type MMTV integration site family, member 7Bb [Source:ZFIN;Acc:ZDB-GENE-081006-1])

HSP 1 Score: 239.58 bits (610), Expect = 9.834e-76
Identity = 130/330 (39.39%), Postives = 189/330 (57.27%), Query Frame = 3
Query:  135 NTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAI---LVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
              NI CN++  L   QR+IC      I  +  G  +GI ECQ+QF    WNC+                   +T     +  G  E+AF  ++T+A VAH V+ ACS G   +CGCDR    Y   E+ ++W GCS ++ +G  FS++F+D+   R+IK+N    L+NLHN+ AG K++ + M ++CKCHGVSGSC TKTC+  LP  R++G +LK+K++KA+   +VR +  +    L    +   +  E DL Y++RSPN+C  +   GS+GTQGRLCN T        +G C  +CC RG++T Q+    +C CKF WCC V+C TC
Sbjct:   37 GANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQLGINECQYQFRYGRWNCSALG---------------ERTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQGYYNQEEGWKWGGCSADIKYGIEFSRKFVDA---REIKKNARR-LMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYVLKDKYNKAVQVEVVRASRLRQPTFLKVKRTRHQKPLETDLVYIERSPNYCEEDAKTGSVGTQGRLCNRTS----PHTDG-CDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTC 342          
BLAST of wntP-3 vs. Ensembl Zebrafish
Match: wnt7bb (wingless-type MMTV integration site family, member 7Bb [Source:ZFIN;Acc:ZDB-GENE-081006-1])

HSP 1 Score: 238.81 bits (608), Expect = 1.837e-75
Identity = 130/330 (39.39%), Postives = 189/330 (57.27%), Query Frame = 3
Query:  135 NTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAI---LVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
              NI CN++  L   QR+IC      I  +  G  +GI ECQ+QF    WNC+                   +T     +  G  E+AF  ++T+A VAH V+ ACS G   +CGCDR    Y   E+ ++W GCS ++ +G  FS++F+D+   R+IK+N    L+NLHN+ AG K++ + M ++CKCHGVSGSC TKTC+  LP  R++G +LK+K++KA+   +VR +  +    L    +   +  E DL Y++RSPN+C  +   GS+GTQGRLCN T        +G C  +CC RG++T Q+    +C CKF WCC V+C TC
Sbjct:   33 GANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQLGINECQYQFRYGRWNCSALG---------------ERTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQGYYNQEEGWKWGGCSADIKYGIEFSRKFVDA---REIKKNARR-LMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYVLKDKYNKAVQVEVVRASRLRQPTFLKVKRTRHQKPLETDLVYIERSPNYCEEDAKTGSVGTQGRLCNRTS----PHTDG-CDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTC 338          
BLAST of wntP-3 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 261.922 bits (668), Expect = 2.450e-84
Identity = 139/347 (40.06%), Postives = 204/347 (58.79%), Query Frame = 3
Query:   60 VYVNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            V++++   ++  L KL          T      L++ Q  +C R++ ++ SV  G  + I+ECQ+QF N  WNC+  + S+P                  ++ +G  E+AF+ +++SA VA  V++ACSSG  + CGCDRT++      FQW+GCSDN+ +G AFS+ F+D   + K   + S  L+NLHN+ AG K +++NM ++CKCHGVSGSCE KTC++A+P  RKVG++LKEKF  A  V          LVP +S     T+ DL YL  SP+FC H+   G LGT GR CN T     + ++G C  +CC RGF T++  + E+C CKF WCC V+C+ C
Sbjct:   14 VFLSAQGNLWEYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLD-SLP--------------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSK-GGSSSRALMNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWKAMPTFRKVGNVLKEKFDGATEVEQKKIGSTKVLVPKNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTTGRQCNKTS----KAIDG-CELMCCGRGFHTEEVEIIERCSCKFHWCCFVKCKQC 339          
BLAST of wntP-3 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 260.381 bits (664), Expect = 9.319e-84
Identity = 134/314 (42.68%), Postives = 193/314 (61.46%), Query Frame = 3
Query:  159 LMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            L++ Q  +C R++ ++ SV  G  + I+ECQ+QF N  WNC+  + S+P                  ++ +G  E+AF+ +++SA VA  V++ACSSG  + CGCDRT++      FQW+GCSDN+ +G AFS+ F+D   + K   + S  L+NLHN+ AG K +++NM ++CKCHGVSGSCE KTC++A+P  RKVG++LKEKF  A  V          LVP +S     T+ DL YL  SP+FC H+   G LGT GR CN T     + ++G C  +CC RGF T++  + E+C CKF WCC V+C+ C
Sbjct:   49 LIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLD-SLP--------------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSK-GGSSSRALMNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWKAMPTFRKVGNVLKEKFDGATEVEQKKIGSTKVLVPKNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTTGRQCNKTS----KAIDG-CELMCCGRGFHTEEVEIIERCSCKFHWCCFVKCKQC 341          
BLAST of wntP-3 vs. Ensembl Xenopus
Match: wnt3 (Wnt family member 3 [Source:NCBI gene;Acc:100125198])

HSP 1 Score: 230.72 bits (587), Expect = 3.863e-72
Identity = 131/352 (37.22%), Postives = 188/352 (53.41%), Query Frame = 3
Query:   66 VNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK--------LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            V +G  ++++L   Q+ +   L +  I C  +  L   Q   C  ++ ++PSV  G+ +GIQECQHQF    WNC     +I D                 +++K   ESAF+ ++ SA VA  V+++C+ G +  CGCD     +P D ++W GCS++  FG   S+ F D+   R   R+     +N HN+ AG   ++D+M ++CKCHG+SGSCE KTC+ + PD R +GD LK+K+  A  + +   +        L   +S     TE DL Y + SPNFC  NP  GS GTQGR CN T       ++G C  LCC RG +T+    KEKC C F WCC V CQ C
Sbjct:   18 VLAGYPIWWSLALGQQYST--LGSQPILCGSIPGLVPKQMRFCRNYIEIMPSVAEGIKLGIQECQHQFRGRRWNCT----TIHDSLA----------IFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSSTICGCDSHHKGSPGDGWKWGGCSEDADFGVLVSREFADARENRPDARS----AMNRHNNEAGRATILDHMHLRCKCHGLSGSCEVKTCWWSQPDFRAIGDHLKDKYDSASEMSVEKHRESRGWVETLRAKYSLFKPPTERDLVYYETSPNFCEPNPETGSFGTQGRSCNVTS----HGIDG-CDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQEC 344          
BLAST of wntP-3 vs. Ensembl Xenopus
Match: ENSXETT00000025270.1 (proto-oncogene Wnt-3-like [Source:NCBI gene;Acc:100487954])

HSP 1 Score: 230.72 bits (587), Expect = 4.442e-72
Identity = 131/352 (37.22%), Postives = 187/352 (53.12%), Query Frame = 3
Query:   66 VNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK--------LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            V +G  ++++L   Q+ +   L +  I C  +  L   Q   C  ++ ++PSV  G+ +GIQECQHQF    WNC     +I D                 +++K   ESAF+ ++ SA VA  V+ +C+ G +  CGCD     +P D ++W GCS++  FG   S+ F D+   R   R+     +N HN+ AG   ++D+M ++CKCHG+SGSCE KTC+ + PD R +GD LK+K+  A  + +   +        L   +S     TE DL Y + SPNFC  NP  GS GTQGR CN T       ++G C  LCC RG +T+    KEKC C F WCC V CQ C
Sbjct:   18 VLAGYPIWWSLALGQQYST--LGSQPILCGSIPGLVPKQMRFCRNYIEIMPSVAEGIKLGIQECQHQFRGRRWNCT----TIHDSLA----------IFGPVLDKATRESAFVHAIASAGVAFAVTHSCAEGSSTICGCDSHHKGSPGDGWKWGGCSEDADFGVLVSREFADAQENRPDARS----AINRHNNEAGRATILDHMHLRCKCHGLSGSCEVKTCWWSQPDFRAIGDHLKDKYDSASEMSVEKHRESRGWVETLRAKYSLFKPPTERDLVYYETSPNFCEPNPETGSFGTQGRSCNVTS----HGIDG-CDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQEC 344          
BLAST of wntP-3 vs. Ensembl Xenopus
Match: ENSXETT00000037217.1 (proto-oncogene Wnt-3 [Source:NCBI gene;Acc:101731015])

HSP 1 Score: 229.565 bits (584), Expect = 1.039e-71
Identity = 127/331 (38.37%), Postives = 177/331 (53.47%), Query Frame = 3
Query:  129 LNNTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK--------LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            L +  I C  +  L   Q   C  ++ ++PSV  G+ +GIQECQHQF    WNC     +I D                 +++K   ESAF+ ++ SA VA  V+++C+ G +  CGCD     +P D ++W GCS++  FG   S+ F D+   R   R+     +N HN+ AG   ++D+M ++CKCHG+SGSCE KTC+ + PD R +GD LK+K+  A  + +   +        L   +S     TE DL Y + SPNFC  NP  GS GTQGR CN T       ++G C  LCC RG +T+    KEKC C F WCC V CQ C
Sbjct:   30 LGSQPILCGSIPGLVPKQMRFCRNYIEIMPSVAEGIKLGIQECQHQFRGRRWNCT----TIHDSLA----------IFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSSTICGCDSHHKGSPGDGWKWGGCSEDADFGVLVSREFADARENRPDARSA----MNRHNNEAGRATILDHMHLRCKCHGLSGSCEVKTCWWSQPDFRAIGDHLKDKYDSASEMSVEKHRESRGWVETLRAKYSLFKPPTERDLVYYETSPNFCEPNPETGSFGTQGRSCNVTS----HGIDG-CDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQEC 337          
BLAST of wntP-3 vs. Ensembl Mouse
Match: Wnt4 (wingless-type MMTV integration site family, member 4 [Source:MGI Symbol;Acc:MGI:98957])

HSP 1 Score: 255.758 bits (652), Expect = 5.782e-82
Identity = 138/341 (40.47%), Postives = 201/341 (58.94%), Query Frame = 3
Query:   87 FFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV---RMNDFK-LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEIL 1097
            +  L KL          T      L++ Q  +C R++ ++ SV  G  + I+ECQ+QF N  WNC+  + S+P                  ++ +G  E+AF+ +++SA VA  V++ACSSG+ + CGCDRT++      FQW+GCSDN+ +G AFS+ F+D   + K   + S  L+NLHN+ AG K ++ +M ++CKCHGVSGSCE KTC+RA+P  R+VG  LKEKF  A  V   R+   + LVP ++     T+ DL YL+ SP+FC  +   G LGT+GR CN T     + ++G C  LCC RGF T Q  + E+C C+F WCC V+C+ C+ L
Sbjct:   25 WLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLD-SLP--------------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSK-GASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTCNKTS----KAIDG-CELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRL 344          
BLAST of wntP-3 vs. Ensembl Mouse
Match: Wnt7b (wingless-type MMTV integration site family, member 7B [Source:MGI Symbol;Acc:MGI:98962])

HSP 1 Score: 241.121 bits (614), Expect = 2.421e-76
Identity = 133/331 (40.18%), Postives = 182/331 (54.98%), Query Frame = 3
Query:  135 NTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV--------RMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
              NI CN++  L   QR+IC      I  +  G  +GI ECQHQF    WNC+                   KT     +  G  E+AF  ++T+A VAH V+ ACS G    CGCDR    Y    + ++W GCS +V +G  FS+RF+D+   R+IK+N    L+NLHN+ AG K++ D M ++CKCHGVSGSC TKTC+  LP  R+VG +LKEK++ A+ V        R   F  +       +  E DL Y+++SPN+C  + + GS+GTQGRLCN T           C  +CC RG++T Q+    +C CKF WCC V+C TC
Sbjct:   37 GANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALG---------------EKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDA---REIKKNARR-LMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGAD-----GCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTC 343          
BLAST of wntP-3 vs. Ensembl Mouse
Match: Wnt7b (wingless-type MMTV integration site family, member 7B [Source:MGI Symbol;Acc:MGI:98962])

HSP 1 Score: 240.736 bits (613), Expect = 3.806e-76
Identity = 133/331 (40.18%), Postives = 182/331 (54.98%), Query Frame = 3
Query:  135 NTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV--------RMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
              NI CN++  L   QR+IC      I  +  G  +GI ECQHQF    WNC+                   KT     +  G  E+AF  ++T+A VAH V+ ACS G    CGCDR    Y    + ++W GCS +V +G  FS+RF+D+   R+IK+N    L+NLHN+ AG K++ D M ++CKCHGVSGSC TKTC+  LP  R+VG +LKEK++ A+ V        R   F  +       +  E DL Y+++SPN+C  + + GS+GTQGRLCN T           C  +CC RG++T Q+    +C CKF WCC V+C TC
Sbjct:   33 GANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALG---------------EKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDA---REIKKNARR-LMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGAD-----GCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTC 339          
BLAST of wntP-3 vs. Ensembl Mouse
Match: Wnt7b (wingless-type MMTV integration site family, member 7B [Source:MGI Symbol;Acc:MGI:98962])

HSP 1 Score: 225.713 bits (574), Expect = 3.252e-71
Identity = 122/296 (41.22%), Postives = 167/296 (56.42%), Query Frame = 3
Query:  231 IGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV--------RMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            +GI ECQHQF    WNC+                   KT     +  G  E+AF  ++T+A VAH V+ ACS G    CGCDR    Y    + ++W GCS +V +G  FS+RF+D+   R+IK+N    L+NLHN+ AG K++ D M ++CKCHGVSGSC TKTC+  LP  R+VG +LKEK++ A+ V        R   F  +       +  E DL Y+++SPN+C  + + GS+GTQGRLCN T           C  +CC RG++T Q+    +C CKF WCC V+C TC
Sbjct:    1 MGIDECQHQFRFGRWNCSALG---------------EKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDA---REIKKNARR-LMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGAD-----GCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTC 272          
BLAST of wntP-3 vs. Ensembl Mouse
Match: Wnt7b (wingless-type MMTV integration site family, member 7B [Source:MGI Symbol;Acc:MGI:98962])

HSP 1 Score: 225.713 bits (574), Expect = 3.252e-71
Identity = 122/296 (41.22%), Postives = 167/296 (56.42%), Query Frame = 3
Query:  231 IGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV--------RMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            +GI ECQHQF    WNC+                   KT     +  G  E+AF  ++T+A VAH V+ ACS G    CGCDR    Y    + ++W GCS +V +G  FS+RF+D+   R+IK+N    L+NLHN+ AG K++ D M ++CKCHGVSGSC TKTC+  LP  R+VG +LKEK++ A+ V        R   F  +       +  E DL Y+++SPN+C  + + GS+GTQGRLCN T           C  +CC RG++T Q+    +C CKF WCC V+C TC
Sbjct:    1 MGIDECQHQFRFGRWNCSALG---------------EKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDA---REIKKNARR-LMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGAD-----GCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTC 272          
BLAST of wntP-3 vs. UniProt/SwissProt
Match: sp|P49337|WNT4_CHICK (Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.728e-82
Identity = 133/314 (42.36%), Postives = 194/314 (61.78%), Query Frame = 3
Query:  159 LMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            L++ Q  +C R++ ++ SV  G  + I+ECQ+QF N  WNC+  + ++P                  ++ +G  E+AF+ +++SA VA  V++ACSSG+   CGCDRT+       FQW+GCSDN+ +G AFS+ F+D   + K   + +  L+NLHN+ AG K +++NM ++CKCHGVSGSCE KTC++A+P  RKVG++LKEKF  A  V  ++      LVP +S     T+ DL YL  SP+FC H+   G LGT GR CN T     + ++G C  +CC RGF T +  V E+C CKF WCC+V+C+ C
Sbjct:   49 LIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLD-TLP--------------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELDKCGCDRTVQGGSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSK-GASSNRALMNLHNNEAGRKAILNNMRVECKCHGVSGSCEFKTCWKAMPPFRKVGNVLKEKFDGATEVEQSEIGSTKVLVPKNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTSGRQCNKTS----KAIDG-CELMCCGRGFHTDEVEVVERCSCKFHWCCSVKCKPC 341          
BLAST of wntP-3 vs. UniProt/SwissProt
Match: sp|P49338|WNT4_XENLA (Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 8.453e-82
Identity = 132/313 (42.17%), Postives = 192/313 (61.34%), Query Frame = 3
Query:  162 MKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            ++ Q  +C R++ ++ SV  G  + I+ECQ+QF N  WNC+  + ++P                  ++ +G  E+AF+ +++SA VA  V++ACSSG  + CGCDRT++      FQW+GCSDN+ +G AFS+ F+D   + K   + S  L+NLHN+ AG K +++NM ++CKCHGVSGSCE KTC++A+P  RKVG++LKEKF  A  V          LVP +S     T+ DL YL  SP+FC H+   G LGT GR CN T     + ++G C  +CC RGF T++  + E+C CKF WCC V+C+ C
Sbjct:   50 IQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLD-TLP--------------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQGFQWSGCSDNILYGVAFSQSFVDVRERSK-GGSSSRALMNLHNNEAGRKAILNNMRVECKCHGVSGSCEVKTCWKAMPTFRKVGNVLKEKFDGATEVEQKKIGSTKVLVPKNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTTGRQCNKTS----KAIDG-CELMCCGRGFHTEEVEIVERCSCKFHWCCFVKCKQC 341          
BLAST of wntP-3 vs. UniProt/SwissProt
Match: sp|P56705|WNT4_HUMAN (Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4)

HSP 1 Score: 256.914 bits (655), Expect = 1.234e-81
Identity = 139/341 (40.76%), Postives = 201/341 (58.94%), Query Frame = 3
Query:   87 FFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV---RMNDFK-LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEIL 1097
            +  L KL          T      L++ Q  +C R++ ++ SV  G  + I+ECQ+QF N  WNC+  + S+P                  ++ +G  E+AF+ +++SA VA  V++ACSSG+ + CGCDRT++      FQW+GCSDN+ +G AFS+ F+D   + K   + S  L+NLHN+ AG K ++ +M ++CKCHGVSGSCE KTC+RA+P  R+VG  LKEKF  A  V   R+   + LVP ++     T+ DL YL+ SP+FC  +   G LGT+GR CN T     + ++G C  LCC RGF T Q  + E+C CKF WCC V+C+ C+ L
Sbjct:   25 WLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLD-SLP--------------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSK-GASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS----KAIDG-CELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRL 344          
BLAST of wntP-3 vs. UniProt/SwissProt
Match: sp|P47793|WNT4A_DANRE (Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 2.483e-81
Identity = 130/315 (41.27%), Postives = 196/315 (62.22%), Query Frame = 3
Query:  159 LMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNP-SYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            L++ Q  IC R+V ++ +V  G  + I ECQ+QF N  WNC+    S+P                  ++ +G  E+AF+ ++++A+VA  V++ACSSG+   CGCDR ++    + FQW+GCSDN+ +G AFS+ F+D   + K  ++ +  L+NLHN+ AG K ++++M ++CKCHGVSGSCE KTC++A+P  RKVG+++KEKF  A  V +        LVP +S     T+ DL YL  SP+FC H+P + G +GT GR CN T     + ++G C  +CC RGF T++  V ++C CKF WCC V+C+ C
Sbjct:   49 LIQRQVQICKRNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLE-SVP--------------VFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELDKCGCDRNVHGVSPEGFQWSGCSDNIAYGVAFSQSFVDIRERSK-GQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVELRKVGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCEHDPRTPGIMGTAGRFCNKTS----KAIDG-CELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQC 342          
BLAST of wntP-3 vs. UniProt/SwissProt
Match: sp|P22724|WNT4_MOUSE (Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 4.045e-81
Identity = 138/341 (40.47%), Postives = 201/341 (58.94%), Query Frame = 3
Query:   87 FFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV---RMNDFK-LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEIL 1097
            +  L KL          T      L++ Q  +C R++ ++ SV  G  + I+ECQ+QF N  WNC+  + S+P                  ++ +G  E+AF+ +++SA VA  V++ACSSG+ + CGCDRT++      FQW+GCSDN+ +G AFS+ F+D   + K   + S  L+NLHN+ AG K ++ +M ++CKCHGVSGSCE KTC+RA+P  R+VG  LKEKF  A  V   R+   + LVP ++     T+ DL YL+ SP+FC  +   G LGT+GR CN T     + ++G C  LCC RGF T Q  + E+C C+F WCC V+C+ C+ L
Sbjct:   25 WLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLD-SLP--------------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSK-GASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTCNKTS----KAIDG-CELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRL 344          
BLAST of wntP-3 vs. TrEMBL
Match: B0LMF8 (Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=wntP-3 PE=2 SV=1)

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 372/372 (100.00%), Postives = 372/372 (100.00%), Query Frame = 3
Query:    3 MFLKXXXXXXXXXXXXXXKVYVNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 1118
            MFLKILVTVLLVIDIISIKVYVNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN
Sbjct:    1 MFLKILVTVLLVIDIISIKVYVNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 372          
BLAST of wntP-3 vs. TrEMBL
Match: T1DBK0 (Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 1.497e-146
Identity = 188/352 (53.41%), Postives = 268/352 (76.14%), Query Frame = 3
Query:   66 VNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETP-EDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 1118
            V SG+G+F+T+  +    + + NN+NI C +L++ Q+ +C  H  LIPSV+ G+ + +QECQHQF N++WNC+G+N+++P    S  KK   KT LDNLI KG  ES +L ++ SA VA+QV+ ACS GQ++YCGCD+T+Y+ P E N++W+GCS+N+HFGAAFSKRFLD+PHK+++++NP++GLV+LHNSH+G K+V+DNM +KCKCHGVSGSCE KTCYRALP LR +GDILK++F+ +I V + D KL+   + +  + E +LTY++RSPNFC  NP YGSLGT GRLCN T+  + ++ EGSC +LCC RG+   +++ +E C C+F+WCC V C+TC +  VE+ CN
Sbjct:   25 VESGKGIFYTIANIDSLDEMNRNNSNIICQKLIRHQQPLCKSHTELIPSVVRGLRLAVQECQHQFSNNHWNCSGYNITLP----SNKKKGRGKTILDNLIMKGTAESGYLNAIISAGVAYQVTLACSRGQHRYCGCDKTVYDMPLEGNYKWSGCSENIHFGAAFSKRFLDTPHKKRLRKNPTLGLVSLHNSHSGRKVVVDNMGVKCKCHGVSGSCEVKTCYRALPSLRIIGDILKKRFTASIFVELKDLKLISKENVKKNVLEDELTYVERSPNFCVRNPRYGSLGTSGRLCNITKNEDGKYSEGSCDNLCCGRGYRKTEYMKEENCHCQFIWCCNVTCETCMVKAVEAICN 372          
BLAST of wntP-3 vs. TrEMBL
Match: T1E0Z8 (Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 2.173e-115
Identity = 169/331 (51.06%), Postives = 229/331 (69.18%), Query Frame = 3
Query:  135 NTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPED-NFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVE--GSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 1118
            N  + C      QR++C +H  L+ SVI+G  +G+ ECQ+QF +  WNC GHN++I  +   ++K   ++TYLD LI +G PE+A++LS+ SA VAHQV+KACS G +  CGCDRTIY+TPE  NF+W+GCS N+HFGAAF+++FLD   K ++K+ P   L+NLHN+H G + VI NM  KCKCHGVSGSCE KTC RALPD R VGD+LK +F K + V  ++ +LVP +      T++DL YL  SPN+C HNP  GSLGT+GR C  + +LE +  E  G+C  LCC RG + + F+ +E+C+CKF WCC V+C  C+   VES CN
Sbjct:   64 NKEVLCRTFGNHQRALCHQHFRLMESVINGFLLGLTECQYQFADQIWNCKGHNITIATKSKKKNKTTKKRTYLDKLIARGTPEAAYVLSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPETANFKWSGCSHNIHFGAAFTRQFLDVNEKVRLKKRPEKALMNLHNNHVGRQAVITNMGKKCKCHGVSGSCEMKTCIRALPDFRIVGDLLKSRFHKGMQVHFDNSRLVPRNPTTRMFTDNDLIYLNLSPNYCKHNPKIGSLGTRGRKCVESALLEKKTTENTGNCNELCCNRGHTRRTFIREEQCRCKFQWCCDVKCDLCKKEVVESVCN 394          
BLAST of wntP-3 vs. TrEMBL
Match: C3U5B1 (Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 4.815e-114
Identity = 167/342 (48.83%), Postives = 222/342 (64.91%), Query Frame = 3
Query:  111 ESTKFDLNNT---NIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPE-DNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEH--EFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 1118
            ++ +  +NN+    + C      QR +C +H  L+ SV++G  +G+ ECQ QF +  WNC GHNL+I         +K  KTYLD L++KG PE+A++ S+ SA VAHQV+KACS G +  CGCDRTIY+TPE + F+W+GCS N+HFGAAF+++FLD P K ++ + P   L  LHN+H G + VI  M  KCKCHGVSGSCE KTC RALPD R VGD+LK +F KA+ V   D +L+P +      T++DL YL +SPN+C HNP +GSLGTQGR C    +LE   E   GSC  LCC RG   + F   E+C CKF WCC V+C  C    +E+ C+
Sbjct:   60 QNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNLTIGGHRTKSKPRKKGKTYLDKLVSKGTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAEMSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 401          
BLAST of wntP-3 vs. TrEMBL
Match: Q589S7 (Protein Wnt OS=Dugesia japonica OX=6161 GN=Djwnt-A PE=2 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.574e-113
Identity = 169/358 (47.21%), Postives = 230/358 (64.25%), Query Frame = 3
Query:   63 YVNSGRGMFFTLMKLQESTKFDLNNT---NIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPED-NFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVE--GSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 1118
            Y N G     +     ++ +  +NN+   ++ C    + QR +C +H  L+ SV++G  +G+ ECQ QF +  WNC GHN++I         +K  KTYLD L++KG PE+A++LS+ SA VAHQV+KACS G +  CGCDRTIY+ PE   F+W+GCS N+HFGAAF+++FLD   K ++ + P   L  LHN+H G + VI  M  KCKCHGVSGSCE KTC RALPD R VGD+LK +F KA+ V   D +L+P +S     T++DL YL +SPN+C HNP  GSLGTQGR C  + +LE +  E  G+C  LCC RG   + F   E+C+CKF WCC V+C  C+   +ES C+
Sbjct:   45 YNNIGDSDSISNSDSGQNQQLPINNSPSKDMICQTFSRHQRKLCNQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNMTIGGNRSKSKPRKKGKTYLDKLVSKGTPEAAYVLSVISAGVAHQVTKACSKGVHDSCGCDRTIYDIPETATFKWSGCSHNIHFGAAFTRQFLDITEKTRVNKRPEKALTKLHNNHVGRQAVILKMGKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYSPNRMFTDNDLIYLLKSPNYCVHNPHIGSLGTQGRKCAESALLEKKPGETNGTCEELCCGRGHKKRTFSRMEQCRCKFQWCCDVKCDLCKKDVIESVCD 402          
BLAST of wntP-3 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 250.366 bits (638), Expect = 4.985e-80
Identity = 130/325 (40.00%), Postives = 198/325 (60.92%), Query Frame = 3
Query:  129 LNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNP-SYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            ++ + + CN   +     C R+V ++ +V  G  + I ECQ+QF N  WNC+    ++P                  ++ +G  E+AF+ ++++A+VA  V++ACSSG+ + CGCDR ++    D FQW+GCSDN+ +G AFS+ F+D   + K  ++ +  L+NLHN+ AG K ++++M ++CKCHGVSGSCE KTC++A+P  RKVG+++KEKF  A  V          LVP +S     T+ DL YL  SP+FC H+P + G LGT GR CN T     + ++G C  +CC RGF T++  V ++C CKF WCC V+C+ C
Sbjct:   41 IHKSGVLCNICFR-----CKRNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLE-TVP--------------VFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRNVHGVSPDGFQWSGCSDNIAYGVAFSQSFVDIRERGK-GQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYCNKTS----KAIDG-CELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQC 339          
BLAST of wntP-3 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 249.21 bits (635), Expect = 6.401e-80
Identity = 128/307 (41.69%), Postives = 191/307 (62.21%), Query Frame = 3
Query:  183 CLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNP-SYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            C R+V ++ +V  G  + I ECQ+QF N  WNC+    ++P                  ++ +G  E+AF+ ++++A+VA  V++ACSSG+ + CGCDR ++    D FQW+GCSDN+ +G AFS+ F+D   +R   ++ +  L+NLHN+ AG K ++++M ++CKCHGVSGSCE KTC++A+P  RKVG+++KEKF  A  V          LVP +S     T+ DL YL  SP+FC H+P + G LGT GR CN T     + ++G C  +CC RGF T++  V ++C CKF WCC V+C+ C
Sbjct:   31 CKRNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLE-TVP--------------VFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRNVHGVSPDGFQWSGCSDNIAYGVAFSQSFVDI-RERGKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYCNKTS----KAIDG-CELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQC 316          
BLAST of wntP-3 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 248.054 bits (632), Expect = 1.628e-79
Identity = 127/305 (41.64%), Postives = 190/305 (62.30%), Query Frame = 3
Query:  189 RHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNP-SYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            R+V ++ +V  G  + I ECQ+QF N  WNC+    ++P                  ++ +G  E+AF+ ++++A+VA  V++ACSSG+ + CGCDR ++    D FQW+GCSDN+ +G AFS+ F+D   +R   ++ +  L+NLHN+ AG K ++++M ++CKCHGVSGSCE KTC++A+P  RKVG+++KEKF  A  V          LVP +S     T+ DL YL  SP+FC H+P + G LGT GR CN T     + ++G C  +CC RGF T++  V ++C CKF WCC V+C+ C
Sbjct:   30 RNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLE-TVP--------------VFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRNVHGVSPDGFQWSGCSDNIAYGVAFSQSFVDI-RERGKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYCNKTS----KAIDG-CELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQC 313          
BLAST of wntP-3 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 247.284 bits (630), Expect = 3.271e-79
Identity = 127/305 (41.64%), Postives = 190/305 (62.30%), Query Frame = 3
Query:  189 RHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNP-SYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            R+V ++ +V  G  + I ECQ+QF N  WNC+    ++P                  ++ +G  E+AF+ ++++A+VA  V++ACSSG+ + CGCDR ++    D FQW+GCSDN+ +G AFS+ F+D   +R   ++ +  L+NLHN+ AG K ++++M ++CKCHGVSGSCE KTC++A+P  RKVG+++KEKF  A  V          LVP +S     T+ DL YL  SP+FC H+P + G LGT GR CN T     + ++G C  +CC RGF T++  V ++C CKF WCC V+C+ C
Sbjct:   26 RNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLE-TVP--------------VFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRNVHGVSPDGFQWSGCSDNIAYGVAFSQSFVDI-RERGKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYCNKTS----KAIDG-CELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQC 309          
BLAST of wntP-3 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 241.506 bits (615), Expect = 5.829e-77
Identity = 127/309 (41.10%), Postives = 192/309 (62.14%), Query Frame = 3
Query:  189 RHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAG-HNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNP-SYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEIL 1097
            R+V ++ +V  G  + I ECQ+QF N  WNC+    + +  + V+Q++                 E+AF+ ++++A+VA  V++ACSSG+ + CGCDR ++    D FQW+GCSDN+ +G AFS+ F+D   +R   ++ +  L+NLHN+ AG K ++++M ++CKCHGVSGSCE KTC++A+P  RKVG+++KEKF  A  V          LVP +S     T+ DL YL  SP+FC H+P + G LGT GR CN T     + ++G C  +CC RGF T++  V ++C CKF WCC V+C+ C  +
Sbjct:   27 RNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLETVPVFGKVVTQTR-----------------EAAFVYAISAASVAFAVTRACSSGELEKCGCDRNVHGVSPD-FQWSGCSDNIAYGVAFSQSFVDI-RERGKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYCNKTS----KAIDG-CELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKM 311          
BLAST of wntP-3 vs. Ensembl Sea Lamprey
Match: wnt3 (wingless-type MMTV integration site family, member 3 [Source:ZFIN;Acc:ZDB-GENE-081003-1])

HSP 1 Score: 213.001 bits (541), Expect = 4.274e-66
Identity = 121/331 (36.56%), Postives = 169/331 (51.06%), Query Frame = 3
Query:  129 LNNTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKA---ILVRMNDFK-----LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            L +  + C  +  L   Q   C  +  L+PSV  GV +GIQECQHQF    WNC              +           ++ +   E++F+ +++SA V   V++AC+ G +  CGCD      P   ++W GCS++  FG   S+ F D+   R   R+     +N HN+ AG   ++D M  KCKCHG+SGSCE KTC+ A P  R VGD LK+K+  A   ++ R  + +     L P +       E DL Y + SPNFC  +   GSLGT GR CN    L    ++G C  LCC RG++T     +EKC+C F WCC V CQ C
Sbjct:   38 LGSQPVLCASIPGLVPKQLRFCRNYQELMPSVAEGVRLGIQECQHQFRGRRWNC--------------TTMTEGPAIFGPVLERATREASFVHAVSSAGVGFAVTRACADGTSTICGCDNKHRGEPSGGWKWGGCSEDADFGVMVSREFADARENRPDARS----AMNRHNNEAGRVSILDFMQRKCKCHGLSGSCEVKTCWWAQPSFRTVGDHLKDKYDSASEMLVERHRESRGWVETLRPKYPLFKPPAERDLVYYETSPNFCEPSAETGSLGTHGRPCN----LTSHGIDG-CDLLCCSRGYNTHTERRREKCKCVFHWCCYVSCQEC 345          
BLAST of wntP-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010914.1 (pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 gene:ENSPMAG00000009890.1 transcript:ENSPMAT00000010914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.978 bits (502), Expect = 4.052e-60
Identity = 125/366 (34.15%), Postives = 181/366 (49.45%), Query Frame = 3
Query:   63 YVNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNC-AGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETP-EDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNP------------------SVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFS-KAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            +V++       L  +Q    + L+   +   QL+ L   QR +C  +   +P +  G  + ++ECQHQF    WNC AG   S+  R                L + G  E+AF  ++++A VAH VS+AC  G+   CGC R       + ++ W GC DN+ +G  F++ F+D+  + +  +                    S  L+NLHN+ AG + V     + CKCHGVSGSC  KTC+  L D RKVG  LKEK+   +        KL P +   S  +  DL YL  SP++C  N + GSLGT GR CN T     E ++G C  +CC RG+   +  V E+C CKF WCC V+C+ C
Sbjct:   21 HVDASEWWSLALSPMQRPEAYLLSAQPLC--QLVGLSPGQRKLCHLYQDHVPHIADGARLAVRECQHQFRTRRWNCSAGEGDSVFGR----------------LTHIGSRETAFAHAISAAGVAHAVSRACREGELATCGCSRAPRPRELQRDWLWGGCGDNLEYGYRFAREFVDAREREQGGQQQQQQQQQQQQLAARHSVEHSRTLMNLHNNEAGRRAVYGLADVACKCHGVSGSCSLKTCWLQLADFRKVGKFLKEKYDSASAARAGRRAKLEPANRKFSPPSAGDLVYLDASPDYCVRNETTGSLGTIGRSCNKTS----EGMDG-CELMCCGRGYDHFKATVVERCNCKFHWCCYVKCKKC 363          
BLAST of wntP-3 vs. Ensembl Sea Lamprey
Match: wnt1 (wingless-type MMTV integration site family, member 1 [Source:NCBI gene;Acc:30128])

HSP 1 Score: 162.54 bits (410), Expect = 8.599e-48
Identity = 94/270 (34.81%), Postives = 132/270 (48.89%), Query Frame = 3
Query:  372 GLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV---------------------RMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSL-GTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRC 1115
            G  E+AF+ ++ SAA+AH V++ACS G    C CD         +++W GCSDN+ FG  F++       +R  +   +  L++ HN  AG + V   M  +CKCHG+SGSC  KTC+  LP  R VGD LKE+F  A  V                           L P           DL Y+  SP FC+ + +  S  GT+GR+C     +      G C  LCC RG+++++  V E+C C F WCCTV CQ C  ++    C
Sbjct:    4 GCRETAFIHAVMSAALAHGVARACSEGSIASCTCDYGRRGRGGPDWEWGGCSDNLPFGTRFARELAAGAGERGGR--DARALMDRHNEEAGMRTVDSEMRRECKCHGMSGSCALKTCWLRLPPFRAVGDRLKERFDGATQVADYGREGNRASKDSDRGGGGSGGGGGHLRPADPAHKPPGGRDLVYVDESPEFCHADTAGLSWPGTRGRVC-----VRGSPGLGGCELLCCGRGWTSREARVSERCLCTFHWCCTVTCQNCTRVETVHEC 266          
BLAST of wntP-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001922.1 (pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 gene:ENSPMAG00000001738.1 transcript:ENSPMAT00000001922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.754 bits (382), Expect = 5.092e-43
Identity = 105/343 (30.61%), Postives = 157/343 (45.77%), Query Frame = 3
Query:  135 NTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSD-NVHFGAAFSKRFLDSPHKRKIKRNPSVGL----VNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMND--------FKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRC 1115
              NI CN++  L   QR++C     +I  +  G  +GI ECQ+QF    WNC    L     F  + K   R T+  ++ + G              +  ++ + C  G ++   C + +    E    W   +  +  FG   S  FL   +     RN  +      V     H+  +++ + M ++CKCHGVSGSC TKTC+  LP  R+VG  LK+K+   + V            F  V       +  + +L + +RSPN+C  +P+ GS GT+GRLCN T        +G C  LCC RG++T Q+    +C CKF WCC V+C TC     E  C
Sbjct:    2 GANIICNKIPGLAPRQRALCQSRPDVIIVIGEGAQLGISECQYQFRFGRWNCTA--LGERTVFGQELKVAIRSTHFTDIQSGG-------------GLFERIHQRCRYGAHELSLCSQ-LTRGREGPHPWLRMTPLDEQFGQKTSSTFLKIVYIHYNYRNSDLAQLMQKVPYRRFHSTDQVLEEKMKLECKCHGVSGSCTTKTCWTTLPKFREVGYALKDKYEHTVHVEPVSGSRYMRPMFLKVKKSRSYRKPLDTELVFTERSPNYCEEDPATGSAGTRGRLCNRTS----PHADG-CDLLCCGRGYNTHQYTRAWQCNCKFHWCCYVRCSTCSERTEEYTC 323          
BLAST of wntP-3 vs. Ensembl Sea Lamprey
Match: wnt10a (wingless-type MMTV integration site family, member 10a [Source:NCBI gene;Acc:30171])

HSP 1 Score: 141.739 bits (356), Expect = 1.521e-39
Identity = 96/297 (32.32%), Postives = 137/297 (46.13%), Query Frame = 3
Query:  372 GLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPE------------------------------------DNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPM--------------HSGESRIT--------EHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            G  E+AF  ++ +A V H V+ ACS G+ K CGCD  +    E                                    D ++W GCS ++ FG  FS+ FLDS   R+  R+       LHN+  G ++V+++   KCKCHG SGSC+ KTC++  PD R VGD L+++F  A  +  ++   VP                S  +++T        + +L Y +RSP FC         GTQGR+CN T        +G C  +CC RG +       E+C CKF WCC V C+ C
Sbjct:    1 GYRETAFAYALAAAGVMHAVASACSLGKLKTCGCDEKLKGDEEAFRVKLIKLKMQMLSQGKAAANGVLPHVPADAPGSPDTWEWGGCSHDLEFGEKFSRDFLDS---RETSRDIHA-RTRLHNNRVGRRVVLEHKRRKCKCHGTSGSCQLKTCWQVSPDFRTVGDTLRDRFHLAAFLAPHNRHGVPALALVSGGGHHHHHQGSSSAQVTGRRYRPPDDGELLYFERSPTFCERGAGSEWPGTQGRVCNRTS----SGADG-CESMCCGRGHNQISESRMERCNCKFHWCCYVVCEEC 288          
BLAST of wntP-3 vs. Ensembl Nematostella
Match: EDO31000 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54])

HSP 1 Score: 246.128 bits (627), Expect = 1.036e-78
Identity = 135/322 (41.93%), Postives = 187/322 (58.07%), Query Frame = 3
Query:  150 CNQLMKL----QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQ-NKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRM----NDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            C+++ +L    Q  +C R++ ++ SV  G  + + ECQHQF    WNC     S             R     N IN G  E+AF+ +++SA VA+ V++ACSSG+  + CGCDR       D F WAGCSD++ FG  F+ RF+D+  +     +P+  L+NLHN+  G   V   M ++CKCHGVSGSC  KTC+RALP+ R VGD +KEKF  A  V          LVP +      T+ DL YL +SP+FC  NP  GSLGTQGR+CN T     + ++G C  +CC RG+ ++  + +E+C CKF WCC V+CQTC
Sbjct:   42 CDEIGQLLNHRQVQVCKRNIQVMDSVKDGASVALFECQHQFRYRPWNCTTVQFS-------------RSPVFGNSINGGTREAAFVHAISSAGVAYAVTQACSSGRLGQKCGCDRKT-RGQADGFNWAGCSDDIDFGMTFATRFVDARERGSGIGSPARVLMNLHNNRGGRLAVKKFMDLQCKCHGVSGSCNIKTCWRALPNFRIVGDYIKEKFDGATEVEYKLIGGKHVLVPKNRKYKPHTQMDLVYLVQSPDFCEPNPKTGSLGTQGRICNRTS----QAIDG-CDLMCCGRGYVSRTEVRQEQCACKFFWCCHVRCQTC 344          
BLAST of wntP-3 vs. Ensembl Nematostella
Match: EDO49431 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9])

HSP 1 Score: 237.269 bits (604), Expect = 3.612e-75
Identity = 127/334 (38.02%), Postives = 175/334 (52.40%), Query Frame = 3
Query:  159 LMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK---------------LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRC 1115
            L + Q  I  R+  LI  +  G    I ECQHQF N  WNC+ H+   P+    +            ++ +   E+AF  ++T+A V+H +++AC  G+   C CD+      +  +QW GCSDN+HF   FSKRF+D+  K +  R      +NLHN+ AG   V +NM+++CKCHG+S +C  KTC++ LPD R VGD LK KF  A +V                      +P      R T +DL Y + SPNFC  NPS GSLGTQGR CN T +         C  +CC RGF+T      E C C+F WCC V+CQ C+  ++ S C
Sbjct:   53 LTQKQIRISRRYPELIQYIAGGARTAIHECQHQFRNRKWNCSAHS---PENVFGK------------ILKRACRETAFTYAITAAGVSHAIARACGEGKLSACSCDQRYRGVSKQGWQWGGCSDNIHFADNFSKRFVDAQEKGRDFR----AQINLHNNEAGRAAVRNNMIVECKCHGLSEACTVKTCWKRLPDFRLVGDDLKRKFDNASMVEYQQNNNNRNSNRNRNEDPALFIPSKPYLRRPTVYDLVYYEHSPNFCERNPSAGSLGTQGRECNTTSM-----GTDGCELMCCGRGFTTSSQERVENCNCRFFWCCEVKCQKCKTRRIISNC 362          
BLAST of wntP-3 vs. Ensembl Nematostella
Match: WNT2 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5])

HSP 1 Score: 232.646 bits (592), Expect = 1.628e-73
Identity = 122/320 (38.12%), Postives = 181/320 (56.56%), Query Frame = 3
Query:  144 IFCNQ---LMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDF--KLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            + CN    L+ +QR +CL +  ++ S+  G  +G++ECQHQF +  WNC+  N                 T    ++ +   E+AF+ +++SA V H+V+++CS G+ K C C R         F+W GCSDN+ +G  F+K F+DS    K  R     L+NLHN+H G ++V  NM + CKCHGVSGSC  +TC++++   R VG  L+EK++ A+ V +     +L        + +  DL YL+ SPN+C  + + GSLGT GR CN +         G+C+ LCC RGF+T Q   + KC CKF WCC V+CQTC
Sbjct:   40 VMCNSITGLISIQRQMCLDNPDVMVSIGKGAKLGVEECQHQFRDQRWNCSTVNGDA--------------TVFGKVMRRASRETAFVYAISSAGVVHEVTRSCSLGELKDCSC-RNKKGRSRKGFEWGGCSDNIQYGLNFAKAFVDSREVEKDAR----ALMNLHNNHVGRRVVKTNMSLDCKCHGVSGSCSVRTCWKSISSFRIVGQHLREKYTTAVQVTVGQSGGELTNAEVSYKKPSRDDLVYLEDSPNYCMVDSNTGSLGTSGRECNGSA----SDTTGACSLLCCGRGFNTIQIEEEYKCHCKFHWCCYVKCQTC 336          
BLAST of wntP-3 vs. Ensembl Nematostella
Match: EDO37901 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:Q5IRC2])

HSP 1 Score: 219.164 bits (557), Expect = 2.694e-68
Identity = 117/322 (36.34%), Postives = 181/322 (56.21%), Query Frame = 3
Query:  171 QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPS--VGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVR-----MNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRC 1115
            Q  IC R++  +  V   V++  +ECQHQF N  WNC+   +    +F+               + +G PE+AF+ ++++AA+ + +++AC   + K C C  T  +    + +W GC DN+  G  FSK F D+   ++++++ S  V L+NLHN+  G K V   +   C+CHGVSG C  KTC R L D R V D+LK ++++ + V          +++    G  R T  DL  L+ SPN+C+ N   G+ GT GRLC+ T+       EGSCA+LCC RG  T++ + +E+C+CK++WCC V+CQTC     ESRC
Sbjct:   50 QYKICRRNLPAMLYVTAAVEMTREECQHQFQNKRWNCS--TIVKAPQFLPD-------------LKRGTPEAAFVYALSAAALTYSITQACGMKRLKPCKCG-TNPKFKHPDGEWGGCHDNIARGMRFSKDFTDAVEAQRMRKHKSMAVALMNLHNNGVGRKAVHSRLEFHCRCHGVSGGCTAKTCIRRLGDFRLVADLLKNRYARIVYVESKTKSKRKARVLKSKRGRRRYTSSDLVALQGSPNYCHKNRKRGTAGTHGRLCDPTK----RRGEGSCAYLCCGRGHRTEEVVHEERCECKYIWCCYVKCQTCRKRVRESRC 351          
BLAST of wntP-3 vs. Ensembl Nematostella
Match: WNT3 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RXF5])

HSP 1 Score: 215.698 bits (548), Expect = 5.659e-67
Identity = 121/348 (34.77%), Postives = 186/348 (53.45%), Query Frame = 3
Query:   72 SGRGMFFTLMKLQESTKFDLNNTNIFC---NQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILV-----RMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCE 1091
            S   +++TL   Q S   D    ++ C    Q    Q+ +C ++  L+  V HG   G+ EC+HQF N  WNC              S  +   +  +++++KG  E+AF+ ++T+A VAH V+ ACS G+ + C CDR +       + W+GC+ N+ FG  FSK+F ++  +    R     ++N HNS AG K + + +  KCKCHG+SGSC  KTC+    + R++GD LK K+  A+ +     R    +L P +S   + ++ DL Y + SPN+C  N + GSLGT GR CN T       ++G C  LCC RG + +Q  +   C C F WCC V+C+ C+
Sbjct:   17 SSEAVWWTL-GTQLSVSSDPAKKSMLCYVTRQFNSRQQEVCRKNPDLMEHVAHGAKYGVHECRHQFRNRRWNC--------------STIRESGSLFESVLSKGCREAAFVHAVTAAGVAHSVTDACSKGRIESCDCDRNLSGRSSKGWTWSGCNSNIKFGVWFSKQFTEARERGGDLRQ----IMNRHNSRAGRKALEELVWRKCKCHGLSGSCSMKTCWMQQANFRQIGDHLKVKYDSAVEMTTKVNRRGKKRLKPKYSHFKKPSDKDLIYFETSPNYCDKNVTVGSLGTSGRQCNYTS----NGIDG-CELLCCGRGHNIQQAKITRNCNCVFKWCCEVKCERCK 340          
BLAST of wntP-3 vs. Ensembl Medaka
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100301590])

HSP 1 Score: 254.218 bits (648), Expect = 1.762e-81
Identity = 131/315 (41.59%), Postives = 191/315 (60.63%), Query Frame = 3
Query:  159 LMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNP-SYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            L++ Q  IC R V ++ +V  G  + I ECQ QF N  WNC+    ++P                   I +G  E+AF+ ++++A+VA  V++ACSSG+ + CGCD  ++    + FQW+GCSDN+ +G AFS+ F+D   + K  ++ S  L+NLHN+ AG K ++ NM ++CKCHGVSGSCE KTC++A+P  RKVG+++KEKF  A  V          LVP +S     T+ DL YL+ SP+FC  +P + G LGT GR CN T     + ++G C  +CC RGF T++  V ++C CKF WCC V+C+ C
Sbjct:   51 LIQRQVQICKRSVEVMDAVRRGAQLAIDECQFQFRNRRWNCSTLE-TLP--------------VFSKAITQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDHNVHGVSPEGFQWSGCSDNIAYGVAFSQSFVDVRERSKGGQSSSQALMNLHNNEAGRKAILSNMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKVGSTKVLVPRNSQFKPHTDEDLVYLQPSPDFCDFDPRTPGMLGTVGRQCNRTS----KAIDG-CELMCCGRGFQTQEVEVVDRCSCKFHWCCYVKCKQC 345          
BLAST of wntP-3 vs. Ensembl Medaka
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100301590])

HSP 1 Score: 253.832 bits (647), Expect = 2.845e-81
Identity = 131/315 (41.59%), Postives = 191/315 (60.63%), Query Frame = 3
Query:  159 LMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK----LVPMHSGESRITEHDLTYLKRSPNFCYHNP-SYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
            L++ Q  IC R V ++ +V  G  + I ECQ QF N  WNC+    ++P                   I +G  E+AF+ ++++A+VA  V++ACSSG+ + CGCD  ++    + FQW+GCSDN+ +G AFS+ F+D   + K  ++ S  L+NLHN+ AG K ++ NM ++CKCHGVSGSCE KTC++A+P  RKVG+++KEKF  A  V          LVP +S     T+ DL YL+ SP+FC  +P + G LGT GR CN T     + ++G C  +CC RGF T++  V ++C CKF WCC V+C+ C
Sbjct:   49 LIQRQVQICKRSVEVMDAVRRGAQLAIDECQFQFRNRRWNCSTLE-TLP--------------VFSKAITQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDHNVHGVSPEGFQWSGCSDNIAYGVAFSQSFVDVRERSKGGQSSSQALMNLHNNEAGRKAILSNMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKVGSTKVLVPRNSQFKPHTDEDLVYLQPSPDFCDFDPRTPGMLGTVGRQCNRTS----KAIDG-CELMCCGRGFQTQEVEVVDRCSCKFHWCCYVKCKQC 343          
BLAST of wntP-3 vs. Ensembl Medaka
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:101155025])

HSP 1 Score: 244.202 bits (622), Expect = 1.409e-77
Identity = 134/332 (40.36%), Postives = 190/332 (57.23%), Query Frame = 3
Query:  135 NTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAI---LVRMNDFKLVPMH------SGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
              NI CN++  L   QR+IC      I  V  G  +GI ECQ+QF    WNC+                   +T     +  G  E+AF  ++T+A VAH ++ ACS G    CGCDR    Y   E+ ++W GCS ++ +G  FS+RF+D+   R+IK+ P   L+NLHN+ AG K++ + M ++CKCHGVSGSC TKTC+  LP  R++G ILKEK+++A+   +VR +  +  P H       G  +  E DL Y++RSPN+C  + + GS+GTQGRLCN T        +G C  +CC RG++T Q+    +C CKF WCC V+C TC
Sbjct:   37 GANIICNKIPGLAPRQRAICQSRPDAIIVVGEGAQMGINECQYQFRYGRWNCSALG---------------ERTVFGQELRVGSREAAFTYAITAAGVAHAITAACSQGNLSQCGCDREKQGYYNQEEGWKWGGCSADIKYGIEFSRRFVDA---REIKKTPRR-LMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYILKEKYNEAVHVEVVRASRLRQ-PTHLKVKQTQGYRKPMETDLVYIERSPNYCEEDAATGSVGTQGRLCNRTS----PHTDG-CDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTC 343          
BLAST of wntP-3 vs. Ensembl Medaka
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:101155025])

HSP 1 Score: 243.817 bits (621), Expect = 1.904e-77
Identity = 134/332 (40.36%), Postives = 190/332 (57.23%), Query Frame = 3
Query:  135 NTNIFCNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTI--YETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAI---LVRMNDFKLVPMH------SGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTC 1088
              NI CN++  L   QR+IC      I  V  G  +GI ECQ+QF    WNC+                   +T     +  G  E+AF  ++T+A VAH ++ ACS G    CGCDR    Y   E+ ++W GCS ++ +G  FS+RF+D+   R+IK+ P   L+NLHN+ AG K++ + M ++CKCHGVSGSC TKTC+  LP  R++G ILKEK+++A+   +VR +  +  P H       G  +  E DL Y++RSPN+C  + + GS+GTQGRLCN T        +G C  +CC RG++T Q+    +C CKF WCC V+C TC
Sbjct:   33 GANIICNKIPGLAPRQRAICQSRPDAIIVVGEGAQMGINECQYQFRYGRWNCSALG---------------ERTVFGQELRVGSREAAFTYAITAAGVAHAITAACSQGNLSQCGCDREKQGYYNQEEGWKWGGCSADIKYGIEFSRRFVDA---REIKKTPRR-LMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYILKEKYNEAVHVEVVRASRLRQ-PTHLKVKQTQGYRKPMETDLVYIERSPNYCEEDAATGSVGTQGRLCNRTS----PHTDG-CDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTC 339          
BLAST of wntP-3 vs. Ensembl Medaka
Match: wnt4b (wingless-type MMTV integration site family member 4b [Source:NCBI gene;Acc:100301591])

HSP 1 Score: 231.491 bits (589), Expect = 1.261e-72
Identity = 126/323 (39.01%), Postives = 182/323 (56.35%), Query Frame = 3
Query:  150 CNQLMKL---QRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVG--LVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDF----KLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCE 1091
            C +L  L   Q  +C     ++ SV    ++ I+ECQHQF N  WNC+     I                   ++N+G  E+AF+ +++SAAVA  V++AC+ G+ + CGCDR +     + FQW+GCSDN+ +G AFS+ F+D P + K     S G  L+NLHN+ AG K ++ NM ++CKCHGVSGSCE +TC++ +P  R+VG +LKE+F  A  VR+        L+P           DL YL  SP+FC+ +P  G  GT GR CN T  L  +     C  +CC  G+   +  V ++C CKF WCC+V+CQ C+
Sbjct:   47 CGRLRGLTPGQVGVCRARGEVMESVRKAAEMVIEECQHQFRNRRWNCSTTPRGI--------------NVFGRVMNQGTREAAFVHALSSAAVAVAVTRACTRGELERCGCDRKVRGVSPEGFQWSGCSDNLSYGVAFSQTFVDEPERGK---GLSAGRPLMNLHNNEAGRKAILHNMQVECKCHGVSGSCELRTCWKVMPPFRRVGIVLKERFDGATEVRLTRIGSRPALLPRDPYVKPPAARDLVYLSPSPDFCHLDPDNGIPGTAGRRCNGTSRLAPD----GCELVCCGPGYKAGRAEVVQRCSCKFSWCCSVRCQQCK 348          
BLAST of wntP-3 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 372/372 (100.00%), Postives = 372/372 (100.00%), Query Frame = 3
Query:    3 MFLKXXXXXXXXXXXXXXKVYVNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 1118
            MFLKILVTVLLVIDIISIKVYVNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN
Sbjct:    1 MFLKILVTVLLVIDIISIKVYVNSGRGMFFTLMKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 372          
BLAST of wntP-3 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 340/340 (100.00%), Postives = 340/340 (100.00%), Query Frame = 3
Query:   99 MKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 1118
            MKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN
Sbjct:    1 MKLQESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 340          
BLAST of wntP-3 vs. Planmine SMEST
Match: SMESG000051375.1 (SMESG000051375.1)

HSP 1 Score: 345.895 bits (886), Expect = 5.106e-117
Identity = 166/342 (48.54%), Postives = 222/342 (64.91%), Query Frame = 3
Query:  111 ESTKFDLNNT---NIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPE-DNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEH--EFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 1118
            ++ +  +NN+    + C      QR +C +H  L+ SV++G  +G+ ECQ QF +  WNC GHNL+I         +K  KTYLD L++K  PE+A++ S+ SA VAHQV+KACS G +  CGCDRTIY+TPE + F+W+GCS N+HFGAAF+++FLD P K ++ + P   L  LHN+H G + VI  M  KCKCHGVSGSCE KTC RALPD R VGD+LK +F KA+ V   D +L+P +      T++DL YL +SPN+C HNP +GSLGTQGR C  + +LE   E   GSC  LCC RG   + F   E+C CKF WCC V+C  C    +E+ C+
Sbjct:   48 QNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNLTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 389          
BLAST of wntP-3 vs. Planmine SMEST
Match: SMESG000051375.1 (SMESG000051375.1)

HSP 1 Score: 346.28 bits (887), Expect = 6.201e-117
Identity = 166/342 (48.54%), Postives = 222/342 (64.91%), Query Frame = 3
Query:  111 ESTKFDLNNT---NIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPE-DNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEH--EFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 1118
            ++ +  +NN+    + C      QR +C +H  L+ SV++G  +G+ ECQ QF +  WNC GHNL+I         +K  KTYLD L++K  PE+A++ S+ SA VAHQV+KACS G +  CGCDRTIY+TPE + F+W+GCS N+HFGAAF+++FLD P K ++ + P   L  LHN+H G + VI  M  KCKCHGVSGSCE KTC RALPD R VGD+LK +F KA+ V   D +L+P +      T++DL YL +SPN+C HNP +GSLGTQGR C  + +LE   E   GSC  LCC RG   + F   E+C CKF WCC V+C  C    +E+ C+
Sbjct:   60 QNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNLTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 401          
BLAST of wntP-3 vs. Planmine SMEST
Match: SMESG000066476.1 (SMESG000066476.1)

HSP 1 Score: 344.354 bits (882), Expect = 2.965e-116
Identity = 168/372 (45.16%), Postives = 240/372 (64.52%), Query Frame = 3
Query:   72 SGRGMFFTLMKL----------QESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHN---------LSIPDRFVSQSKKKHRK---TYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDN-FQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 1118
            SGRG+ +T++++          Q +   +  +T+  C +++K Q+ +C  H  L+PSV+ G  +GI ECQ QF N  WNC GHN         L + + ++ +  K+ RK   TY+D LI K  PESAF+LS+ SA V++QV+KACS G +  CGCDRT+Y+ P+D+ F W+GCS N+HFGAAFS+RFLD+  K ++K+  S  L N+HN+H G + VI+ M++KCKCHGVSGSCE +TC R LP  R VGD LKE+F K I V   D KL+P +  +    E D+ YL  SP+ C+H+   G+LGT GR+CN+T    ++  E SC  LCC+RG+  K ++  E+C CKF WCC V C+TC+   +++ CN
Sbjct:   31 SGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVVSGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 402          
The following BLAST results are available for this feature:
BLAST of wntP-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNT42.569e-8240.76Wnt family member 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WNT7B8.968e-7640.00Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT7B1.953e-7539.88Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT7B2.176e-7540.00Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT34.713e-7137.22Wnt family member 3 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of wntP-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cwn-12.092e-6334.55pep chromosome:WBcel235:II:130983:133598:-1 gene:W... [more]
cwn-27.141e-6036.58pep chromosome:WBcel235:IV:10067824:10070251:1 gen... [more]
egl-207.105e-5733.02Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05][more]
mom-23.134e-5129.71pep chromosome:WBcel235:V:8355988:8358185:1 gene:W... [more]
mom-23.134e-5129.71pep chromosome:WBcel235:V:8355953:8358185:1 gene:W... [more]
back to top
BLAST of wntP-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt22.525e-5034.12gene:FBgn0004360 transcript:FBtr0339383[more]
Wnt27.150e-5034.12gene:FBgn0004360 transcript:FBtr0088512[more]
wg8.670e-4132.82gene:FBgn0284084 transcript:FBtr0079432[more]
Wnt63.072e-4038.12gene:FBgn0031902 transcript:FBtr0334800[more]
Wnt63.072e-4038.12gene:FBgn0031902 transcript:FBtr0303251[more]
back to top
BLAST of wntP-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt43.290e-8241.27wingless-type MMTV integration site family, member... [more]
wnt7ba2.161e-7639.58wingless-type MMTV integration site family, member... [more]
wnt7ba4.189e-7639.58wingless-type MMTV integration site family, member... [more]
wnt7bb9.834e-7639.39wingless-type MMTV integration site family, member... [more]
wnt7bb1.837e-7539.39wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wntP-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt42.450e-8440.06Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
wnt49.319e-8442.68Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
wnt33.863e-7237.22Wnt family member 3 [Source:NCBI gene;Acc:10012519... [more]
ENSXETT00000025270.14.442e-7237.22proto-oncogene Wnt-3-like [Source:NCBI gene;Acc:10... [more]
ENSXETT00000037217.11.039e-7138.37proto-oncogene Wnt-3 [Source:NCBI gene;Acc:1017310... [more]
back to top
BLAST of wntP-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt45.782e-8240.47wingless-type MMTV integration site family, member... [more]
Wnt7b2.421e-7640.18wingless-type MMTV integration site family, member... [more]
Wnt7b3.806e-7640.18wingless-type MMTV integration site family, member... [more]
Wnt7b3.252e-7141.22wingless-type MMTV integration site family, member... [more]
Wnt7b3.252e-7141.22wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wntP-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P49337|WNT4_CHICK1.728e-8242.36Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=... [more]
sp|P49338|WNT4_XENLA8.453e-8242.17Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE... [more]
sp|P56705|WNT4_HUMAN1.234e-8140.76Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1... [more]
sp|P47793|WNT4A_DANRE2.483e-8141.27Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=... [more]
sp|P22724|WNT4_MOUSE4.045e-8140.47Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=... [more]
back to top
BLAST of wntP-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B0LMF80.000e+0100.00Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=... [more]
T1DBK01.497e-14653.41Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
T1E0Z82.173e-11551.06Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
C3U5B14.815e-11448.83Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=... [more]
Q589S71.574e-11347.21Protein Wnt OS=Dugesia japonica OX=6161 GN=Djwnt-A... [more]
back to top
BLAST of wntP-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt44.985e-8040.00wingless-type MMTV integration site family, member... [more]
wnt46.401e-8041.69wingless-type MMTV integration site family, member... [more]
wnt41.628e-7941.64wingless-type MMTV integration site family, member... [more]
wnt43.271e-7941.64wingless-type MMTV integration site family, member... [more]
wnt45.829e-7741.10wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wntP-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt34.274e-6636.56wingless-type MMTV integration site family, member... [more]
ENSPMAT00000010914.14.052e-6034.15pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 g... [more]
wnt18.599e-4834.81wingless-type MMTV integration site family, member... [more]
ENSPMAT00000001922.15.092e-4330.61pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 ge... [more]
wnt10a1.521e-3932.32wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wntP-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of wntP-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310001.036e-7841.93Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54][more]
EDO494313.612e-7538.02Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9][more]
WNT21.628e-7338.13Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5][more]
EDO379012.694e-6836.34Protein Wnt [Source:UniProtKB/TrEMBL;Acc:Q5IRC2][more]
WNT35.659e-6734.77Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RXF5][more]
back to top
BLAST of wntP-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt41.762e-8141.59Wnt family member 4 [Source:NCBI gene;Acc:10030159... [more]
wnt42.845e-8141.59Wnt family member 4 [Source:NCBI gene;Acc:10030159... [more]
wnt7bb1.409e-7740.36protein Wnt-7b [Source:NCBI gene;Acc:101155025][more]
wnt7bb1.904e-7740.36protein Wnt-7b [Source:NCBI gene;Acc:101155025][more]
wnt4b1.261e-7239.01wingless-type MMTV integration site family member ... [more]
back to top
BLAST of wntP-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067888.10.000e+0100.00SMESG000067888.1[more]
SMESG000067888.10.000e+0100.00SMESG000067888.1[more]
SMESG000051375.15.106e-11748.54SMESG000051375.1[more]
SMESG000051375.16.201e-11748.54SMESG000051375.1[more]
SMESG000066476.12.965e-11645.16SMESG000066476.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30001470
GenBankABY85209.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001470 ID=SMED30001470|Name=wntP-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1173bp
GCATGTTTTTGAAAATTCTCGTCACCGTTCTGCTGGTTATTGATATCATA
TCAATAAAAGTGTACGTGAATTCCGGCCGAGGGATGTTCTTCACTCTGAT
GAAACTGCAAGAGTCAACAAAATTTGACTTGAATAATACGAATATTTTTT
GTAACCAACTCATGAAGCTTCAAAGATCAATCTGTCTGAGACATGTCGGA
CTGATTCCTAGTGTCATTCATGGGGTGGATATTGGAATACAGGAATGTCA
ACATCAATTTTTTAACAGTTATTGGAATTGCGCTGGTCACAATCTCTCAA
TACCTGATCGGTTTGTGTCACAATCGAAAAAGAAACATAGGAAAACCTAT
TTGGACAATTTGATTAACAAAGGTTTACCGGAGTCGGCTTTCCTTCTCTC
AATGACATCAGCCGCTGTCGCTCATCAAGTCTCAAAGGCTTGCAGTTCGG
GACAAAACAAATATTGCGGATGCGACCGAACTATCTATGAAACACCAGAA
GACAATTTCCAATGGGCCGGCTGTTCGGATAATGTGCATTTCGGAGCAGC
ATTTTCAAAGCGGTTTCTAGATAGTCCTCACAAAAGAAAAATCAAGCGAA
ATCCGTCTGTTGGGCTTGTCAATCTTCACAATAGCCACGCTGGTACGAAA
ATCGTTATTGATAATATGATGATGAAATGCAAATGTCACGGGGTAAGTGG
GTCATGCGAAACGAAAACTTGCTATAGAGCTTTGCCTGATTTACGGAAGG
TTGGTGACATTTTGAAAGAGAAATTTTCAAAGGCGATATTAGTACGAATG
AATGATTTCAAATTAGTCCCAATGCATTCCGGAGAGAGTCGTATAACTGA
ACATGATCTAACGTACTTAAAAAGATCACCAAATTTTTGCTACCATAATC
CTTCCTATGGTAGTCTAGGTACTCAAGGAAGATTGTGCAACAATACTCAA
GTCCTTGAACATGAATTTGTTGAAGGAAGCTGTGCACATCTTTGTTGTAA
AAGAGGTTTTAGTACAAAACAGTTTTTAGTTAAAGAAAAATGCCAATGCA
AATTTGTATGGTGCTGCACTGTTCAATGTCAAACGTGTGAAATTTTGAAA
GTAGAATCGAGGTGCAATTAGGCCAAAGATGCGGCATTCTTGTAATTTAT
AATAAATTTTAATGTACGGTTTC
back to top

protein sequence of SMED30001470-orf-1

>SMED30001470-orf-1 ID=SMED30001470-orf-1|Name=SMED30001470-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=373bp
MFLKILVTVLLVIDIISIKVYVNSGRGMFFTLMKLQESTKFDLNNTNIFC
NQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSI
PDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSG
QNKYCGCDRTIYETPEDNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRN
PSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKV
GDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNP
SYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCK
FVWCCTVQCQTCEILKVESRCN*
back to top
Aliases
The feature 'wntP-3' has the following synonyms
Synonym
WntP-3
Wnt11-4
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000062esophagus
PLANA:0000072mouth
PLANA:0000142posterior region of the whole animal
PLANA:0000421tail
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR043158Wnt_C
IPR005817Wnt
IPR018161Wnt_CS
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005817WntPRINTSPR01349WNTPROTEINcoord: 169..181
score: 55.17
coord: 285..296
score: 54.99
coord: 227..241
score: 76.67
coord: 126..140
score: 40.16
coord: 145..158
score: 48.71
IPR005817WntSMARTSM00097wnt1_3coord: 49..372
e-value: 6.7E-94
score: 327.9
IPR005817WntPFAMPF00110wntcoord: 51..372
e-value: 9.5E-98
score: 327.6
IPR005817WntPANTHERPTHR12027WNT RELATEDcoord: 51..371
IPR043158Wnt, C-terminal domainGENE3DG3DSA:3.30.2460.20coord: 307..372
e-value: 7.0E-12
score: 47.3
IPR018161Wnt protein, conserved sitePROSITEPS00246WNT1coord: 226..235