SMED30001467

Overview
NameSMED30001467
Smed IDSMED30001467
Uniprot Best hitAlpha-scruin OS=Limulus polyphemus OX=6850 PE=2 SV=1 (E=2.34874e-07)
Length (bp)1310
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001467 (SMED30001467) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001467 (SMED30001467) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001467

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30001467SMESG000050635.1 dd_Smed_v4_14507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30001467SMESG000050635.1 dd_Smed_v6_14507_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
oocyteSMED30001467SMESG000050635.1 Contig31829newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30001467SMESG000050635.1 Contig31829uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30001467SMESG000050635.1 Contig31829newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30001467SMESG000050635.1 Contig31829uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30001467SMESG000050635.1 dd_Smed_v4_14507_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30001467SMESG000050635.1 dd_Smed_v4_14507_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30001467SMESG000050635.1 dd_Smed_v4_14507_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30001467 vs. Ensembl Human
Match: KLHL42 (kelch like family member 42 [Source:HGNC Symbol;Acc:HGNC:29252])

HSP 1 Score: 51.6026 bits (122), Expect = 3.513e-7
Identity = 27/104 (25.96%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  256 YIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            Y++I+GGY  +  + + +   Y+    EW     M  +R+ +     + K++  GG     V     ECY P  D       LP+P + ++    K K+++IGG
Sbjct:   76 YLFIVGGY-RITSQEISAAHSYNPSTNEWLQVASMNQKRSNFKLVAVNSKLYAIGGQAVSNV-----ECYNPEQDAWNFVAPLPNPLAEFSACECKGKIYVIGG 173          
BLAST of SMED30001467 vs. Ensembl Human
Match: KLHL33 (kelch like family member 33 [Source:HGNC Symbol;Acc:HGNC:31952])

HSP 1 Score: 54.299 bits (129), Expect = 3.908e-7
Identity = 41/184 (22.28%), Postives = 77/184 (41.85%), Query Frame = 1
Query:  259 IYIIGGYD-NVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKS 807
            +Y+ GG D       L S +R++  + +W     +   R+ ++    D K++  GG  +   + D VE Y P +++   + +LP+PC  +A A       I+ G + +  G   +  +     H++   +     P  F   + +  A         GH  V++    RLY+ GG  +  D  S
Sbjct:  538 LYVCGGQDFYSHSNTLASTLRWEPSQEDWEEMAPLSQARSLFSLVALDGKLYALGGRHNDVAL-DSVETYNPELNVWRPAPALPAPCFAHAAA-------ILEGQLYVSGGCGGTGQYLASLMHYDPKLEK----PGTFLSPMGVPRA---------GH--VMAALGGRLYVAGGLGETEDLLS 698          
BLAST of SMED30001467 vs. Ensembl Human
Match: KLHL33 (kelch like family member 33 [Source:HGNC Symbol;Acc:HGNC:31952])

HSP 1 Score: 53.9138 bits (128), Expect = 4.259e-7
Identity = 40/184 (21.74%), Postives = 78/184 (42.39%), Query Frame = 1
Query:  259 IYIIGGYD-NVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKS 807
            +Y+ GG D       L S +R++  + +W     +   R+ ++    D K++  GG  +   + D VE Y P +++   + +LP+PC  +A A  + ++++ G       G   +  +     H++   +     P  F   + +  A         GH  V++    RLY+ GG  +  D  S
Sbjct:  274 LYVCGGQDFYSHSNTLASTLRWEPSQEDWEEMAPLSQARSLFSLVALDGKLYALGGRHNDVAL-DSVETYNPELNVWRPAPALPAPCFAHAAAILEGQLYVSG-------GCGGTGQYLASLMHYDPKLEK----PGTFLSPMGVPRA---------GH--VMAALGGRLYVAGGLGETEDLLS 434          
BLAST of SMED30001467 vs. Ensembl Human
Match: KLHL17 (kelch like family member 17 [Source:HGNC Symbol;Acc:HGNC:24023])

HSP 1 Score: 53.9138 bits (128), Expect = 4.285e-7
Identity = 34/106 (32.08%), Postives = 48/106 (45.28%), Query Frame = 1
Query:  253 GYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            G +Y  GGYD      L S  RYD + G W     M TRR        D  ++  GGY S + +   VE YEP +++     S+ S  S    A  +  +++ GGN
Sbjct:  436 GLLYSAGGYDGA--SCLNSAERYDPLTGTWTSVAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLAT-VEKYEPQVNVWSPVASMLSRRSSAGVAVLEGALYVAGGN 538          
BLAST of SMED30001467 vs. Ensembl Human
Match: KLHL6 (kelch like family member 6 [Source:HGNC Symbol;Acc:HGNC:18653])

HSP 1 Score: 52.7582 bits (125), Expect = 9.419e-7
Identity = 33/195 (16.92%), Postives = 76/195 (38.97%), Query Frame = 1
Query:  229 RRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKSSI 813
            R K+ V  G +Y+IGG+D +++  + ++  YD     W     ++   + +       K++  GG  +  + TD  +CY+P  +      ++P           +++++++GG ++     +     +         + S  + P                              NNRLY+ GG ++ N+  +++
Sbjct:  413 RHKMVVLGGKVYVIGGFDGLQR--INNVETYDPFHNCWSEAAPLLVHVSSFAATSHKKKLYVIGGGPNGKLATDKTQCYDPSTNKWSLKAAMPVEAKCINAVSFRDRIYVVGGAMRALYAYSPLEDSWCLVTQLSHERASCGIAP-----------------------------CNNRLYITGGRDEKNEVIATV 576          
BLAST of SMED30001467 vs. Ensembl Celegans
Match: ivns-1 (Influenza Virus NS1a (A) binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q21854])

HSP 1 Score: 53.5286 bits (127), Expect = 2.257e-7
Identity = 34/109 (31.19%), Postives = 52/109 (47.71%), Query Frame = 1
Query:  250 SGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVEC--YEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            +G I++ GGYD  R + LRS+  YD++ G+W +  KM   R  +   +   K+F   G        DL  C  Y+P  D+     +L +      CA   N V+ IGG+
Sbjct:  514 NGKIFVCGGYD--RGECLRSVEEYDVVNGKWRNVAKMKAERGRFDCTIHGGKVFAVAGSNGN---NDLKSCEIYDPKADVWAPLPNLATARCHNGCATIDNYVYCIGGS 617          
BLAST of SMED30001467 vs. Ensembl Celegans
Match: ivns-1 (Influenza Virus NS1a (A) binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q21854])

HSP 1 Score: 53.5286 bits (127), Expect = 2.257e-7
Identity = 34/109 (31.19%), Postives = 52/109 (47.71%), Query Frame = 1
Query:  250 SGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVEC--YEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            +G I++ GGYD  R + LRS+  YD++ G+W +  KM   R  +   +   K+F   G        DL  C  Y+P  D+     +L +      CA   N V+ IGG+
Sbjct:  514 NGKIFVCGGYD--RGECLRSVEEYDVVNGKWRNVAKMKAERGRFDCTIHGGKVFAVAGSNGN---NDLKSCEIYDPKADVWAPLPNLATARCHNGCATIDNYVYCIGGS 617          
BLAST of SMED30001467 vs. Ensembl Celegans
Match: ivns-1 (Influenza Virus NS1a (A) binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q21854])

HSP 1 Score: 53.5286 bits (127), Expect = 2.257e-7
Identity = 34/109 (31.19%), Postives = 52/109 (47.71%), Query Frame = 1
Query:  250 SGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVEC--YEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            +G I++ GGYD  R + LRS+  YD++ G+W +  KM   R  +   +   K+F   G        DL  C  Y+P  D+     +L +      CA   N V+ IGG+
Sbjct:  514 NGKIFVCGGYD--RGECLRSVEEYDVVNGKWRNVAKMKAERGRFDCTIHGGKVFAVAGSNGN---NDLKSCEIYDPKADVWAPLPNLATARCHNGCATIDNYVYCIGGS 617          
BLAST of SMED30001467 vs. Ensembl Fly
Match: KLHL18 (gene:FBgn0037978 transcript:FBtr0082557)

HSP 1 Score: 55.0694 bits (131), Expect = 7.111e-8
Identity = 35/133 (26.32%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  169 TWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            TWK++  +  +       ++   +   +GY+Y +GG+D +      S+ RYD     W     M+ RR        + KI+  GGY   + +   VECY+P  D  +    +    S  A A +  K++ IGG
Sbjct:  375 TWKTVAQMMKY-------RSAGGVTQLNGYVYALGGHDGL--SIFDSVERYDQAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNSFLRS-VECYDPQTDTWKLVTPMNCKRSRVALAANMGKLWAIGG 497          
BLAST of SMED30001467 vs. Ensembl Fly
Match: KLHL18 (gene:FBgn0037978 transcript:FBtr0082556)

HSP 1 Score: 55.0694 bits (131), Expect = 8.418e-8
Identity = 35/133 (26.32%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  169 TWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            TWK++  +  +       ++   +   +GY+Y +GG+D +      S+ RYD     W     M+ RR        + KI+  GGY   + +   VECY+P  D  +    +    S  A A +  K++ IGG
Sbjct:  412 TWKTVAQMMKY-------RSAGGVTQLNGYVYALGGHDGL--SIFDSVERYDQAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNSFLRS-VECYDPQTDTWKLVTPMNCKRSRVALAANMGKLWAIGG 534          
BLAST of SMED30001467 vs. Ensembl Fly
Match: KLHL18 (gene:FBgn0037978 transcript:FBtr0335434)

HSP 1 Score: 55.0694 bits (131), Expect = 8.418e-8
Identity = 35/133 (26.32%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  169 TWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            TWK++  +  +       ++   +   +GY+Y +GG+D +      S+ RYD     W     M+ RR        + KI+  GGY   + +   VECY+P  D  +    +    S  A A +  K++ IGG
Sbjct:  412 TWKTVAQMMKY-------RSAGGVTQLNGYVYALGGHDGL--SIFDSVERYDQAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNSFLRS-VECYDPQTDTWKLVTPMNCKRSRVALAANMGKLWAIGG 534          
BLAST of SMED30001467 vs. Ensembl Fly
Match: klhl10 (gene:FBgn0040038 transcript:FBtr0113686)

HSP 1 Score: 50.8322 bits (120), Expect = 2.199e-6
Identity = 28/106 (26.42%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  250 SGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            +G IY IGGYD   +  L ++ RY+    +W     M  +R+  +     ++I+  GG+  +  + D  E Y+P+ ++     ++    SG +C   +N++++IGG
Sbjct:  441 NGMIYAIGGYDGHNR--LNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGGFNGQECL-DSAEYYDPVTNVWTRIPNMNHRRSGVSCVAFRNQLYVIGG 543          
BLAST of SMED30001467 vs. Ensembl Fly
Match: klhl10 (gene:FBgn0040038 transcript:FBtr0113685)

HSP 1 Score: 50.8322 bits (120), Expect = 2.199e-6
Identity = 28/106 (26.42%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  250 SGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            +G IY IGGYD   +  L ++ RY+    +W     M  +R+  +     ++I+  GG+  +  + D  E Y+P+ ++     ++    SG +C   +N++++IGG
Sbjct:  441 NGMIYAIGGYDGHNR--LNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGGFNGQECL-DSAEYYDPVTNVWTRIPNMNHRRSGVSCVAFRNQLYVIGG 543          
BLAST of SMED30001467 vs. Ensembl Zebrafish
Match: klhl26 (kelch-like family member 26 [Source:NCBI gene;Acc:558035])

HSP 1 Score: 51.9878 bits (123), Expect = 1.053e-6
Identity = 59/277 (21.30%), Postives = 112/277 (40.43%), Query Frame = 1
Query:  238 LKVESGYIYIIGGYDNVRKKFLRSI---IRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEV-DEEGDKAPNSDHLKDA 1056
            + V   ++Y++GG     +    ++    RYD    +W   + M   R  +   + D +++  GG      ++  VECY P  +   N +SL     G+A A   +K++I GG      G++         E  +     DS + +  +        K P+    + H ++    NNR+Y +GG   + D    +  + Y      I   D       W   +     +S  G  L++ K++I+GG     N+  +I++V + E D+     H  ++
Sbjct:  346 VSVLDNFVYVVGGQHLQYRSGEGAVDICFRYDPHLNQWLRIQPMQESRIQFQLNVLDGQLYATGGRNRSGSLSS-VECYCPKKNEWTNVDSLKRRIWGHAGATCGDKLYISGG-----YGVSV--------EDKKTLHCYDSALDQWDF--------KCPMNEPRVLHAMI--SANNRIYALGGRMDHVDRCFDVLAVEY-----YIPETDQ------WTTVSPMRAGQSEAGCCLLDKKIYIVGGYNWHLNNVTSIVQVYNTETDEWERDLHFPES 587          
BLAST of SMED30001467 vs. Ensembl Zebrafish
Match: klhl26 (kelch-like family member 26 [Source:NCBI gene;Acc:558035])

HSP 1 Score: 51.9878 bits (123), Expect = 1.053e-6
Identity = 59/277 (21.30%), Postives = 112/277 (40.43%), Query Frame = 1
Query:  238 LKVESGYIYIIGGYDNVRKKFLRSI---IRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEV-DEEGDKAPNSDHLKDA 1056
            + V   ++Y++GG     +    ++    RYD    +W   + M   R  +   + D +++  GG      ++  VECY P  +   N +SL     G+A A   +K++I GG      G++         E  +     DS + +  +        K P+    + H ++    NNR+Y +GG   + D    +  + Y      I   D       W   +     +S  G  L++ K++I+GG     N+  +I++V + E D+     H  ++
Sbjct:  346 VSVLDNFVYVVGGQHLQYRSGEGAVDICFRYDPHLNQWLRIQPMQESRIQFQLNVLDGQLYATGGRNRSGSLSS-VECYCPKKNEWTNVDSLKRRIWGHAGATCGDKLYISGG-----YGVSV--------EDKKTLHCYDSALDQWDF--------KCPMNEPRVLHAMI--SANNRIYALGGRMDHVDRCFDVLAVEY-----YIPETDQ------WTTVSPMRAGQSEAGCCLLDKKIYIVGGYNWHLNNVTSIVQVYNTETDEWERDLHFPES 587          
BLAST of SMED30001467 vs. Ensembl Zebrafish
Match: klhl31 (kelch-like family member 31 [Source:NCBI gene;Acc:407079])

HSP 1 Score: 51.6026 bits (122), Expect = 1.384e-6
Identity = 46/184 (25.00%), Postives = 73/184 (39.67%), Query Frame = 1
Query:   46 GLMQSILLVSNSPNTTHKA--GFIVFHPERNNLISKFCPLTTFTWKSLTHISDFGLIYVPPKT-RRKLKVESGYIYIIGGYD-----NVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNI 573
            G ++ +L V   P  T K+    I++  E N             W  LT +        P K+  + + V  G++Y+ GG D     N  K  + +  RYD     W H   MI +R  ++   F+  +F  GG  S       VECY P  +  +    +  P   +A +    K+ + GG I
Sbjct:  314 GGLRVLLTVGGRPALTEKSLSKDILYRDEDN------------VWNKLTEM--------PAKSFNQCVAVLDGFLYVAGGEDQNDARNQAKHAVSNFSRYDPRFNTWIHLANMIQKRTHFSLNTFNGLLFAVGGRNSDGCQAS-VECYVPSSNQWQMKAPMEVPRCCHASSVIDGKILVSGGYI 476          
BLAST of SMED30001467 vs. Ensembl Zebrafish
Match: klhl31 (kelch-like family member 31 [Source:NCBI gene;Acc:407079])

HSP 1 Score: 51.6026 bits (122), Expect = 1.384e-6
Identity = 46/184 (25.00%), Postives = 73/184 (39.67%), Query Frame = 1
Query:   46 GLMQSILLVSNSPNTTHKA--GFIVFHPERNNLISKFCPLTTFTWKSLTHISDFGLIYVPPKT-RRKLKVESGYIYIIGGYD-----NVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNI 573
            G ++ +L V   P  T K+    I++  E N             W  LT +        P K+  + + V  G++Y+ GG D     N  K  + +  RYD     W H   MI +R  ++   F+  +F  GG  S       VECY P  +  +    +  P   +A +    K+ + GG I
Sbjct:  314 GGLRVLLTVGGRPALTEKSLSKDILYRDEDN------------VWNKLTEM--------PAKSFNQCVAVLDGFLYVAGGEDQNDARNQAKHAVSNFSRYDPRFNTWIHLANMIQKRTHFSLNTFNGLLFAVGGRNSDGCQAS-VECYVPSSNQWQMKAPMEVPRCCHASSVIDGKILVSGGYI 476          
BLAST of SMED30001467 vs. Ensembl Zebrafish
Match: si:ch211-63p21.8 (si:ch211-63p21.8 [Source:ZFIN;Acc:ZDB-GENE-130530-652])

HSP 1 Score: 51.2174 bits (121), Expect = 1.864e-6
Identity = 40/162 (24.69%), Postives = 71/162 (43.83%), Query Frame = 1
Query:  130 NNLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGG-YDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG-NIQLRNGITTSSSH 609
            N+L S    +    W+ L  + D        + R  + V +G +YI GG Y   +   ++S+ RYD +R +W     ++  R+ +T  +  + ++  GG        D VE Y P  +    +  L    SG+A      ++FI GG N +    ++ S+ H
Sbjct:  488 NSLRSGTGLVKQMEWRLLGEMPD------QARFRHGVGVLNGQLYIAGGCYFYSKADIMKSVYRYDPVREQWEKLSDLLELRSNFTLVVNGENLYAVGGDKEINTNLDSVEKYSPETNSWSFTHPLDQALSGHAATVCGGEIFISGGFNCKYECLVSMSAYH 643          
BLAST of SMED30001467 vs. Ensembl Xenopus
Match: KLHL17 (kelch like family member 17 [Source:NCBI gene;Acc:100491332])

HSP 1 Score: 51.9878 bits (123), Expect = 1.397e-6
Identity = 37/118 (31.36%), Postives = 52/118 (44.07%), Query Frame = 1
Query:  226 TRRK---LKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            TRR    + V  G +Y  GGYD      L S  RYD + G W     M TRR        D  ++  GGY S + +   VE YEP ++      ++ S  S    A  +  +++ GGN
Sbjct:  409 TRRSCLGVAVLHGLLYAAGGYDGA--SCLNSAERYDPLTGTWTSIAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLAT-VEKYEPQINTWTPIANMLSRRSSAGVAVLEGMLYVAGGN 523          
BLAST of SMED30001467 vs. Ensembl Xenopus
Match: KLHL17 (kelch like family member 17 [Source:NCBI gene;Acc:100491332])

HSP 1 Score: 51.9878 bits (123), Expect = 1.472e-6
Identity = 37/118 (31.36%), Postives = 52/118 (44.07%), Query Frame = 1
Query:  226 TRRK---LKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            TRR    + V  G +Y  GGYD      L S  RYD + G W     M TRR        D  ++  GGY S + +   VE YEP ++      ++ S  S    A  +  +++ GGN
Sbjct:  409 TRRSCLGVAVLHGLLYAAGGYDGA--SCLNSAERYDPLTGTWTSIAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLAT-VEKYEPQINTWTPIANMLSRRSSAGVAVLEGMLYVAGGN 523          
BLAST of SMED30001467 vs. Ensembl Xenopus
Match: KLHL17 (kelch like family member 17 [Source:NCBI gene;Acc:100491332])

HSP 1 Score: 51.9878 bits (123), Expect = 1.531e-6
Identity = 37/118 (31.36%), Postives = 52/118 (44.07%), Query Frame = 1
Query:  226 TRRK---LKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            TRR    + V  G +Y  GGYD      L S  RYD + G W     M TRR        D  ++  GGY S + +   VE YEP ++      ++ S  S    A  +  +++ GGN
Sbjct:  391 TRRSCLGVAVLHGLLYAAGGYDGA--SCLNSAERYDPLTGTWTSIAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLAT-VEKYEPQINTWTPIANMLSRRSSAGVAVLEGMLYVAGGN 505          
BLAST of SMED30001467 vs. Ensembl Xenopus
Match: slc25a10 (solute carrier family 25 member 10 [Source:Xenbase;Acc:XB-GENE-955175])

HSP 1 Score: 51.2174 bits (121), Expect = 2.560e-6
Identity = 38/140 (27.14%), Postives = 60/140 (42.86%), Query Frame = 1
Query:  172 WKSLTHISDFGLIYVPPKT-RRKLKVESGYIYIIGGYD-----NVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNI 573
            WK L  +        P K+  + + V  G++YI GG D     N  K  + +  RYD     W H   MI +R  ++  +F+  IF  GG  S   +   VECY P  +  +    L      ++ +    K+ ++GG I
Sbjct:  345 WKRLAEL--------PAKSFNQCVTVMDGFLYIAGGEDQNDARNQAKHAVSNFCRYDPRFNTWIHLANMIQKRTHFSFNVFNGLIFAIGGRNSDGGLAS-VECYVPSTNQWQMKAPLEVARCCHSSSIIDGKILVVGGYI 475          

HSP 2 Score: 50.447 bits (119), Expect = 4.961e-6
Identity = 53/225 (23.56%), Postives = 96/225 (42.67%), Query Frame = 1
Query:  124 ERNNLISKFCPLTTF--TWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYD-KNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNK 789
            +  + +S FC       TW  L ++       +  +T     V +G I+ IGG ++     L S+  Y     +W     +   R C++  + D KI   GGY +    +  V  Y+P MD  ++  +L +P  G+ C+    ++V+++GG+ QL                  R ++ D L  E +       +   P++NG+       S  N ++YL+GG N+
Sbjct:  381 QAKHAVSNFCRYDPRFNTWIHLANM-------IQKRTHFSFNVFNGLIFAIGGRNS--DGGLASVECYVPSTNQWQMKAPLEVARCCHSSSIIDGKILVVGGYINN-AYSRSVCMYDPSMDSWQDKANLSTP-RGWHCSVTLGDRVYVMGGS-QLGG----------------RGERVDVLPVECYNPHTGQWSYVAPLQNGV--STAGASTLNGKIYLVGGWNE 575          
BLAST of SMED30001467 vs. Ensembl Xenopus
Match: zbtb48 (zinc finger and BTB domain containing 48 [Source:Xenbase;Acc:XB-GENE-984069])

HSP 1 Score: 50.8322 bits (120), Expect = 3.273e-6
Identity = 29/93 (31.18%), Postives = 47/93 (50.54%), Query Frame = 1
Query:  256 YIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACA 534
            Y+Y +GGYD   +  L S+ RY++ R  W     M  RR+ +   +   KI+  GG+ +   ++  VECY P  +       +P+ CSG + A
Sbjct:  406 YLYAVGGYDGTNQ--LDSVERYNIERNYWEAMAPMKHRRSAHGLTVHQGKIYALGGFNAGGFLSS-VECYCPDRNEWTEVTVMPTGCSGMSVA 495          
BLAST of SMED30001467 vs. Ensembl Mouse
Match: Plekhn1 (pleckstrin homology domain containing, family N member 1 [Source:MGI Symbol;Acc:MGI:2387630])

HSP 1 Score: 52.7582 bits (125), Expect = 5.850e-7
Identity = 34/106 (32.08%), Postives = 47/106 (44.34%), Query Frame = 1
Query:  253 GYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            G +Y  GGYD      L S  RYD + G W     M TRR        D  ++  GGY S + +   VE YEP ++      S+ S  S    A  +  +++ GGN
Sbjct:  434 GLLYAAGGYDGA--SCLNSAERYDPLTGTWTSIAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLAT-VEKYEPQVNSWTPVASMLSRRSSAGVAVLEGALYVAGGN 536          
BLAST of SMED30001467 vs. Ensembl Mouse
Match: Klhl42 (kelch-like 42 [Source:MGI Symbol;Acc:MGI:2444786])

HSP 1 Score: 51.9878 bits (123), Expect = 1.057e-6
Identity = 27/104 (25.96%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  256 YIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            Y++I+GGY  +  + + +   Y+ +  EW     M  +R+ +     + K++  GG     V     ECY P  D       LP+P + ++    K K+++IGG
Sbjct:  242 YLFIVGGY-RITSQEISAAHSYNPITNEWLQVASMNQKRSNFKLVAVNSKLYAIGGQAVSNV-----ECYNPEQDAWNFVAPLPNPLAEFSACECKGKIYVIGG 339          
BLAST of SMED30001467 vs. Ensembl Mouse
Match: Klhl33 (kelch-like 33 [Source:MGI Symbol;Acc:MGI:3644593])

HSP 1 Score: 50.8322 bits (120), Expect = 2.894e-6
Identity = 25/104 (24.04%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  259 IYIIGGYD-NVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            +Y+ GG D       L S +R+   + +W     +   R+ +   +FD +++  GG  +   +   VE Y P +++   + +LP+PC  +A A  ++++++ GG
Sbjct:  534 LYVCGGQDFYSHNSTLASTLRWSSSQEDWEEMAPLCQARSFFPLVVFDGQLYALGGRDNGVALNS-VETYNPELNVWRPAPALPAPCFAHAAAILEDRLYVSGG 636          
BLAST of SMED30001467 vs. Ensembl Mouse
Match: Klhl12 (kelch-like 12 [Source:MGI Symbol;Acc:MGI:2385619])

HSP 1 Score: 50.447 bits (119), Expect = 3.255e-6
Identity = 32/110 (29.09%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  238 LKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            L V SG IY +GGYD +    L S+ +YD   G W +   M T+R+     L +D I+  GG+     ++  VE Y    D      S+ +P         + +++ I G
Sbjct:  421 LVVASGIIYCLGGYDGL--NILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSS-VEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAG 527          
BLAST of SMED30001467 vs. Ensembl Mouse
Match: Klhl12 (kelch-like 12 [Source:MGI Symbol;Acc:MGI:2385619])

HSP 1 Score: 50.447 bits (119), Expect = 3.255e-6
Identity = 32/110 (29.09%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  238 LKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            L V SG IY +GGYD +    L S+ +YD   G W +   M T+R+     L +D I+  GG+     ++  VE Y    D      S+ +P         + +++ I G
Sbjct:  421 LVVASGIIYCLGGYDGL--NILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSS-VEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAG 527          
BLAST of SMED30001467 vs. UniProt
Match: sp|Q25390|SCRA_LIMPO (Alpha-scruin OS=Limulus polyphemus OX=6850 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.349e-7
Identity = 70/309 (22.65%), Postives = 123/309 (39.81%), Query Frame = 1
Query:  112 VFHPERNNLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYD--NVRKKFLRSI---IRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG---NIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIAL--KDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEV 1008
            V+HP+RN             W       +F    + P+T   +      +Y+ GGY+  + RK  +++     +  +   +W     M   RA +   + D++IF  GG  S   +   VE YEP MD      S+P P  G A A ++  +++IGG   N + +     S+  F F     +  +  SL     +   + +N K+                    ++ GG N + +      GL  +SIDSI  L  K G     + +     E+ +  + V+     +FI+GG+ +   S +   E+
Sbjct:  105 VYHPDRNK------------W-------NFYTTMMEPRTYHAVGYFHRRVYVFGGYNPLHCRKGKMQATATTFQLTVQTKQWRKRADMRYARAHHNVTVMDERIFVFGGRDSNGEILAAVEMYEPEMDQWTTLASIPEPMMGSAIANNEGIIYVIGGVTTNKEKKPEGNLSNKIFCFDPLNNKWYRKPSLSSPRAFSAATTQNKKI--------------------WIWGGANLSEE------GL-LSSIDSIDVLDPKKGTLEHHMNF-----ELAKHCHAVAKTGAHVFIVGGMSSVEASAIAETEM 362          
BLAST of SMED30001467 vs. UniProt
Match: sp|Q70JS2|KELC_ANOST (Ring canal kelch homolog OS=Anopheles stephensi OX=30069 GN=kel PE=2 SV=2)

HSP 1 Score: 54.299 bits (129), Expect = 1.758e-6
Identity = 59/238 (24.79%), Postives = 103/238 (43.28%), Query Frame = 1
Query:  259 IYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEM--QRSYNGVSLINNKLFIIGG 966
            + +IGG      K +RS+  YD+   +W+   +M TRR      +  DK++  GG+   ++    V+ Y+P++D    S ++ +  S    A   N ++ +GG     +G T  SS     E F+  +Q   L+  M  +  S+    V + NG+             LY +GG +  +    +    Y  S D+             W +  I EM  +RS  GV +++N L+ +GG
Sbjct:  352 LLVIGGQ---APKAIRSVECYDLREEKWYQVAEMPTRRCRAGLAVLGDKVYAVGGFNG-SLRVKTVDVYDPVLDQWTTSHNMEARRSTLGVAVLNNCIYAVGG----FDGSTGLSSA----EMFDPKRQEWRLIASMSTRRSSV---GVGVVNGL-------------LYAVGGYDGASRQCLASVERYNPSTDT-------------WTQ--IAEMSARRSGAGVGVLDNILYAVGG 546          
BLAST of SMED30001467 vs. UniProt
Match: sp|A6NCF5|KLH33_HUMAN (Kelch-like protein 33 OS=Homo sapiens OX=9606 GN=KLHL33 PE=4 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 2.045e-6
Identity = 40/184 (21.74%), Postives = 78/184 (42.39%), Query Frame = 1
Query:  259 IYIIGGYD-NVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKS 807
            +Y+ GG D       L S +R++  + +W     +   R+ ++    D K++  GG  +   + D VE Y P +++   + +LP+PC  +A A  + ++++ G       G   +  +     H++   +     P  F   + +  A         GH  V++    RLY+ GG  +  D  S
Sbjct:  274 LYVCGGQDFYSHSNTLASTLRWEPSQEDWEEMAPLSQARSLFSLVALDGKLYALGGRHNDVAL-DSVETYNPELNVWRPAPALPAPCFAHAAAILEGQLYVSG-------GCGGTGQYLASLMHYDPKLEK----PGTFLSPMGVPRA---------GH--VMAALGGRLYVAGGLGETEDLLS 434          
BLAST of SMED30001467 vs. UniProt
Match: sp|Q6TDP4|KLH17_HUMAN (Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.058e-6
Identity = 34/106 (32.08%), Postives = 48/106 (45.28%), Query Frame = 1
Query:  253 GYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            G +Y  GGYD      L S  RYD + G W     M TRR        D  ++  GGY S + +   VE YEP +++     S+ S  S    A  +  +++ GGN
Sbjct:  436 GLLYSAGGYDGA--SCLNSAERYDPLTGTWTSVAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLAT-VEKYEPQVNVWSPVASMLSRRSSAGVAVLEGALYVAGGN 538          
BLAST of SMED30001467 vs. UniProt
Match: sp|Q8K430|KLH17_RAT (Kelch-like protein 17 OS=Rattus norvegicus OX=10116 GN=Klhl17 PE=1 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.092e-6
Identity = 34/106 (32.08%), Postives = 47/106 (44.34%), Query Frame = 1
Query:  253 GYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            G +Y  GGYD      L S  RYD + G W     M TRR        D  ++  GGY S + +   VE YEP ++      S+ S  S    A  +  +++ GGN
Sbjct:  434 GLLYAAGGYDGA--SCLNSAERYDPLTGTWTSIAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLAT-VEKYEPQVNSWTPVASMLSRRSSAGVAVLEGALYVAGGN 536          
BLAST of SMED30001467 vs. TrEMBL
Match: gnl|BL_ORD_ID|18212842 (tr|A0A267EXD6|A0A267EXD6_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014943g1 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.838e-60
Identity = 134/448 (29.91%), Postives = 219/448 (48.88%), Query Frame = 1
Query:   43 IGLMQSILLVSNSPNTTHKAGFIVFHPERNNLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYA--CAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFI---SIENAKVPIENGIIGHKIVISEKNNRLYLIGG---TNKNND----TKSSIAGLYYASIDSIIALKD-------GATVESI-------WYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEVDEEGDK---APNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSANDINLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW 1299
            +  M  ++L+    +T   A F+V+HPER  ++ K   ++   W+ L  I  + ++ +             ++Y +GGY   +KK+ R ++RY++  G W++C KM T RA ++ F +D KI+C GG T+   +T+L+E +EP+ +       LP+PC+ +A  C    + V ++GG  +  NG     +H W +   + T       P + Y+++         VP   G+ GH++V     NR+YL+GG   T K++D     KS + GLYY SI+ + AL D         TV+ I       W +RNI +  R+Y  VSLI NKLF++GG Q K     T    +E   +         LK  +E        +  P        D   GY+D RRK +  ++SLS++  ++   +  V V +     +   DR DWL+QW+LW
Sbjct:    2 LSTMADLILLFPRQSTKQCAAFLVYHPERRLVMPK---VSLLDWRRLDGICRYSVVRL-----------RDHLYFLGGYRPAKKKYSRQVLRYELSTGTWYYCNKMKTPRADFSAFAYDGKIYCPGGRTTNGALTELMESFEPITNNWYQENPLPAPCAEFACICLEQLSTVILVGGVARSPNGSFRCFNHIWRFGFLKSTN------PYLDYEYLWQALPSGVGVPTSLGVRGHQLVFDSAFNRVYLVGGSPLTGKDDDPAVSQKSRLPGLYYFSIEDMKALFDELDKAMEQGTVDDISDSLKLCWTRRNIEQCSRAYAAVSLIGNKLFVVGGSQVKPPPPKTPSLTEETTAQELSEAEPPRLKVVEEEAAEHGSASATPQQPEVASGD--AGYYDKRRKSFHSLFSLSNSG-LDTSELISVTVKLEKSNRDLKPDRLDWLLQWSLW 426          
BLAST of SMED30001467 vs. TrEMBL
Match: gnl|BL_ORD_ID|15783126 (tr|A0A1I8IHE1|A0A1I8IHE1_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024318g1 PE=4 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.357e-60
Identity = 133/445 (29.89%), Postives = 220/445 (49.44%), Query Frame = 1
Query:   52 MQSILLVSNSPNTTHKAGFIVFHPERNNLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYA--CAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFI---SIENAKVPIENGIIGHKIVISEKNNRLYLIGG---TNKNND----TKSSIAGLYYASIDSIIALKD-------GATVESI-------WYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEVDEEGDK---APNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSANDINLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW 1299
            M  ++L+    +    A F+V+HPER  ++ K   ++   W+ L  I  + ++ +             ++Y +GGY   +KK+ R ++RY++  G W++C KM T RA ++ F +D KI+C GG T+   +T+L+E +EP+ +       LP+PC+ +A  C    + V ++GG  +  NG     +H W +   + T       P + Y+++         VP   G+ GH++V     NR+YL+GG   T K++D     KS + GLYY SI+ + AL D         TV+ I       W +RNI +  R+Y  VSLI NKLF++GG Q K   + T+   +E   +      +  LK  +E        +  P        D   GY+D RRK +  ++SLS++  ++   +  V V +     +   DR DWL+QW+LW
Sbjct:    1 MADLILLFPRQSMKQCAAFLVYHPERRLVMPK---VSLLDWRRLDGICRYSVVRL-----------RDHLYFLGGYRPAKKKYSRQVLRYELSTGTWYYCNKMKTPRADFSAFAYDGKIYCPGGRTTNGALTELMESFEPITNNWYQENPLPAPCAEFACICLEQLSTVILVGGVARSPNGSFRCFNHIWRFGLLKSTN------PYLDYEYLWQALPSGVGVPTSLGVRGHQLVFDSAFNRVYLVGGSPLTGKDDDPAVSQKSRLPGLYYFSIEDMKALLDELDKAMEQGTVDGISDSLKLCWTRRNIEQCSRAYAAVSLIGNKLFVVGGNQVKPPPSKTLSLTEETTARELSEAEAPGLKVVEEEAAEHGSASATPQQPEVASGD--AGYYDKRRKSFHSLFSLSNSG-LDTSELISVTVKLEKSNRDLKPDRLDWLLQWSLW 422          
BLAST of SMED30001467 vs. TrEMBL
Match: gnl|BL_ORD_ID|18271989 (tr|A0A1I8J8Q1|A0A1I8J8Q1_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 3.205e-60
Identity = 136/450 (30.22%), Postives = 220/450 (48.89%), Query Frame = 1
Query:   52 MQSILLVSNSPNTTHKAGFIVFHPERNNLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYA--CAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFI---SIENAKVPIENGIIGHKIVISEKNNRLYLIGG---TNKNND----TKSSIAGLYYASIDSIIALKD-------GATVESI-------WYKRNIPEMQRSYNGVSLINNKLFIIGGLQNK--------FNSTVTILEVDEEGDKAPNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSANDINLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW 1299
            M  ++L+    +    A F+V+HPER  ++ K   ++   W+ L  I  + ++ +             ++Y +GGY   +KK+ R ++RY++  G W++C KM T RA ++ F +D KI+C GG T+   +T+L+E +EP+ +       LP+PC+ +A  C    + V ++GG  +  NG     +H W +   + T       P + Y+++         VP   G+ GH++V     NR+YL+GG   T K++D     KS + GLYY SI+ + AL D         TV+ I       W +RNI +  R+Y  VSLI NKLF++GG Q K             T  E+ E   +AP    LK  +E        +  P        D   GY+D RRK +  ++SLS++  ++   +  V V +     +   DR DWL+QW+LW
Sbjct:    1 MADLILLFPRQSMKQCAAFLVYHPERRLVMPK---VSLLDWRRLDGICRYSVVRL-----------RDHLYFLGGYRPAKKKYSRQVLRYELSTGTWYYCNKMKTPRADFSAFAYDGKIYCPGGRTTNGALTELMESFEPITNNWYQENPLPAPCAEFACICLEQLSTVILVGGVARSPNGSFRCFNHIWRFGFLKSTN------PYLDYEYLWQALPSGVGVPTSLGVRGHQLVFDSAFNRVYLVGGSPLTGKDDDPAVSQKSRLPGLYYFSIEDMKALLDELDKAMEQGTVDDISDSLKLCWTRRNIEQCSRAYAAVSLIGNKLFVVGGSQVKPPPPKTPSLTEETTAQELSEA--EAP---RLKVVEEEAAEHGSASATPQQPEVASGD--AGYYDKRRKSFHSLFSLSNSG-LDTSELISVTVKLEKSNRDLKPDRLDWLLQWSLW 422          
BLAST of SMED30001467 vs. TrEMBL
Match: gnl|BL_ORD_ID|18231381 (tr|A0A1I8HIT0|A0A1I8HIT0_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 8.514e-59
Identity = 135/450 (30.00%), Postives = 219/450 (48.67%), Query Frame = 1
Query:   52 MQSILLVSNSPNTTHKAGFIVFHPERNNLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYA--CAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFI---SIENAKVPIENGIIGHKIVISEKNNRLYLIGG---TNKNNDTK----SSIAGLYYASIDSIIALKDG-------ATVESI-------WYKRNIPEMQRSYNGVSLINNKLFIIGGLQNK--------FNSTVTILEVDEEGDKAPNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSANDINLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW 1299
            M  ++L+    +    A F+V+HPER  ++ K   ++   W+ L  I  + ++ +             ++Y +GGY   +KK+ R ++RY++  G W++C KM T RA ++ F +D KI+C GG T+   +T+L+E +EP+ +       LP+PC+ +A  C    + V ++GG  +  NG     +H W +   + T       P + Y+++         VP   G+ GH++V     NR+YL+GG   T K++D      S + GLYY SI+ + AL D         TV+ I       W +RNI +  R+Y  VSLI NKLF++GG Q K             T  E+ E   +AP    LK  +E        +  P        D   GY+D RRK +  ++SLS++  ++   +  V V +     +   DR DWL+QW+LW
Sbjct:   18 MADLILLFPRQSMKQCAAFLVYHPERRLVMPK---VSLLDWRRLDGICRYSVVRL-----------RDHLYFLGGYRPAKKKYSRQVLRYELSTGTWYYCNKMKTPRADFSAFAYDGKIYCPGGRTTNGALTELMESFEPITNNWYQENPLPAPCAEFACICLEQLSTVILVGGVARSPNGSFRCFNHIWRFGLLKSTN------PYLDYEYLWQALPSGVGVPTSLGVRGHQLVFDSAFNRVYLVGGSPLTGKDDDPAVSQNSRLPGLYYFSIEDMKALLDELDKAMELGTVDDISDSLKLCWTRRNIEQCSRAYAAVSLIGNKLFVVGGSQVKPPPPKTPSLTEETTAQELSEA--EAPG---LKVVEEEAAEHGSASATPQQPEVASGD--AGYYDKRRKSFHSLFSLSNSG-LDTSELISVTVKLEKSNRDLKPDRLDWLLQWSLW 439          
BLAST of SMED30001467 vs. TrEMBL
Match: gnl|BL_ORD_ID|18207672 (tr|A0A267F3U3|A0A267F3U3_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030840g1 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 8.514e-59
Identity = 134/450 (29.78%), Postives = 219/450 (48.67%), Query Frame = 1
Query:   52 MQSILLVSNSPNTTHKAGFIVFHPERNNLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYA--CAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFI---SIENAKVPIENGIIGHKIVISEKNNRLYLIGG---TNKNNDTK----SSIAGLYYASIDSIIALKDG-------ATVESI-------WYKRNIPEMQRSYNGVSLINNKLFIIGGLQNK--------FNSTVTILEVDEEGDKAPNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSANDINLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW 1299
            M  ++L+    +    A F+V+HPER  ++ K   ++   W+ L  I  + ++ +             ++Y +GGY   +KK+ R ++RY++  G W++C KM T RA ++ F +D KI+C GG T+   +T+L+E +EP+ +       LP+PC+ +A  C    + V ++GG  +  NG     +H W +   + T       P + Y+++         VP   G+ GH++V     NR+YL+GG   T K++D      S + GLYY SI+ + AL D         TV+ +       W +RNI +  R+Y  VSLI NKLF++GG Q K             T  E+ E   +AP    LK  +E        +  P        D   GY+D RRK +  ++SLS++  ++   +  V V +     +   DR DWL+QW+LW
Sbjct:   18 MADLMLLFPRQSMKQCAAFLVYHPERRLVMPK---VSLLDWRRLDGICRYSVVRL-----------RDHLYFLGGYRPAKKKYSRQVLRYELSTGTWYYCNKMKTPRADFSAFAYDGKIYCPGGRTTNGALTELMESFEPITNNWYQENPLPAPCAEFACICLEQLSTVILVGGVARSPNGSFRCFNHIWRFGLLKSTN------PYLDYEYLWQALPSGVGVPTSLGVRGHQLVFDSAFNRVYLVGGSPLTGKDDDPAVSQNSRLPGLYYFSIEDMKALLDELDKAMELGTVDDVSDSLKLCWTRRNIEQCSRAYAAVSLIGNKLFVVGGSQVKPPPPKTPSLTEETTAQELSEA--EAPG---LKVVEEEAAEHGSASATPQQPEVASGD--AGYYDKRRKSFHSLFSLSNSG-LDTSELISVTVKLEKSNRDLKPDRLDWLLQWSLW 439          
BLAST of SMED30001467 vs. Ensembl Cavefish
Match: KLHL10 (kelch-like protein 10 [Source:NCBI gene;Acc:103041454])

HSP 1 Score: 57.3806 bits (137), Expect = 1.755e-8
Identity = 40/145 (27.59%), Postives = 66/145 (45.52%), Query Frame = 1
Query:  133 NLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            N + K  PLT  TW+ + H+         P+    + V  G IY +GG++   ++ + S+ RYD    +W     M   R+  +    + KI+  GGY  +  +    EC++P+ +       + S  SG   A  KN VF +GG
Sbjct:  342 NTVKKLNPLTQ-TWQQVGHMQ-------LPRCFVTVAVLDGLIYAMGGHNG--RERISSVERYDPKTNQWSLISSMQVVRSDASATALNRKIYICGGYNGRECLFT-AECFDPLTNRWSFISRMQSSRSGLGVAALKNLVFAVGG 475          
BLAST of SMED30001467 vs. Ensembl Cavefish
Match: KLHL10 (kelch-like protein 10 [Source:NCBI gene;Acc:103041454])

HSP 1 Score: 56.9954 bits (136), Expect = 2.341e-8
Identity = 40/145 (27.59%), Postives = 66/145 (45.52%), Query Frame = 1
Query:  133 NLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            N + K  PLT  TW+ + H+         P+    + V  G IY +GG++   ++ + S+ RYD    +W     M   R+  +    + KI+  GGY  +  +    EC++P+ +       + S  SG   A  KN VF +GG
Sbjct:  342 NTVKKLNPLTQ-TWQQVGHMQ-------LPRCFVTVAVLDGLIYAMGGHNG--RERISSVERYDPKTNQWSLISSMQVVRSDASATALNRKIYICGGYNGRECLFT-AECFDPLTNRWSFISRMQSSRSGLGVAALKNLVFAVGG 475          
BLAST of SMED30001467 vs. Ensembl Cavefish
Match: ENSAMXT00000018852.2 (kelch-like protein 10 [Source:NCBI gene;Acc:103032605])

HSP 1 Score: 53.9138 bits (128), Expect = 2.089e-7
Identity = 41/145 (28.28%), Postives = 64/145 (44.14%), Query Frame = 1
Query:  133 NLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            N + K  PLT  TW  + H+      YV       + V  G IY +GG+    ++ L S+ RYD    +W     M   R+  +    + KI+  GGY  +  ++   EC++P+ D   +   + S  SG   A     VF +GG
Sbjct:  337 NTVKKLNPLTQ-TWHQVGHMQ-LQRCYV------TVAVLDGLIYAMGGHSG--RERLSSVERYDPKTNQWSLITSMQLVRSDASATALNGKIYICGGYNGRQCLSR-AECFDPLTDNWSSIAPMQSSRSGLGVAAFNELVFAVGG 470          
BLAST of SMED30001467 vs. Ensembl Cavefish
Match: klhl31 (kelch like family member 31 [Source:NCBI gene;Acc:103047547])

HSP 1 Score: 51.6026 bits (122), Expect = 1.225e-6
Identity = 34/129 (26.36%), Postives = 55/129 (42.64%), Query Frame = 1
Query:  205 LIYVPPKT-RRKLKVESGYIYIIGGYD-----NVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNI 573
            L  +P K+  + + V  G++Y+ GG D     N  K  + +  RYD     W H   MI +R  ++   F+  +F  GG  S      + ECY P  +  +    +  P   +A      K+ + GG I
Sbjct:  349 LTEMPAKSFNQCVAVLDGFLYVAGGEDQNDARNQAKHAVSNFCRYDPRFNSWIHLTSMIQKRTHFSLNTFNGLLFAVGGRNSDGCQASM-ECYVPSSNQWQMKAPMEVPRCCHASTVIDGKILVTGGYI 476          
BLAST of SMED30001467 vs. Ensembl Cavefish
Match: klhl31 (kelch like family member 31 [Source:NCBI gene;Acc:103047547])

HSP 1 Score: 51.6026 bits (122), Expect = 1.225e-6
Identity = 34/129 (26.36%), Postives = 55/129 (42.64%), Query Frame = 1
Query:  205 LIYVPPKT-RRKLKVESGYIYIIGGYD-----NVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNI 573
            L  +P K+  + + V  G++Y+ GG D     N  K  + +  RYD     W H   MI +R  ++   F+  +F  GG  S      + ECY P  +  +    +  P   +A      K+ + GG I
Sbjct:  349 LTEMPAKSFNQCVAVLDGFLYVAGGEDQNDARNQAKHAVSNFCRYDPRFNSWIHLTSMIQKRTHFSLNTFNGLLFAVGGRNSDGCQASM-ECYVPSSNQWQMKAPMEVPRCCHASTVIDGKILVTGGYI 476          
BLAST of SMED30001467 vs. Ensembl Sea Lamprey
Match: klhl18 (kelch-like family member 18 [Source:ZFIN;Acc:ZDB-GENE-030131-5785])

HSP 1 Score: 56.225 bits (134), Expect = 9.043e-9
Identity = 38/144 (26.39%), Postives = 68/144 (47.22%), Query Frame = 1
Query:  220 PKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN--IQLRNGITTSSSHFWFYEHFERTQQ 645
            P++R  + V  G +Y +GG D   ++ L S+  YD  R  W     M ++R+     + D +I+  GGY   + ++  VECY    D      ++ SP S    A+ + +V++ GG+  +Q+ N +   + H   +      QQ
Sbjct:  334 PRSRVGVAVLGGRLYAVGGSDG--QERLSSVEVYDPDRNIWTKVASMNSKRSAMGVAVLDGQIYVCGGYDGVSSLSS-VECYSSEADKWTMVTAMNSPRSATGVAFFEGRVYVTGGHDGLQIFNTVEYYNPHTGSWHKAAPMQQ 474          
BLAST of SMED30001467 vs. Ensembl Sea Lamprey
Match: KLHL12 (kelch like family member 12 [Source:HGNC Symbol;Acc:HGNC:19360])

HSP 1 Score: 51.6026 bits (122), Expect = 2.199e-7
Identity = 31/110 (28.18%), Postives = 51/110 (46.36%), Query Frame = 1
Query:  238 LKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            L V +G I+ +GGYD +    L S+ R+D   G W H   M T+R+     L +D ++  GG+     +   VE Y    D   +  S+ +P      A  + +++ I G
Sbjct:  405 LVVANGVIFCVGGYDGI--NILNSVERFDPHTGHWSHVSPMSTKRSGAGVALLNDHVYVVGGFDGAAHLAS-VESYNIRTDTWSSITSMTTPRCYVGAAVLRGRLYAIAG 511          
BLAST of SMED30001467 vs. Ensembl Sea Lamprey
Match: klhl22 (kelch-like family member 22 [Source:ZFIN;Acc:ZDB-GENE-081104-154])

HSP 1 Score: 49.6766 bits (117), Expect = 9.551e-7
Identity = 46/200 (23.00%), Postives = 83/200 (41.50%), Query Frame = 1
Query:  256 YIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVI----SEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDS 843
            YIY IGG D V +  L S+ RY +    W     +      +       K++ A G  + T ++  V CYEP  D        P   + +  A   N+V++IGG+ +L                + R     +++     ++ S+  A +P  +G  G  +V     S     +Y++GG + +   ++S   +Y A+ +S
Sbjct:  409 YIYAIGGRDYVEE--LHSVERYSLETNTWDAAAPLPKEMYAHAGTACGGKVYVACGIRADTYLST-VYCYEPAGDAWRELPPAPVERAWHCAAALANQVYLIGGSNRLHG--------------YRRDVLQVNVLQTDTEQWTSV--AHLPAGHGEPGIAVVPASDGSAMEGEIYIVGGRSHDRHARTSCVHVYDAATNS 589          
BLAST of SMED30001467 vs. Ensembl Sea Lamprey
Match: klhl31 (kelch-like family member 31 [Source:NCBI gene;Acc:407079])

HSP 1 Score: 48.521 bits (114), Expect = 2.475e-6
Identity = 47/190 (24.74%), Postives = 78/190 (41.05%), Query Frame = 1
Query:  223 KTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYD-KNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNK 789
            +T   +   +G +Y IGG  N+    L ++  Y     +W     +   R C+   + D  I   GGY S    +  V  Y+P  D  +   SL +P  G+ C+     +VF++GG+                 +   R ++ D L  E F  F S  +   P+  G+      +   N+RLY+ GG N+
Sbjct:  412 RTHFSISALNGQLYAIGGR-NLEGPLL-AVESYVPAINQWQPKAALDVARCCHASAVSDGNILVTGGYISNA-YSRTVCGYDPSTDRWQERASLSTP-RGWHCSVSLGERVFVVGGS-----------------QLGPRGERVDVLTVEAFNPFSSQWSYMAPLTIGVSTAGATL--LNHRLYVCGGWNE 578          
BLAST of SMED30001467 vs. Ensembl Sea Lamprey
Match: klhl8 (kelch-like family member 8 [Source:ZFIN;Acc:ZDB-GENE-070209-226])

HSP 1 Score: 47.7506 bits (112), Expect = 3.900e-6
Identity = 31/105 (29.52%), Postives = 48/105 (45.71%), Query Frame = 1
Query:  256 YIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            YIY +GG  N  +  L ++ RYD    +W   + M  RRA     + +  ++  GG+     +   VE Y+P  D  E    L +P  G   A    K+F +GG+
Sbjct:  454 YIYAVGG--NNGQTSLATVERYDPPLDKWEEVKGMKQRRAGAGVTVLNRCLYVVGGFDDNAPLNS-VEKYDPQKDRWEEVADLTTPRGGVGVATLIGKIFAVGGH 555          
BLAST of SMED30001467 vs. Ensembl Nematostella
Match: EDO42382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1L8])

HSP 1 Score: 57.3806 bits (137), Expect = 5.913e-9
Identity = 41/147 (27.89%), Postives = 67/147 (45.58%), Query Frame = 1
Query:  139 ISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRK---LKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGN 570
            +  +CP     W ++T          P  TRR    + V SG IY +GGYD      L SI RYD +  +W     M T+R      +    I+  GGY   + + + VEC++P+ +  ++  ++ S  S        N ++++GGN
Sbjct:  356 VEVYCPQDN-QWSTVT----------PMGTRRSCLGVAVISGLIYAVGGYDGA--SCLNSIERYDPLTAQWTSVAAMSTKRRYVRVGVVGGIIYAVGGYDGSSHL-NTVECFDPVTNTWKSVANMASRRSSAGVVVLNNMLYVVGGN 488          
BLAST of SMED30001467 vs. Ensembl Nematostella
Match: EDO30333 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T138])

HSP 1 Score: 56.9954 bits (136), Expect = 9.139e-9
Identity = 64/264 (24.24%), Postives = 113/264 (42.80%), Query Frame = 1
Query:  259 IYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG--NIQLRNGITTSSSHFWFYEHFE-RTQQSDSLMP--------EMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQ--RSYNGVSLINNKLFIIGGLQ-NKFNSTVTILEV 1008
            ++ +GGYD+  +  L ++  Y+ +  +W     M+ RR        D KI+ +GG+   TV    VECY+P +D    +  + SP  G   +     ++ +GG     + N +          E F+ RT Q  ++ P        ++   FI  ++AK+     I+G  + +   + +LY IGG + N+         + A+++      D       W  R +  MQ  R Y G S++  KL  +GG        T+ I +V
Sbjct:  336 LFALGGYDSSSR--LNTVECYNPIVSQWNTVTPMLQRRGLAGAVTLDGKIYVSGGFDG-TVRHTSVECYDPNIDRWSMASRMLSPREGAGLSNMDGILYSVGGYDGTNILNTV----------ERFDPRTGQWTAVAPMGTRRSGKDILNHFILEDSAKIICY--ILGAGVTV--LDGQLYAIGGYDGNH---------HLATVECYSPCTDQ------W--RPVASMQSKRCYVGGSILGGKLCAVGGYDGTALQDTIEIYDV 565          
BLAST of SMED30001467 vs. Ensembl Nematostella
Match: EDO46854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP55])

HSP 1 Score: 54.299 bits (129), Expect = 6.744e-8
Identity = 43/156 (27.56%), Postives = 67/156 (42.95%), Query Frame = 1
Query:  214 VPP----KTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEM 669
            VPP    ++   +    GY+Y +GGYD     +L ++ RY     EW     MI  R+C+   + D  I+  GGY    + T  VE Y+P MD  E   ++               ++I+GG+    NG+    SH    E F+      S++  M
Sbjct:  367 VPPMHQCRSNHSVLTLGGYLYALGGYDG--NSYLNTVERYCPKTKEWTMVSPMIFSRSCFAAEVADGYIYAFGGYGPSYLST--VERYDPSMDAWEMMPAMSMVRINSGVGVVAGCLYIVGGH----NGV----SHLQSVERFDPITNEWSMVAPM 510          
BLAST of SMED30001467 vs. Ensembl Nematostella
Match: EDO49374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG74])

HSP 1 Score: 52.373 bits (124), Expect = 2.682e-7
Identity = 59/245 (24.08%), Postives = 103/245 (42.04%), Query Frame = 1
Query:  232 RKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGG 966
            RK    +G IY IGG  N   + L S+  +DM+  +W     M T R      + D++++  GG+     ++  VE Y P++D    +  + +  S    A    K++++GG     +G  + S+     E +  T  S S +  M                  +     ++E N +L++IGG N          GL   SI S + + D  T +  W       M+R   GV+ +N+ +++ GG
Sbjct:  275 RKCSEAAGLIYAIGGL-NSSGEALCSVETFDMLSCQWSPTSPMNTLRTRVGVAVLDNRLYALGGFDGHKRLST-VEFYNPVLDKWIPAAPMNTRRSALGAATVNGKIYVVGG----YDGHISLST----MECYSATANSWSFLAPM----------------STLRSAAGVTELNGKLFVIGGHN----------GL---SIFSSVEVYDPQTDK--WGPGASLLMRRCRVGVATLNSCIYVCGG 478          
BLAST of SMED30001467 vs. Ensembl Nematostella
Match: EDO33590 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRT7])

HSP 1 Score: 51.6026 bits (122), Expect = 4.325e-7
Identity = 32/97 (32.99%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  244 VESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACA 534
            V +G+IY++GG  +  +  L S   Y+    +W +   M  +R      +FDDKI+  GG +   V+ D VECY+P +   E    LP+   G+ CA
Sbjct:  484 VLNGHIYVMGG--SSERSALSSCEVYNPSMNKWTYFSDMSIKRDRAGAAVFDDKIYVFGG-SYGNVVIDTVECYDPAVGRWETVAHLPNARHGFKCA 577          
BLAST of SMED30001467 vs. Ensembl Medaka
Match: ENSORLT00000013860.2 (kelch-like protein 10 [Source:NCBI gene;Acc:101168357])

HSP 1 Score: 68.1662 bits (165), Expect = 7.230e-12
Identity = 56/200 (28.00%), Postives = 89/200 (44.50%), Query Frame = 1
Query:  214 VPPKTRRK----LKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDT 801
            V P  R++    + V +G IY +GGY+ +R+  L S  R+D  R +W     M  RR+  +   FD K++  GG+T    +   VECY+P  D      S+ S  SG   A  +N++F IGG                 +   ER   +++  P     + ++     P  N        IS  N+ L+++GG N N+ T
Sbjct:  349 VSPMHRKRCFVSVTVLNGLIYALGGYNGLRR--LESAERFDPKRNQWTFISSMHERRSDASCVSFDGKVYICGGFTGMHCLAT-VECYDPRTDQWTMMASMSSRRSGVGVAVYENQIFAIGG-----------------FSGTERLATAEAYNPNT-NAWETVRPMLCPRSN------FGISVINSCLFVVGGYNGNHTT 521          
BLAST of SMED30001467 vs. Ensembl Medaka
Match: klhl33 (kelch-like protein 33 [Source:NCBI gene;Acc:101170795])

HSP 1 Score: 58.9214 bits (141), Expect = 7.086e-9
Identity = 38/125 (30.40%), Postives = 62/125 (49.60%), Query Frame = 1
Query:  220 PKTRR---KLKVESGYIYIIGGYDNVRKKF------LRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            P+T R   ++ V  G +Y+ GG     KK+      L S+ RYD ++  W   R+M  RR  ++  + D+K++  GG+     M D VECY P  +    S  L  P SG+     ++++ + GG
Sbjct:  765 PETARFGHEVAVLHGLLYVFGG-----KKYYGTGDTLNSVYRYDPLQNVWQCIREMQERRCSFSVVVLDEKMYAIGGHCELYHM-DSVECYCPTTNSWSLSRPLDLPLSGHVARVCQDQIIVTGG 883          
BLAST of SMED30001467 vs. Ensembl Medaka
Match: klhl6 (kelch like family member 6 [Source:NCBI gene;Acc:101171209])

HSP 1 Score: 57.7658 bits (138), Expect = 1.381e-8
Identity = 31/115 (26.96%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  229 RRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNI 573
            R K+ V++G +Y++GG+D  ++  L S+  YD     W     +    + +    FD  I+  GG  +  + TD V+C+EP  D  E    +P           KN ++++GG +
Sbjct:  425 RHKMAVQNGKVYVLGGFDGTQR--LTSVEAYDPFHNRWTQATPLAIGVSSFAAANFDRWIYVIGGGPNGKLSTDKVQCWEPGTDSWELRAPIPIETKCTNAVTFKNCIYVVGGAM 537          
BLAST of SMED30001467 vs. Ensembl Medaka
Match: klhl6 (kelch like family member 6 [Source:NCBI gene;Acc:101171209])

HSP 1 Score: 57.3806 bits (137), Expect = 1.555e-8
Identity = 31/115 (26.96%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  229 RRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNI 573
            R K+ V++G +Y++GG+D  ++  L S+  YD     W     +    + +    FD  I+  GG  +  + TD V+C+EP  D  E    +P           KN ++++GG +
Sbjct:  399 RHKMAVQNGKVYVLGGFDGTQR--LTSVEAYDPFHNRWTQATPLAIGVSSFAAANFDRWIYVIGGGPNGKLSTDKVQCWEPGTDSWELRAPIPIETKCTNAVTFKNCIYVVGGAM 511          
BLAST of SMED30001467 vs. Ensembl Medaka
Match: klhl18 (kelch like family member 18 [Source:NCBI gene;Acc:101157249])

HSP 1 Score: 52.373 bits (124), Expect = 7.917e-7
Identity = 38/150 (25.33%), Postives = 65/150 (43.33%), Query Frame = 1
Query:  133 NLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLR 582
            NL+  F PL  F W+    +          ++R  + V +G +Y IGGYD   +  L ++  Y+     W     M ++R+     + D  I+  GGY  K+ +   VECY P  D       + +  S       + ++F+ GG+  L+
Sbjct:  416 NLVEVFDPLGNF-WERCQPMRT-------ARSRVGVAVVNGLLYAIGGYDGQSR--LSTVEVYNPEADSWMQVSSMNSQRSAMGTVVVDGHIYVCGGYDGKSSLNS-VECYSPETDRWVVVTEMSASRSAAGVTVFEGRIFVSGGHDGLQ 554          
BLAST of SMED30001467 vs. Planmine SMEST
Match: SMESG000050635.1 (SMESG000050635.1)

HSP 1 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 410/416 (98.56%), Postives = 414/416 (99.52%), Query Frame = 1
Query:   52 MQSILLVSNSPNTTHKAGFIVFHPERNNLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEVDEEGDKAPNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSANDINLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW 1299
            MQSILLVSNSPNTTHKAGFIVFHPERNNLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRAC+TPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGIT SSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPI+NGIIGHKI ISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEVDEEGD+APNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSAN+INLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW
Sbjct:    1 MQSILLVSNSPNTTHKAGFIVFHPERNNLISKFCPLTTFTWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACFTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGITASSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIKNGIIGHKIFISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEVDEEGDQAPNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSANEINLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW 416          
BLAST of SMED30001467 vs. Planmine SMEST
Match: SMESG000050635.1 (SMESG000050635.1)

HSP 1 Score: 431.409 bits (1108), Expect = 1.481e-152
Identity = 210/214 (98.13%), Postives = 213/214 (99.53%), Query Frame = 1
Query:  658 MPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEVDEEGDKAPNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSANDINLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW 1299
            MPEMFYKFISIENAKVPI+NGIIGHKI ISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEVDEEGD+APNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSAN+INLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW
Sbjct:    1 MPEMFYKFISIENAKVPIKNGIIGHKIFISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEVDEEGDQAPNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSANEINLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW 214          
BLAST of SMED30001467 vs. Planmine SMEST
Match: SMESG000050635.1 (SMESG000050635.1)

HSP 1 Score: 424.476 bits (1090), Expect = 7.709e-150
Identity = 207/211 (98.10%), Postives = 210/211 (99.53%), Query Frame = 1
Query:  667 MFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEVDEEGDKAPNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSANDINLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW 1299
            MFYKFISIENAKVPI+NGIIGHKI ISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEVDEEGD+APNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSAN+INLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW
Sbjct:    1 MFYKFISIENAKVPIKNGIIGHKIFISEKNNRLYLIGGTNKNNDTKSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKLFIIGGLQNKFNSTVTILEVDEEGDQAPNSDHLKDADEMGVIFLKNNKRPLDMVFVPVDEMIGYFDWRRKIYKDVYSLSSANEINLESIHCVVVDMNDKYAEFNKDRYDWLIQWALW 211          
BLAST of SMED30001467 vs. Planmine SMEST
Match: SMESG000078467.1 (SMESG000078467.1)

HSP 1 Score: 54.299 bits (129), Expect = 1.452e-7
Identity = 32/108 (29.63%), Postives = 52/108 (48.15%), Query Frame = 1
Query:  244 VESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGG 567
            V +G I++ GG+D + +  L+S+  YD    +W     M T R      + D  ++C GGY    ++ D VE Y+ + D    SE +    SG  CA     +++ GG
Sbjct:  390 VYNGRIFVCGGFDGIAR--LKSLEVYDPSINQWSRKESMETSREGAGLVVVDSYLYCVGGYNGMQLL-DTVEKYDILNDQWSKSEPMHYRRSGAGCAVMNETIYVCGG 494          
BLAST of SMED30001467 vs. Planmine SMEST
Match: SMESG000008723.1 (SMESG000008723.1)

HSP 1 Score: 49.6766 bits (117), Expect = 2.442e-6
Identity = 44/208 (21.15%), Postives = 81/208 (38.94%), Query Frame = 1
Query:  169 TWKSLTHISDFGLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHCRKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSESLPSPCSGYACAYDKNKVFIIGGNIQLRNGI----TTSSSHFWFYEHFERTQQSDSLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGG 780
            TW  + ++ +F  +               +IY++GGY    K+ ++++ RYD++  EW     M   R   T  +F D+I   GG+ + + +    E Y    +      S     S        + +   GG   ++N I    T   S+   YE+     +  +L           EN    +   +  H +V  E  +++Y+IGG
Sbjct:   37 TWNQIVNLKEFSCVS-----------HKQFIYVLGGYSTKLKRPIQNVKRYDVITNEWTDLTSMENERRMATAVVFKDEIVICGGFKNSSKLHASTEIYNIAHNKWRKGPSFKIGISDIQLLVVNDSILGFGG---MKNSIYKNETILCSNDEIYEYKNNGNEWSTLD----------ENVPFILSKPVYNHSVV--EMESKIYIIGG 218          
The following BLAST results are available for this feature:
BLAST of SMED30001467 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KLHL423.513e-725.96kelch like family member 42 [Source:HGNC Symbol;Ac... [more]
KLHL333.908e-722.28kelch like family member 33 [Source:HGNC Symbol;Ac... [more]
KLHL334.259e-721.74kelch like family member 33 [Source:HGNC Symbol;Ac... [more]
KLHL174.285e-732.08kelch like family member 17 [Source:HGNC Symbol;Ac... [more]
KLHL69.419e-716.92kelch like family member 6 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30001467 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ivns-12.257e-731.19Influenza Virus NS1a (A) binding protein homolog ... [more]
ivns-12.257e-731.19Influenza Virus NS1a (A) binding protein homolog ... [more]
ivns-12.257e-731.19Influenza Virus NS1a (A) binding protein homolog ... [more]
back to top
BLAST of SMED30001467 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KLHL187.111e-826.32gene:FBgn0037978 transcript:FBtr0082557[more]
KLHL188.418e-826.32gene:FBgn0037978 transcript:FBtr0082556[more]
KLHL188.418e-826.32gene:FBgn0037978 transcript:FBtr0335434[more]
klhl102.199e-626.42gene:FBgn0040038 transcript:FBtr0113686[more]
klhl102.199e-626.42gene:FBgn0040038 transcript:FBtr0113685[more]
back to top
BLAST of SMED30001467 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl261.053e-621.30kelch-like family member 26 [Source:NCBI gene;Acc:... [more]
klhl261.053e-621.30kelch-like family member 26 [Source:NCBI gene;Acc:... [more]
klhl311.384e-625.00kelch-like family member 31 [Source:NCBI gene;Acc:... [more]
klhl311.384e-625.00kelch-like family member 31 [Source:NCBI gene;Acc:... [more]
si:ch211-63p21.81.864e-624.69si:ch211-63p21.8 [Source:ZFIN;Acc:ZDB-GENE-130530-... [more]
back to top
BLAST of SMED30001467 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KLHL171.397e-631.36kelch like family member 17 [Source:NCBI gene;Acc:... [more]
KLHL171.472e-631.36kelch like family member 17 [Source:NCBI gene;Acc:... [more]
KLHL171.531e-631.36kelch like family member 17 [Source:NCBI gene;Acc:... [more]
slc25a102.560e-627.14solute carrier family 25 member 10 [Source:Xenbase... [more]
zbtb483.273e-631.18zinc finger and BTB domain containing 48 [Source:X... [more]
back to top
BLAST of SMED30001467 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plekhn15.850e-732.08pleckstrin homology domain containing, family N me... [more]
Klhl421.057e-625.96kelch-like 42 [Source:MGI Symbol;Acc:MGI:2444786][more]
Klhl332.894e-624.04kelch-like 33 [Source:MGI Symbol;Acc:MGI:3644593][more]
Klhl123.255e-629.09kelch-like 12 [Source:MGI Symbol;Acc:MGI:2385619][more]
Klhl123.255e-629.09kelch-like 12 [Source:MGI Symbol;Acc:MGI:2385619][more]
back to top
BLAST of SMED30001467 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25390|SCRA_LIMPO2.349e-722.65Alpha-scruin OS=Limulus polyphemus OX=6850 PE=2 SV... [more]
sp|Q70JS2|KELC_ANOST1.758e-624.79Ring canal kelch homolog OS=Anopheles stephensi OX... [more]
sp|A6NCF5|KLH33_HUMAN2.045e-621.74Kelch-like protein 33 OS=Homo sapiens OX=9606 GN=K... [more]
sp|Q6TDP4|KLH17_HUMAN2.058e-632.08Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=K... [more]
sp|Q8K430|KLH17_RAT4.092e-632.08Kelch-like protein 17 OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of SMED30001467 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182128421.838e-6029.91tr|A0A267EXD6|A0A267EXD6_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157831262.357e-6029.89tr|A0A1I8IHE1|A0A1I8IHE1_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182719893.205e-6030.22tr|A0A1I8J8Q1|A0A1I8J8Q1_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182313818.514e-5930.00tr|A0A1I8HIT0|A0A1I8HIT0_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182076728.514e-5929.78tr|A0A267F3U3|A0A267F3U3_9PLAT Uncharacterized pro... [more]
back to top
BLAST of SMED30001467 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KLHL101.755e-827.59kelch-like protein 10 [Source:NCBI gene;Acc:103041... [more]
KLHL102.341e-827.59kelch-like protein 10 [Source:NCBI gene;Acc:103041... [more]
ENSAMXT00000018852.22.089e-728.28kelch-like protein 10 [Source:NCBI gene;Acc:103032... [more]
klhl311.225e-626.36kelch like family member 31 [Source:NCBI gene;Acc:... [more]
klhl311.225e-626.36kelch like family member 31 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of SMED30001467 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl189.043e-926.39kelch-like family member 18 [Source:ZFIN;Acc:ZDB-G... [more]
KLHL122.199e-728.18kelch like family member 12 [Source:HGNC Symbol;Ac... [more]
klhl229.551e-723.00kelch-like family member 22 [Source:ZFIN;Acc:ZDB-G... [more]
klhl312.475e-624.74kelch-like family member 31 [Source:NCBI gene;Acc:... [more]
klhl83.900e-629.52kelch-like family member 8 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of SMED30001467 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001467 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO423825.913e-927.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303339.139e-924.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468546.744e-827.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493742.682e-724.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335904.325e-732.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30001467 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000013860.27.230e-1228.00kelch-like protein 10 [Source:NCBI gene;Acc:101168... [more]
klhl337.086e-930.40kelch-like protein 33 [Source:NCBI gene;Acc:101170... [more]
klhl61.381e-826.96kelch like family member 6 [Source:NCBI gene;Acc:1... [more]
klhl61.555e-826.96kelch like family member 6 [Source:NCBI gene;Acc:1... [more]
klhl187.917e-725.33kelch like family member 18 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of SMED30001467 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050635.10.000e+098.56SMESG000050635.1[more]
SMESG000050635.11.481e-15298.13SMESG000050635.1[more]
SMESG000050635.17.709e-15098.10SMESG000050635.1[more]
SMESG000078467.11.452e-729.63SMESG000078467.1[more]
SMESG000008723.12.442e-621.15SMESG000008723.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001467 ID=SMED30001467|Name=SMED30001467|organism=Schmidtea mediterranea sexual|type=transcript|length=1310bp
ATTTGAGTGATATTTGATAAAATTAAAATATTAACTTTTCTAATTGGATT
AATGCAGAGCATTCTTTTGGTTTCCAACAGTCCCAACACAACTCACAAAG
CGGGTTTCATCGTATTCCATCCGGAAAGAAATAATCTTATTTCCAAATTT
TGTCCTTTAACAACTTTTACCTGGAAATCTCTCACTCACATTTCTGATTT
CGGTTTGATTTATGTGCCCCCTAAGACAAGGCGAAAATTGAAAGTAGAAT
CAGGATATATTTATATAATTGGTGGATATGACAATGTTAGAAAAAAGTTC
CTTCGATCAATTATAAGGTATGACATGATGCGAGGAGAATGGTTTCATTG
TAGAAAAATGATTACAAGACGAGCGTGTTATACTCCGTTTCTGTTTGATG
ATAAAATATTTTGTGCAGGAGGCTACACCTCTAAAACAGTAATGACAGAT
TTAGTTGAGTGCTACGAACCGATGATGGATATGATAGAAAATTCAGAATC
ACTGCCATCTCCGTGTTCCGGTTACGCATGTGCGTATGACAAAAATAAAG
TTTTTATTATTGGAGGAAATATACAGTTACGAAATGGCATAACAACAAGT
AGCTCACACTTCTGGTTTTATGAACATTTTGAAAGAACACAACAAAGCGA
CTCACTTATGCCAGAAATGTTTTACAAATTTATTTCTATAGAAAATGCTA
AAGTTCCTATTGAAAATGGTATTATCGGTCACAAAATTGTTATTTCGGAA
AAAAATAATAGATTATATTTAATTGGAGGTACGAATAAGAACAACGATAC
AAAATCTTCAATTGCAGGATTATATTACGCCAGTATAGATTCAATAATTG
CATTGAAGGACGGTGCCACAGTAGAAAGTATATGGTATAAAAGGAATATC
CCGGAAATGCAGAGATCATATAACGGAGTGTCACTTATAAATAACAAACT
TTTCATTATTGGAGGCCTACAGAATAAATTTAATTCTACTGTTACGATAT
TGGAGGTTGATGAAGAAGGTGACAAAGCACCAAATTCAGATCATTTAAAG
GACGCAGATGAAATGGGAGTTATATTTTTAAAAAACAATAAAAGACCCTT
GGATATGGTTTTTGTTCCAGTTGATGAAATGATCGGTTATTTCGATTGGC
GAAGAAAGATATACAAGGACGTCTACAGTTTAAGTAGTGCAAATGACATA
AATTTGGAGAGCATCCATTGCGTTGTTGTTGACATGAATGATAAATATGC
AGAATTTAATAAAGACAGATATGACTGGTTAATACAATGGGCTCTTTGGT
AGAATATAGG
back to top

protein sequence of SMED30001467-orf-1

>SMED30001467-orf-1 ID=SMED30001467-orf-1|Name=SMED30001467-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=417bp
MQSILLVSNSPNTTHKAGFIVFHPERNNLISKFCPLTTFTWKSLTHISDF
GLIYVPPKTRRKLKVESGYIYIIGGYDNVRKKFLRSIIRYDMMRGEWFHC
RKMITRRACYTPFLFDDKIFCAGGYTSKTVMTDLVECYEPMMDMIENSES
LPSPCSGYACAYDKNKVFIIGGNIQLRNGITTSSSHFWFYEHFERTQQSD
SLMPEMFYKFISIENAKVPIENGIIGHKIVISEKNNRLYLIGGTNKNNDT
KSSIAGLYYASIDSIIALKDGATVESIWYKRNIPEMQRSYNGVSLINNKL
FIIGGLQNKFNSTVTILEVDEEGDKAPNSDHLKDADEMGVIFLKNNKRPL
DMVFVPVDEMIGYFDWRRKIYKDVYSLSSANDINLESIHCVVVDMNDKYA
EFNKDRYDWLIQWALW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR030609KLHL33
IPR006652Kelch_1
IPR015915Kelch-typ_b-propeller
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006652Kelch repeat type 1SMARTSM00612kelc_smartcoord: 118..165
e-value: 1.4
score: 10.3
coord: 69..117
e-value: 4.1E-4
score: 29.7
IPR006652Kelch repeat type 1PFAMPF01344Kelch_1coord: 68..103
e-value: 2.9E-6
score: 26.7
IPR015915Kelch-type beta propellerGENE3DG3DSA:2.120.10.80coord: 36..209
e-value: 2.1E-22
score: 81.3
IPR015915Kelch-type beta propellerSUPERFAMILYSSF117281Kelch motifcoord: 39..316
IPR030609Kelch-like protein 33PANTHERPTHR45632:SF14KELCH-LIKE PROTEIN 33coord: 56..177
NoneNo IPR availablePANTHERPTHR45632FAMILY NOT NAMEDcoord: 56..177