Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30001465
Length (bp)2919
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30001465) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30001465) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30001465) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30001465) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001465

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30001465h1SMcG0016098 dd_Smed_v4_4202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001465h1SMcG0016098 dd_Smed_v4_4202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001465h1SMcG0016098 dd_Smed_v4_4202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001465h1SMcG0016098 dd_Smed_v4_4202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30001465h1SMcG0016098 dd_Smed_v4_4202_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001465h1SMcG0016098 Contig37441newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001465h1SMcG0016098 Contig37441uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001465h1SMcG0016098 Contig40782newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001465h1SMcG0016098 Contig40782uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: SRPK3 (SRSF protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:11402])

HSP 1 Score: 329.717 bits (844), Expect = 4.823e-102
Identity = 153/210 (72.86%), Postives = 180/210 (85.71%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASS-VSTAPKE 898
            +LGSD+EEQEDPKDYCKGGYHPVK+G V+N RYHVVRKLGWGHFSTVWLCWD++ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP+   R+  VQLIDDFR++G+NG HVCMV EVLG  LLK IIKSNY+G+P   V++I+RQ L GL YLHTKC+IIHTDIKPENILLCV D+++RRLAAEA + Q+ G P  + S VSTAP+E
Sbjct:    5 LLGSDDEEQEDPKDYCKGGYHPVKIGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQE 214          

HSP 2 Score: 269.24 bits (687), Expect = 1.270e-79
Identity = 120/164 (73.17%), Postives = 137/164 (83.54%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            I++KIADLGNACW   HFTEDIQTRQYRA+EVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH++ELLG IP   ALSGRYSR+FF ++GELRHIHNL  W LY VL EKY+W    A  F+ FLLPM+ Y  ++R +A DCLQHPWLN
Sbjct:  328 IKIKIADLGNACWVHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLN 491          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: SRPK3 (SRSF protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:11402])

HSP 1 Score: 330.872 bits (847), Expect = 5.952e-102
Identity = 153/210 (72.86%), Postives = 180/210 (85.71%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASS-VSTAPKE 898
            +LGSD+EEQEDPKDYCKGGYHPVK+G V+N RYHVVRKLGWGHFSTVWLCWD++ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP+   R+  VQLIDDFR++G+NG HVCMV EVLG  LLK IIKSNY+G+P   V++I+RQ L GL YLHTKC+IIHTDIKPENILLCV D+++RRLAAEA + Q+ G P  + S VSTAP+E
Sbjct:   47 LLGSDDEEQEDPKDYCKGGYHPVKIGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQE 256          

HSP 2 Score: 270.396 bits (690), Expect = 1.671e-79
Identity = 120/164 (73.17%), Postives = 137/164 (83.54%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            I++KIADLGNACW   HFTEDIQTRQYRA+EVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH++ELLG IP   ALSGRYSR+FF ++GELRHIHNL  W LY VL EKY+W    A  F+ FLLPM+ Y  ++R +A DCLQHPWLN
Sbjct:  370 IKIKIADLGNACWVHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLN 533          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: SRPK3 (SRSF protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:11402])

HSP 1 Score: 330.487 bits (846), Expect = 6.553e-102
Identity = 153/210 (72.86%), Postives = 180/210 (85.71%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASS-VSTAPKE 898
            +LGSD+EEQEDPKDYCKGGYHPVK+G V+N RYHVVRKLGWGHFSTVWLCWD++ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP+   R+  VQLIDDFR++G+NG HVCMV EVLG  LLK IIKSNY+G+P   V++I+RQ L GL YLHTKC+IIHTDIKPENILLCV D+++RRLAAEA + Q+ G P  + S VSTAP+E
Sbjct:   47 LLGSDDEEQEDPKDYCKGGYHPVKIGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQE 256          

HSP 2 Score: 270.396 bits (690), Expect = 1.766e-79
Identity = 120/164 (73.17%), Postives = 137/164 (83.54%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            I++KIADLGNACW   HFTEDIQTRQYRA+EVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH++ELLG IP   ALSGRYSR+FF ++GELRHIHNL  W LY VL EKY+W    A  F+ FLLPM+ Y  ++R +A DCLQHPWLN
Sbjct:  369 IKIKIADLGNACWVHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLN 532          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: SRPK3 (SRSF protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:11402])

HSP 1 Score: 330.872 bits (847), Expect = 1.435e-101
Identity = 153/210 (72.86%), Postives = 180/210 (85.71%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASS-VSTAPKE 898
            +LGSD+EEQEDPKDYCKGGYHPVK+G V+N RYHVVRKLGWGHFSTVWLCWD++ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP+   R+  VQLIDDFR++G+NG HVCMV EVLG  LLK IIKSNY+G+P   V++I+RQ L GL YLHTKC+IIHTDIKPENILLCV D+++RRLAAEA + Q+ G P  + S VSTAP+E
Sbjct:   47 LLGSDDEEQEDPKDYCKGGYHPVKIGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQE 256          

HSP 2 Score: 270.396 bits (690), Expect = 3.987e-79
Identity = 120/164 (73.17%), Postives = 137/164 (83.54%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            I++KIADLGNACW   HFTEDIQTRQYRA+EVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH++ELLG IP   ALSGRYSR+FF ++GELRHIHNL  W LY VL EKY+W    A  F+ FLLPM+ Y  ++R +A DCLQHPWLN
Sbjct:  402 IKIKIADLGNACWVHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLN 565          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: SRPK3 (SRSF protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:11402])

HSP 1 Score: 330.872 bits (847), Expect = 1.587e-101
Identity = 153/210 (72.86%), Postives = 180/210 (85.71%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASS-VSTAPKE 898
            +LGSD+EEQEDPKDYCKGGYHPVK+G V+N RYHVVRKLGWGHFSTVWLCWD++ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP+   R+  VQLIDDFR++G+NG HVCMV EVLG  LLK IIKSNY+G+P   V++I+RQ L GL YLHTKC+IIHTDIKPENILLCV D+++RRLAAEA + Q+ G P  + S VSTAP+E
Sbjct:   47 LLGSDDEEQEDPKDYCKGGYHPVKIGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQE 256          

HSP 2 Score: 270.011 bits (689), Expect = 4.256e-79
Identity = 120/164 (73.17%), Postives = 137/164 (83.54%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            I++KIADLGNACW   HFTEDIQTRQYRA+EVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH++ELLG IP   ALSGRYSR+FF ++GELRHIHNL  W LY VL EKY+W    A  F+ FLLPM+ Y  ++R +A DCLQHPWLN
Sbjct:  403 IKIKIADLGNACWVHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLN 566          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: spk-1 (Serine/threonine-protein kinase spk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03563])

HSP 1 Score: 285.419 bits (729), Expect = 1.349e-84
Identity = 133/209 (63.64%), Postives = 161/209 (77.03%), Query Frame = 2
Query:  266 NEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAP 892
             E LGSD+EEQEDP+DY +GGYHPV +G V+N RYHV+RKLGWGHFSTVWL WD ++KRFVAMK+VKSA HYTE A DEIKLL  VR ADP      + VQL+D+F VTGING HV MVFEVLGCNLLKLII+SNYRG+  + VR I RQ LE L Y+H KC IIHTDIKPEN+L+ +S   ++ +A  A+  ++  + +  S+VSTAP
Sbjct:    4 GEQLGSDDEEQEDPRDYKRGGYHPVNIGDVFNARYHVIRKLGWGHFSTVWLAWDTQDKRFVAMKIVKSAEHYTEAALDEIKLLLSVRSADPNDIGCHKVVQLLDEFTVTGINGQHVAMVFEVLGCNLLKLIIRSNYRGLHLEQVRKICRQVLEALGYMHEKCGIIHTDIKPENVLITMSREEIKIMAQHAVVARKMNMKMSGSAVSTAP 212          

HSP 2 Score: 251.521 bits (641), Expect = 2.814e-72
Identity = 116/180 (64.44%), Postives = 135/180 (75.00%), Query Frame = 2
Query: 1712 LLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            +L  P   P+     C I VKIADLGNACW  HH+T+DIQTRQYRALEVLIG+GYG PADIWSTACMAFELATGDYLFEPH GD+YSRD+DHLAH+ ELLG IP  I   G++ R+FF K G L HIH L PW LY VLR+KY+WS   A+ F  FL PML +D ++R TA   L+HP+L
Sbjct:  341 ILPAPPVGPNIGDPYCDIDVKIADLGNACWVNHHYTDDIQTRQYRALEVLIGSGYGPPADIWSTACMAFELATGDYLFEPHQGDNYSRDEDHLAHISELLGAIPPSIYKKGKHWREFFHKNGHLLHIHQLKPWSLYEVLRQKYEWSHEDAQQFESFLRPMLDFDQEKRSTAKIALKHPFL 520          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: spk-1 (Serine/threonine-protein kinase spk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03563])

HSP 1 Score: 285.419 bits (729), Expect = 1.349e-84
Identity = 133/209 (63.64%), Postives = 161/209 (77.03%), Query Frame = 2
Query:  266 NEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAP 892
             E LGSD+EEQEDP+DY +GGYHPV +G V+N RYHV+RKLGWGHFSTVWL WD ++KRFVAMK+VKSA HYTE A DEIKLL  VR ADP      + VQL+D+F VTGING HV MVFEVLGCNLLKLII+SNYRG+  + VR I RQ LE L Y+H KC IIHTDIKPEN+L+ +S   ++ +A  A+  ++  + +  S+VSTAP
Sbjct:    4 GEQLGSDDEEQEDPRDYKRGGYHPVNIGDVFNARYHVIRKLGWGHFSTVWLAWDTQDKRFVAMKIVKSAEHYTEAALDEIKLLLSVRSADPNDIGCHKVVQLLDEFTVTGINGQHVAMVFEVLGCNLLKLIIRSNYRGLHLEQVRKICRQVLEALGYMHEKCGIIHTDIKPENVLITMSREEIKIMAQHAVVARKMNMKMSGSAVSTAP 212          

HSP 2 Score: 251.521 bits (641), Expect = 2.814e-72
Identity = 116/180 (64.44%), Postives = 135/180 (75.00%), Query Frame = 2
Query: 1712 LLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            +L  P   P+     C I VKIADLGNACW  HH+T+DIQTRQYRALEVLIG+GYG PADIWSTACMAFELATGDYLFEPH GD+YSRD+DHLAH+ ELLG IP  I   G++ R+FF K G L HIH L PW LY VLR+KY+WS   A+ F  FL PML +D ++R TA   L+HP+L
Sbjct:  341 ILPAPPVGPNIGDPYCDIDVKIADLGNACWVNHHYTDDIQTRQYRALEVLIGSGYGPPADIWSTACMAFELATGDYLFEPHQGDNYSRDEDHLAHISELLGAIPPSIYKKGKHWREFFHKNGHLLHIHQLKPWSLYEVLRQKYEWSHEDAQQFESFLRPMLDFDQEKRSTAKIALKHPFL 520          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: spk-1 (Serine/threonine-protein kinase spk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03563])

HSP 1 Score: 285.419 bits (729), Expect = 1.349e-84
Identity = 133/209 (63.64%), Postives = 161/209 (77.03%), Query Frame = 2
Query:  266 NEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAP 892
             E LGSD+EEQEDP+DY +GGYHPV +G V+N RYHV+RKLGWGHFSTVWL WD ++KRFVAMK+VKSA HYTE A DEIKLL  VR ADP      + VQL+D+F VTGING HV MVFEVLGCNLLKLII+SNYRG+  + VR I RQ LE L Y+H KC IIHTDIKPEN+L+ +S   ++ +A  A+  ++  + +  S+VSTAP
Sbjct:    4 GEQLGSDDEEQEDPRDYKRGGYHPVNIGDVFNARYHVIRKLGWGHFSTVWLAWDTQDKRFVAMKIVKSAEHYTEAALDEIKLLLSVRSADPNDIGCHKVVQLLDEFTVTGINGQHVAMVFEVLGCNLLKLIIRSNYRGLHLEQVRKICRQVLEALGYMHEKCGIIHTDIKPENVLITMSREEIKIMAQHAVVARKMNMKMSGSAVSTAP 212          

HSP 2 Score: 251.521 bits (641), Expect = 2.814e-72
Identity = 116/180 (64.44%), Postives = 135/180 (75.00%), Query Frame = 2
Query: 1712 LLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            +L  P   P+     C I VKIADLGNACW  HH+T+DIQTRQYRALEVLIG+GYG PADIWSTACMAFELATGDYLFEPH GD+YSRD+DHLAH+ ELLG IP  I   G++ R+FF K G L HIH L PW LY VLR+KY+WS   A+ F  FL PML +D ++R TA   L+HP+L
Sbjct:  341 ILPAPPVGPNIGDPYCDIDVKIADLGNACWVNHHYTDDIQTRQYRALEVLIGSGYGPPADIWSTACMAFELATGDYLFEPHQGDNYSRDEDHLAHISELLGAIPPSIYKKGKHWREFFHKNGHLLHIHQLKPWSLYEVLRQKYEWSHEDAQQFESFLRPMLDFDQEKRSTAKIALKHPFL 520          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: spk-1 (Serine/threonine-protein kinase spk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03563])

HSP 1 Score: 285.419 bits (729), Expect = 1.349e-84
Identity = 133/209 (63.64%), Postives = 161/209 (77.03%), Query Frame = 2
Query:  266 NEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAP 892
             E LGSD+EEQEDP+DY +GGYHPV +G V+N RYHV+RKLGWGHFSTVWL WD ++KRFVAMK+VKSA HYTE A DEIKLL  VR ADP      + VQL+D+F VTGING HV MVFEVLGCNLLKLII+SNYRG+  + VR I RQ LE L Y+H KC IIHTDIKPEN+L+ +S   ++ +A  A+  ++  + +  S+VSTAP
Sbjct:    4 GEQLGSDDEEQEDPRDYKRGGYHPVNIGDVFNARYHVIRKLGWGHFSTVWLAWDTQDKRFVAMKIVKSAEHYTEAALDEIKLLLSVRSADPNDIGCHKVVQLLDEFTVTGINGQHVAMVFEVLGCNLLKLIIRSNYRGLHLEQVRKICRQVLEALGYMHEKCGIIHTDIKPENVLITMSREEIKIMAQHAVVARKMNMKMSGSAVSTAP 212          

HSP 2 Score: 251.521 bits (641), Expect = 2.814e-72
Identity = 116/180 (64.44%), Postives = 135/180 (75.00%), Query Frame = 2
Query: 1712 LLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            +L  P   P+     C I VKIADLGNACW  HH+T+DIQTRQYRALEVLIG+GYG PADIWSTACMAFELATGDYLFEPH GD+YSRD+DHLAH+ ELLG IP  I   G++ R+FF K G L HIH L PW LY VLR+KY+WS   A+ F  FL PML +D ++R TA   L+HP+L
Sbjct:  341 ILPAPPVGPNIGDPYCDIDVKIADLGNACWVNHHYTDDIQTRQYRALEVLIGSGYGPPADIWSTACMAFELATGDYLFEPHQGDNYSRDEDHLAHISELLGAIPPSIYKKGKHWREFFHKNGHLLHIHQLKPWSLYEVLRQKYEWSHEDAQQFESFLRPMLDFDQEKRSTAKIALKHPFL 520          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: spk-1 (Serine/threonine-protein kinase spk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03563])

HSP 1 Score: 286.574 bits (732), Expect = 3.914e-84
Identity = 133/209 (63.64%), Postives = 161/209 (77.03%), Query Frame = 2
Query:  266 NEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAP 892
             E LGSD+EEQEDP+DY +GGYHPV +G V+N RYHV+RKLGWGHFSTVWL WD ++KRFVAMK+VKSA HYTE A DEIKLL  VR ADP      + VQL+D+F VTGING HV MVFEVLGCNLLKLII+SNYRG+  + VR I RQ LE L Y+H KC IIHTDIKPEN+L+ +S   ++ +A  A+  ++  + +  S+VSTAP
Sbjct:  100 GEQLGSDDEEQEDPRDYKRGGYHPVNIGDVFNARYHVIRKLGWGHFSTVWLAWDTQDKRFVAMKIVKSAEHYTEAALDEIKLLLSVRSADPNDIGCHKVVQLLDEFTVTGINGQHVAMVFEVLGCNLLKLIIRSNYRGLHLEQVRKICRQVLEALGYMHEKCGIIHTDIKPENVLITMSREEIKIMAQHAVVARKMNMKMSGSAVSTAP 308          

HSP 2 Score: 252.292 bits (643), Expect = 7.830e-72
Identity = 116/180 (64.44%), Postives = 135/180 (75.00%), Query Frame = 2
Query: 1712 LLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            +L  P   P+     C I VKIADLGNACW  HH+T+DIQTRQYRALEVLIG+GYG PADIWSTACMAFELATGDYLFEPH GD+YSRD+DHLAH+ ELLG IP  I   G++ R+FF K G L HIH L PW LY VLR+KY+WS   A+ F  FL PML +D ++R TA   L+HP+L
Sbjct:  437 ILPAPPVGPNIGDPYCDIDVKIADLGNACWVNHHYTDDIQTRQYRALEVLIGSGYGPPADIWSTACMAFELATGDYLFEPHQGDNYSRDEDHLAHISELLGAIPPSIYKKGKHWREFFHKNGHLLHIHQLKPWSLYEVLRQKYEWSHEDAQQFESFLRPMLDFDQEKRSTAKIALKHPFL 616          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: SRPK (gene:FBgn0286813 transcript:FBtr0087384)

HSP 1 Score: 305.064 bits (780), Expect = 3.037e-90
Identity = 138/207 (66.67%), Postives = 166/207 (80.19%), Query Frame = 2
Query:  281 SDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKEF 901
            SD E+QE  +DYCKGGYHPV +G +++DRYHV+RKLGWGHFSTVWLCWDL+   +VA+K+VKSA H+ ETA DEIK+LK VRE DP++  R +TVQ++DDF++TG+NGTH+CMVFEVLG NLLKLI KSNYRGIP  NV+TI RQ LEGL YLHT C+IIHTDIKPEN+LLCV + HVR LA EA         +  S VS APKE+
Sbjct:  141 SDNEDQELMEDYCKGGYHPVNIGDLFHDRYHVIRKLGWGHFSTVWLCWDLQAMGYVAIKIVKSAPHFAETARDEIKILKTVRETDPSNPRRHKTVQMLDDFKITGVNGTHICMVFEVLGDNLLKLIRKSNYRGIPLANVKTITRQVLEGLDYLHTCCKIIHTDIKPENVLLCVDEPHVRSLATEATQLYCMNSKMYPSLVSRAPKEY 347          

HSP 2 Score: 261.922 bits (668), Expect = 1.328e-74
Identity = 124/206 (60.19%), Postives = 146/206 (70.87%), Query Frame = 2
Query: 1655 SGATGNTDSALKAGDRRSILLDQPI-------SEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            SG+  NT SA       S L   P        ++ DP+ + C + VKIADLGNACW   HFTEDIQTRQYR+LEV+IGAGY T ADIWSTACM FELATGDYLFEPHSG+ Y+RD+DHLAH+IELLGPIPR I L+G Y+   FT+  ELR+I  L PW L  VL EKY+WS + A +F  FL PML +D  +R TA +CLQHPWL
Sbjct:  558 SGSVENTSSATNGPHSNSTLPTPPPPPQAKHKAKKDPALDECNVHVKIADLGNACWVDRHFTEDIQTRQYRSLEVIIGAGYNTSADIWSTACMVFELATGDYLFEPHSGESYTRDEDHLAHIIELLGPIPREILLNGTYAAKSFTRSCELRNISGLKPWGLMDVLLEKYEWSQKDAASFASFLTPMLEFDPNKRATAAECLQHPWL 763          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: SRPK (gene:FBgn0286813 transcript:FBtr0087383)

HSP 1 Score: 305.064 bits (780), Expect = 3.037e-90
Identity = 138/207 (66.67%), Postives = 166/207 (80.19%), Query Frame = 2
Query:  281 SDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKEF 901
            SD E+QE  +DYCKGGYHPV +G +++DRYHV+RKLGWGHFSTVWLCWDL+   +VA+K+VKSA H+ ETA DEIK+LK VRE DP++  R +TVQ++DDF++TG+NGTH+CMVFEVLG NLLKLI KSNYRGIP  NV+TI RQ LEGL YLHT C+IIHTDIKPEN+LLCV + HVR LA EA         +  S VS APKE+
Sbjct:  141 SDNEDQELMEDYCKGGYHPVNIGDLFHDRYHVIRKLGWGHFSTVWLCWDLQAMGYVAIKIVKSAPHFAETARDEIKILKTVRETDPSNPRRHKTVQMLDDFKITGVNGTHICMVFEVLGDNLLKLIRKSNYRGIPLANVKTITRQVLEGLDYLHTCCKIIHTDIKPENVLLCVDEPHVRSLATEATQLYCMNSKMYPSLVSRAPKEY 347          

HSP 2 Score: 261.922 bits (668), Expect = 1.328e-74
Identity = 124/206 (60.19%), Postives = 146/206 (70.87%), Query Frame = 2
Query: 1655 SGATGNTDSALKAGDRRSILLDQPI-------SEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            SG+  NT SA       S L   P        ++ DP+ + C + VKIADLGNACW   HFTEDIQTRQYR+LEV+IGAGY T ADIWSTACM FELATGDYLFEPHSG+ Y+RD+DHLAH+IELLGPIPR I L+G Y+   FT+  ELR+I  L PW L  VL EKY+WS + A +F  FL PML +D  +R TA +CLQHPWL
Sbjct:  558 SGSVENTSSATNGPHSNSTLPTPPPPPQAKHKAKKDPALDECNVHVKIADLGNACWVDRHFTEDIQTRQYRSLEVIIGAGYNTSADIWSTACMVFELATGDYLFEPHSGESYTRDEDHLAHIIELLGPIPREILLNGTYAAKSFTRSCELRNISGLKPWGLMDVLLEKYEWSQKDAASFASFLTPMLEFDPNKRATAAECLQHPWL 763          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: SRPK (gene:FBgn0286813 transcript:FBtr0330628)

HSP 1 Score: 305.449 bits (781), Expect = 6.705e-89
Identity = 138/207 (66.67%), Postives = 166/207 (80.19%), Query Frame = 2
Query:  281 SDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKEF 901
            SD E+QE  +DYCKGGYHPV +G +++DRYHV+RKLGWGHFSTVWLCWDL+   +VA+K+VKSA H+ ETA DEIK+LK VRE DP++  R +TVQ++DDF++TG+NGTH+CMVFEVLG NLLKLI KSNYRGIP  NV+TI RQ LEGL YLHT C+IIHTDIKPEN+LLCV + HVR LA EA         +  S VS APKE+
Sbjct:  141 SDNEDQELMEDYCKGGYHPVNIGDLFHDRYHVIRKLGWGHFSTVWLCWDLQAMGYVAIKIVKSAPHFAETARDEIKILKTVRETDPSNPRRHKTVQMLDDFKITGVNGTHICMVFEVLGDNLLKLIRKSNYRGIPLANVKTITRQVLEGLDYLHTCCKIIHTDIKPENVLLCVDEPHVRSLATEATQLYCMNSKMYPSLVSRAPKEY 347          

HSP 2 Score: 263.462 bits (672), Expect = 6.244e-74
Identity = 125/210 (59.52%), Postives = 148/210 (70.48%), Query Frame = 2
Query: 1655 SGATGNTDSALKAGDRRSILLDQPI-------SEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNTDS 2263
            SG+  NT SA       S L   P        ++ DP+ + C + VKIADLGNACW   HFTEDIQTRQYR+LEV+IGAGY T ADIWSTACM FELATGDYLFEPHSG+ Y+RD+DHLAH+IELLGPIPR I L+G Y+   FT+  ELR+I  L PW L  VL EKY+WS + A +F  FL PML +D  +R TA +CLQHPWL  D+
Sbjct:  558 SGSVENTSSATNGPHSNSTLPTPPPPPQAKHKAKKDPALDECNVHVKIADLGNACWVDRHFTEDIQTRQYRSLEVIIGAGYNTSADIWSTACMVFELATGDYLFEPHSGESYTRDEDHLAHIIELLGPIPREILLNGTYAAKSFTRSCELRNISGLKPWGLMDVLLEKYEWSQKDAASFASFLTPMLEFDPNKRATAAECLQHPWLRXDT 767          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: SRPK (gene:FBgn0286813 transcript:FBtr0087385)

HSP 1 Score: 266.544 bits (680), Expect = 1.160e-77
Identity = 122/180 (67.78%), Postives = 144/180 (80.00%), Query Frame = 2
Query:  362 DRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKEF 901
            DRYHV+RKLGWGHFSTVWLCWDL+   +VA+K+VKSA H+ ETA DEIK+LK VRE DP++  R +TVQ++DDF++TG+NGTH+CMVFEVLG NLLKLI KSNYRGIP  NV+TI RQ LEGL YLHT C+IIHTDIKPEN+LLCV + HVR LA EA         +  S VS APKE+
Sbjct:   11 DRYHVIRKLGWGHFSTVWLCWDLQAMGYVAIKIVKSAPHFAETARDEIKILKTVRETDPSNPRRHKTVQMLDDFKITGVNGTHICMVFEVLGDNLLKLIRKSNYRGIPLANVKTITRQVLEGLDYLHTCCKIIHTDIKPENVLLCVDEPHVRSLATEATQLYCMNSKMYPSLVSRAPKEY 190          

HSP 2 Score: 260.381 bits (664), Expect = 1.678e-75
Identity = 124/206 (60.19%), Postives = 146/206 (70.87%), Query Frame = 2
Query: 1655 SGATGNTDSALKAGDRRSILLDQPI-------SEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            SG+  NT SA       S L   P        ++ DP+ + C + VKIADLGNACW   HFTEDIQTRQYR+LEV+IGAGY T ADIWSTACM FELATGDYLFEPHSG+ Y+RD+DHLAH+IELLGPIPR I L+G Y+   FT+  ELR+I  L PW L  VL EKY+WS + A +F  FL PML +D  +R TA +CLQHPWL
Sbjct:  401 SGSVENTSSATNGPHSNSTLPTPPPPPQAKHKAKKDPALDECNVHVKIADLGNACWVDRHFTEDIQTRQYRSLEVIIGAGYNTSADIWSTACMVFELATGDYLFEPHSGESYTRDEDHLAHIIELLGPIPREILLNGTYAAKSFTRSCELRNISGLKPWGLMDVLLEKYEWSQKDAASFASFLTPMLEFDPNKRATAAECLQHPWL 606          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Srpk79D (gene:FBgn0025702 transcript:FBtr0304724)

HSP 1 Score: 252.677 bits (644), Expect = 5.187e-71
Identity = 111/184 (60.33%), Postives = 145/184 (78.80%), Query Frame = 2
Query:  257 NESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDS 808
            + S+  L   +EEQED   YC+GGYHPV +G ++++R+ VVRKLGWGHFSTVWLC DLK++++VA+KVVKSA HY ETA DEI+LL+ +R+ADP    R+R V+L++ F V G+NG H C+VFE LGC+L KLI+K+NY+G+    VR IIRQ LEGL YLH+KC IIHTDIKPENILL + ++
Sbjct:  310 DSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNA 493          

HSP 2 Score: 241.121 bits (614), Expect = 6.232e-67
Identity = 103/163 (63.19%), Postives = 130/163 (79.75%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            ++VKIADLGNAC+ +HHFTEDIQTRQYR++EVL+GA Y   ADIWSTAC+AFELATGDYLF+PH+G+ YSRD+DHLAH++ELLG IP+ +   G++   +FT  G LR+I  L PW L +VL EKYDW P  A+ F++FLLPML Y+   R +A +CLQHPWL
Sbjct:  648 VRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 810          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: srpk3 (SRSF protein kinase 3 [Source:ZFIN;Acc:ZDB-GENE-101025-2])

HSP 1 Score: 316.235 bits (809), Expect = 3.414e-100
Identity = 146/207 (70.53%), Postives = 172/207 (83.09%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTA 889
            E+LGSD+EEQE+P DYCKGGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWDL+ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP    R+R VQLIDDF+++G+NG HVCMV EVLG  LLK IIKSNY G+P   V++I+RQ LEGL YLHTKC+IIHTDIKPENILL V++ +VRRLAAEA   Q+ G P  + S  T 
Sbjct:   62 ELLGSDDEEQENPSDYCKGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDLQRKRFVALKVVKSAQHYTETALDEIKLLKCVRDSDPTDSKRERLVQLIDDFKISGVNGVHVCMVLEVLGHQLLKWIIKSNYMGLPLICVKSILRQVLEGLDYLHTKCKIIHTDIKPENILLEVNEVYVRRLAAEATIWQKAGAPPPSGSSGTV 268          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: srpk3 (SRSF protein kinase 3 [Source:ZFIN;Acc:ZDB-GENE-101025-2])

HSP 1 Score: 325.479 bits (833), Expect = 3.533e-98
Identity = 152/211 (72.04%), Postives = 178/211 (84.36%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPKE 898
            E+LGSD+EEQE+P DYCKGGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWDL+ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP    R+R VQLIDDF+++G+NG HVCMV EVLG  LLK IIKSNY G+P   V++I+RQ LEGL YLHTKC+IIHTDIKPENILL V++ +VRRLAAEA   Q+ G  P   SSVSTAP+E
Sbjct:  178 ELLGSDDEEQENPSDYCKGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDLQRKRFVALKVVKSAQHYTETALDEIKLLKCVRDSDPTDSKRERLVQLIDDFKISGVNGVHVCMVLEVLGHQLLKWIIKSNYMGLPLICVKSILRQVLEGLDYLHTKCKIIHTDIKPENILLEVNEVYVRRLAAEATIWQKAGAPPPSGSSVSTAPRE 388          

HSP 2 Score: 269.24 bits (687), Expect = 1.748e-77
Identity = 118/165 (71.52%), Postives = 137/165 (83.03%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            I +KIADLGNACW   HFTEDIQTRQYRALEVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DY+RD+DH+AH+IELLG IP H ALSGRYSR++F ++GELRHI NL PW L+ VL EKY+W    A  F++FLL ML +  ++R TA  CLQHPW+N+
Sbjct:  546 ISIKIADLGNACWVHKHFTEDIQTRQYRALEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHIAHIIELLGAIPPHFALSGRYSREYFNRRGELRHIANLKPWGLFEVLLEKYEWPLDQAAQFSDFLLTMLEFIPEKRATAAQCLQHPWINS 710          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: srpk1b (SRSF protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-070112-2292])

HSP 1 Score: 311.227 bits (796), Expect = 2.241e-93
Identity = 145/212 (68.40%), Postives = 176/212 (83.02%), Query Frame = 2
Query:  260 ESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAP 892
            +  E+LGSD+EEQEDP DYCKGGYH VK+G ++N RYHV+RKLGWGHFSTVWL WD + KRFVAMKVVKSA HYTETA DEIKLLK VR  D     R++ VQL+DDF+++G+NGTHVCMVFEVLG +LLK IIKSNY+G+P   V++IIRQ L+GL YLHTKC+IIHTDIKPENIL+ V++++V+RLAAEA + Q+ G  P   S+VSTAP
Sbjct:   59 QDEEILGSDDEEQEDPNDYCKGGYHHVKIGDLFNGRYHVIRKLGWGHFSTVWLAWDTQGKRFVAMKVVKSAEHYTETALDEIKLLKAVRNTDQNDPSREKVVQLLDDFKISGVNGTHVCMVFEVLGHHLLKWIIKSNYQGLPLPCVKSIIRQVLQGLDYLHTKCKIIHTDIKPENILMDVNEAYVKRLAAEATEWQKSGAPPPSGSAVSTAP 270          

HSP 2 Score: 263.848 bits (673), Expect = 4.614e-76
Identity = 116/165 (70.30%), Postives = 139/165 (84.24%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            IQVKIADLGNACW   HFT+DIQTRQYR+LEVLIG GYGTPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+A +IELLG IPR + ++G+YS++FFTKKG+LRHI  L PW L  VL EKY+W    A+NF++FLLPML    ++R TA +CL+H W+N+
Sbjct:  494 IQVKIADLGNACWVHKHFTDDIQTRQYRSLEVLIGTGYGTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIALIIELLGKIPRKLVMNGKYSKEFFTKKGDLRHITKLKPWGLQDVLVEKYEWHREEAQNFSDFLLPMLDLIPEKRATAAECLRHSWINS 658          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: srpk1a (SRSF protein kinase 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2399])

HSP 1 Score: 309.686 bits (792), Expect = 4.442e-93
Identity = 145/209 (69.38%), Postives = 173/209 (82.78%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAP 892
            E+LGSD+EEQEDP DYCKGGYH VK+G + N +YHV+RKLGWGHFSTVWL WD++ KRFVAMKVVKSA HYTETA DEIKLL+ VR  DP    R+  VQL+DDF+++G+NGTHVCMVFEVLG +LLK IIKSNY+G+P   V++IIRQ L+GL YLHTKC+IIHTDIKPENIL+ V + +VRRLAAEA + Q+ G  P   S+VSTAP
Sbjct:   49 EILGSDDEEQEDPNDYCKGGYHHVKIGDLLNSKYHVIRKLGWGHFSTVWLAWDIQGKRFVAMKVVKSAEHYTETALDEIKLLRSVRNTDPDDPNREMVVQLLDDFKISGVNGTHVCMVFEVLGHHLLKWIIKSNYQGLPLPCVKSIIRQVLQGLDYLHTKCQIIHTDIKPENILMSVEELYVRRLAAEATEWQKAGAPPPSGSAVSTAP 257          

HSP 2 Score: 246.514 bits (628), Expect = 3.943e-70
Identity = 112/163 (68.71%), Postives = 137/163 (84.05%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            I+VKIADLGNACW   HFTEDIQTRQYR+LEVL+G+GY TPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+A +IELLG +PR + L+G+YS++FF+KKG+L+HI  L PW L  VL +KY+W    A+ F++FLLPML    ++R TA DCL+HPWL
Sbjct:  470 IKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLLGSGYNTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIALIIELLGVVPRKLVLTGKYSKEFFSKKGDLKHITKLKPWGLLDVLMDKYEWPQEEAQTFSDFLLPMLELLPEKRATASDCLRHPWL 632          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: srpk1a (SRSF protein kinase 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2399])

HSP 1 Score: 309.301 bits (791), Expect = 5.627e-93
Identity = 145/209 (69.38%), Postives = 173/209 (82.78%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAP 892
            E+LGSD+EEQEDP DYCKGGYH VK+G + N +YHV+RKLGWGHFSTVWL WD++ KRFVAMKVVKSA HYTETA DEIKLL+ VR  DP    R+  VQL+DDF+++G+NGTHVCMVFEVLG +LLK IIKSNY+G+P   V++IIRQ L+GL YLHTKC+IIHTDIKPENIL+ V + +VRRLAAEA + Q+ G  P   S+VSTAP
Sbjct:   49 EILGSDDEEQEDPNDYCKGGYHHVKIGDLLNSKYHVIRKLGWGHFSTVWLAWDIQGKRFVAMKVVKSAEHYTETALDEIKLLRSVRNTDPDDPNREMVVQLLDDFKISGVNGTHVCMVFEVLGHHLLKWIIKSNYQGLPLPCVKSIIRQVLQGLDYLHTKCQIIHTDIKPENILMSVEELYVRRLAAEATEWQKAGAPPPSGSAVSTAP 257          

HSP 2 Score: 247.284 bits (630), Expect = 2.500e-70
Identity = 114/163 (69.94%), Postives = 137/163 (84.05%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            I+VKIADLGNACW   HFTEDIQTRQYR+LEVL+G+GY TPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DHLA +IELLG IPRH ALSG++S+++F +KG+L+HI  L PW L  VL +KY+W    A+ F++FLLPML    ++R TA DCL+HPWL
Sbjct:  470 IKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLLGSGYNTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHLALIIELLGHIPRHYALSGKFSQEYFCRKGDLKHITKLKPWGLLDVLMDKYEWPQEEAQTFSDFLLPMLELLPEKRATAADCLRHPWL 632          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: srpk2 (SRSF protein kinase 2 [Source:NCBI gene;Acc:100124819])

HSP 1 Score: 314.309 bits (804), Expect = 1.126e-94
Identity = 142/205 (69.27%), Postives = 173/205 (84.39%), Query Frame = 2
Query:  281 SDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAP 892
            SD EEQEDP DYC+GGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWDL+ KRFVA+KVVKSA+HYTETA DEIKLLKCVR++DP+   R+  VQLIDDF+++G+NG H+CMV EVLG  LLK IIKSNY G+P   V++I+RQ L+GL YLHTKC+IIHTDIKPENIL+CV + ++RRLAAEA   Q+ G+ P   S+VS+AP
Sbjct:   78 SDNEEQEDPGDYCRGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDLQRKRFVALKVVKSAVHYTETALDEIKLLKCVRDSDPSDSKREMIVQLIDDFKISGVNGVHICMVLEVLGHQLLKWIIKSNYEGVPLPCVKSILRQVLQGLDYLHTKCKIIHTDIKPENILMCVEEGYIRRLAAEATIWQQSGMPPPSGSAVSSAP 282          

HSP 2 Score: 279.641 bits (714), Expect = 7.178e-82
Identity = 124/165 (75.15%), Postives = 142/165 (86.06%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            IQVKIADLGNACW   HFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSG+DY+RD+DH+AH+IELLG IP H ALSGRYSR++F+++GELRHI NL  W L+ VL EKY+WS   A  FT+FL+PML +  ++R TA  CLQHPWLN+
Sbjct:  473 IQVKIADLGNACWVHKHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHIAHIIELLGDIPPHFALSGRYSREYFSRRGELRHIQNLKHWGLFDVLVEKYEWSLEEATQFTDFLMPMLEFLPEKRATASQCLQHPWLNS 637          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: srpk2 (SRSF protein kinase 2 [Source:NCBI gene;Acc:100124819])

HSP 1 Score: 310.071 bits (793), Expect = 6.246e-94
Identity = 137/194 (70.62%), Postives = 166/194 (85.57%), Query Frame = 2
Query:  281 SDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVP 862
            SD EEQEDP DYC+GGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWDL+ KRFVA+KVVKSA+HYTETA DEIKLLKCVR++DP+   R+  VQLIDDF+++G+NG H+CMV EVLG  LLK IIKSNY G+P   V++I+RQ L+GL YLHTKC+IIHTDIKPENIL+CV + ++RRLAAEA   Q+ G+P
Sbjct:   78 SDNEEQEDPGDYCRGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDLQRKRFVALKVVKSAVHYTETALDEIKLLKCVRDSDPSDSKREMIVQLIDDFKISGVNGVHICMVLEVLGHQLLKWIIKSNYEGVPLPCVKSILRQVLQGLDYLHTKCKIIHTDIKPENILMCVEEGYIRRLAAEATIWQQSGMP 271          

HSP 2 Score: 278.485 bits (711), Expect = 3.579e-82
Identity = 124/165 (75.15%), Postives = 142/165 (86.06%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            IQVKIADLGNACW   HFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSG+DY+RD+DH+AH+IELLG IP H ALSGRYSR++F+++GELRHI NL  W L+ VL EKY+WS   A  FT+FL+PML +  ++R TA  CLQHPWLN+
Sbjct:  399 IQVKIADLGNACWVHKHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHIAHIIELLGDIPPHFALSGRYSREYFSRRGELRHIQNLKHWGLFDVLVEKYEWSLEEATQFTDFLMPMLEFLPEKRATASQCLQHPWLNS 563          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: srpk2 (SRSF protein kinase 2 [Source:NCBI gene;Acc:100124819])

HSP 1 Score: 306.99 bits (785), Expect = 1.662e-93
Identity = 138/201 (68.66%), Postives = 168/201 (83.58%), Query Frame = 2
Query:  281 SDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVS 883
            SD EEQEDP DYC+GGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWDL+ KRFVA+KVVKSA+HYTETA DEIKLLKCVR++DP+   R+  VQLIDDF+++G+NG H+CMV EVLG  LLK IIKSNY G+P   V++I+RQ L+GL YLHTKC+IIHTDIKPENIL+CV + ++RRLAAEA   Q+ G+P  + S  
Sbjct:   35 SDNEEQEDPGDYCRGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDLQRKRFVALKVVKSAVHYTETALDEIKLLKCVRDSDPSDSKREMIVQLIDDFKISGVNGVHICMVLEVLGHQLLKWIIKSNYEGVPLPCVKSILRQVLQGLDYLHTKCKIIHTDIKPENILMCVEEGYIRRLAAEATIWQQSGMPPPSGSAG 235          

HSP 2 Score: 273.092 bits (697), Expect = 7.543e-81
Identity = 122/163 (74.85%), Postives = 140/163 (85.89%), Query Frame = 2
Query: 1769 VKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            VKIADLGNACW   HFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSG+DY+RD+DH+AH+IELLG IP H ALSGRYSR++F+++GELRHI NL  W L+ VL EKY+WS   A  FT+FL+PML +  ++R TA  CLQHPWLN+
Sbjct:  343 VKIADLGNACWVHKHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHIAHIIELLGDIPPHFALSGRYSREYFSRRGELRHIQNLKHWGLFDVLVEKYEWSLEEATQFTDFLMPMLEFLPEKRATASQCLQHPWLNS 505          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: srpk2 (SRSF protein kinase 2 [Source:NCBI gene;Acc:100124819])

HSP 1 Score: 306.99 bits (785), Expect = 1.666e-93
Identity = 138/201 (68.66%), Postives = 168/201 (83.58%), Query Frame = 2
Query:  281 SDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVS 883
            SD EEQEDP DYC+GGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWDL+ KRFVA+KVVKSA+HYTETA DEIKLLKCVR++DP+   R+  VQLIDDF+++G+NG H+CMV EVLG  LLK IIKSNY G+P   V++I+RQ L+GL YLHTKC+IIHTDIKPENIL+CV + ++RRLAAEA   Q+ G+P  + S  
Sbjct:   39 SDNEEQEDPGDYCRGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDLQRKRFVALKVVKSAVHYTETALDEIKLLKCVRDSDPSDSKREMIVQLIDDFKISGVNGVHICMVLEVLGHQLLKWIIKSNYEGVPLPCVKSILRQVLQGLDYLHTKCKIIHTDIKPENILMCVEEGYIRRLAAEATIWQQSGMPPPSGSAG 239          

HSP 2 Score: 276.559 bits (706), Expect = 3.854e-82
Identity = 124/165 (75.15%), Postives = 142/165 (86.06%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            IQVKIADLGNACW   HFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSG+DY+RD+DH+AH+IELLG IP H ALSGRYSR++F+++GELRHI NL  W L+ VL EKY+WS   A  FT+FL+PML +  ++R TA  CLQHPWLN+
Sbjct:  340 IQVKIADLGNACWVHKHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHIAHIIELLGDIPPHFALSGRYSREYFSRRGELRHIQNLKHWGLFDVLVEKYEWSLEEATQFTDFLMPMLEFLPEKRATASQCLQHPWLNS 504          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: srpk2 (SRSF protein kinase 2 [Source:NCBI gene;Acc:100124819])

HSP 1 Score: 306.99 bits (785), Expect = 2.076e-93
Identity = 137/194 (70.62%), Postives = 166/194 (85.57%), Query Frame = 2
Query:  281 SDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVP 862
            SD EEQEDP DYC+GGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWDL+ KRFVA+KVVKSA+HYTETA DEIKLLKCVR++DP+   R+  VQLIDDF+++G+NG H+CMV EVLG  LLK IIKSNY G+P   V++I+RQ L+GL YLHTKC+IIHTDIKPENIL+CV + ++RRLAAEA   Q+ G+P
Sbjct:   46 SDNEEQEDPGDYCRGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDLQRKRFVALKVVKSAVHYTETALDEIKLLKCVRDSDPSDSKREMIVQLIDDFKISGVNGVHICMVLEVLGHQLLKWIIKSNYEGVPLPCVKSILRQVLQGLDYLHTKCKIIHTDIKPENILMCVEEGYIRRLAAEATIWQQSGMP 239          

HSP 2 Score: 276.559 bits (706), Expect = 4.245e-82
Identity = 124/165 (75.15%), Postives = 142/165 (86.06%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            IQVKIADLGNACW   HFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSG+DY+RD+DH+AH+IELLG IP H ALSGRYSR++F+++GELRHI NL  W L+ VL EKY+WS   A  FT+FL+PML +  ++R TA  CLQHPWLN+
Sbjct:  347 IQVKIADLGNACWVHKHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHIAHIIELLGDIPPHFALSGRYSREYFSRRGELRHIQNLKHWGLFDVLVEKYEWSLEEATQFTDFLMPMLEFLPEKRATASQCLQHPWLNS 511          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Srpk2 (serine/arginine-rich protein specific kinase 2 [Source:MGI Symbol;Acc:MGI:1201408])

HSP 1 Score: 334.339 bits (856), Expect = 9.548e-102
Identity = 150/210 (71.43%), Postives = 183/210 (87.14%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPKE 898
            +LGSD+EEQEDP DYCKGGYHPVK+G ++N RYHV+RKLGWGHFSTVWLCWD++ KRFVAMKVVKSA HYTETA DEIKLLKCVRE+DP+   +D  VQLIDDF+++G+NG HVCMVFEVLG +LLK IIKSNY+G+P + V++IIRQ L+GL YLH+KC+IIHTDIKPENIL+CV D++VRR+AAEA + Q+ G  P   S+VSTAP++
Sbjct:   47 ILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQ 256          

HSP 2 Score: 275.018 bits (702), Expect = 7.801e-80
Identity = 135/231 (58.44%), Postives = 162/231 (70.13%), Query Frame = 2
Query: 1592 LKVTACSNC---ASKMFQSTNSDGSGATGNTDSALKAGD------RRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            L+  AC +     S + +   S  S     T SA   GD      R + LL  P+   +  K    I+VKIADLGNACW   HFTEDIQTRQYR++EVLIGAGY TPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH+IELLG IPRH ALSG+YSR+FF ++GELRHI  L PW L+ VL EKY W    A  FT+FL+PML    ++R +A +CL+HPWLN+
Sbjct:  456 LEPVACGSVISEGSPLTEQEESSPSHDRSRTVSASSTGDLPKTKTRAADLLVNPLDPRNADK----IRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS 682          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Srpk3 (serine/arginine-rich protein specific kinase 3 [Source:MGI Symbol;Acc:MGI:1891338])

HSP 1 Score: 328.561 bits (841), Expect = 6.295e-101
Identity = 151/210 (71.90%), Postives = 180/210 (85.71%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPKE 898
            +LGSD+EEQEDPKDYCKGGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWD++ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP+   R+  VQLIDDFR++G+NG HVCMV EVLG  LLK IIKSNY+G+P   V++I+RQ L GL YLHTKC+IIHTDIKPENILLCV D+++RRLAAEA + Q+ G  P   S+VSTAP+E
Sbjct:   46 LLGSDDEEQEDPKDYCKGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQSGAQPPSRSTVSTAPQE 255          

HSP 2 Score: 267.7 bits (683), Expect = 2.191e-78
Identity = 130/223 (58.30%), Postives = 157/223 (70.40%), Query Frame = 2
Query: 1586 TLLKVTACSNCASKMFQSTNSDGSGATGNTDSALKAGDRRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            +L    +CS  +     S+N   +G   +  +   A +    LL  P+   +  K    I++KIADLGNACW   HFTEDIQTRQYRA+EVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH++ELLG IP   ALSGRYSR+FF ++GELRHI NL  W LY VL EKY+W    A  F+ FLLPM+ Y  ++R +A DCLQHPWLN
Sbjct:  354 SLFSTASCSILSG----SSNQRETGGLLSPSTPFGASN----LLVNPLEPQNADK----IKIKIADLGNACWVHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIPNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLN 564          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Srpk1 (serine/arginine-rich protein specific kinase 1 [Source:MGI Symbol;Acc:MGI:106908])

HSP 1 Score: 308.531 bits (789), Expect = 3.231e-97
Identity = 143/213 (67.14%), Postives = 176/213 (82.63%), Query Frame = 2
Query:  260 ESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPK 895
            +  E+LGSD++EQEDP DYCKGGYH VK+G ++N RYHV+RKLGWGHFSTVWL WD++ K+FVAMKVVKSA HYTETA DEI+LLK VR +DP     +  VQL+DDF+++G+NGTH+CMVFEVLG +LLK IIKSNY+G+P   V+ II+Q L+GL YLHTKCRIIHTDIKPENILL V++ ++RRLAAEA + QR G  P   S+VSTAP+
Sbjct:   44 QEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNGEMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPQ 256          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Srpk1 (serine/arginine-rich protein specific kinase 1 [Source:MGI Symbol;Acc:MGI:106908])

HSP 1 Score: 305.064 bits (780), Expect = 1.378e-95
Identity = 139/209 (66.51%), Postives = 171/209 (81.82%), Query Frame = 2
Query:  260 ESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVST 886
            +  E+LGSD++EQEDP DYCKGGYH VK+G ++N RYHV+RKLGWGHFSTVWL WD++ K+FVAMKVVKSA HYTETA DEI+LLK VR +DP     +  VQL+DDF+++G+NGTH+CMVFEVLG +LLK IIKSNY+G+P   V+ II+Q L+GL YLHTKCRIIHTDIKPENILL V++ ++RRLAAEA + QR G P  + S  T
Sbjct:   44 QEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNGEMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQRSGAPPPSGSAGT 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Srpk1 (serine/arginine-rich protein specific kinase 1 [Source:MGI Symbol;Acc:MGI:106908])

HSP 1 Score: 310.842 bits (795), Expect = 2.758e-93
Identity = 143/213 (67.14%), Postives = 176/213 (82.63%), Query Frame = 2
Query:  260 ESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPK 895
            +  E+LGSD++EQEDP DYCKGGYH VK+G ++N RYHV+RKLGWGHFSTVWL WD++ K+FVAMKVVKSA HYTETA DEI+LLK VR +DP     +  VQL+DDF+++G+NGTH+CMVFEVLG +LLK IIKSNY+G+P   V+ II+Q L+GL YLHTKCRIIHTDIKPENILL V++ ++RRLAAEA + QR G  P   S+VSTAP+
Sbjct:   44 QEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNGEMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPQ 256          

HSP 2 Score: 264.618 bits (675), Expect = 2.382e-76
Identity = 114/165 (69.09%), Postives = 138/165 (83.64%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            +QVKIADLGNACW   HFTEDIQTRQYR+LEVLIG+GY TPADIWSTACMAFELATGDYLFEPHSG+DY+RD+DH+A +IELLG +PR + ++G+YS++FFTKKG+L+HI  L PW L  VL EKY+W    A  FT+FLLPML    ++R TA +CL+HPWLN+
Sbjct:  484 LQVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLLEVLVEKYEWPQEEAAGFTDFLLPMLELMPEKRATAAECLRHPWLNS 648          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O54781|SRPK2_MOUSE (SRSF protein kinase 2 OS=Mus musculus OX=10090 GN=Srpk2 PE=1 SV=2)

HSP 1 Score: 334.339 bits (856), Expect = 5.994e-101
Identity = 150/210 (71.43%), Postives = 183/210 (87.14%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPKE 898
            +LGSD+EEQEDP DYCKGGYHPVK+G ++N RYHV+RKLGWGHFSTVWLCWD++ KRFVAMKVVKSA HYTETA DEIKLLKCVRE+DP+   +D  VQLIDDF+++G+NG HVCMVFEVLG +LLK IIKSNY+G+P + V++IIRQ L+GL YLH+KC+IIHTDIKPENIL+CV D++VRR+AAEA + Q+ G  P   S+VSTAP++
Sbjct:   47 ILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQ 256          

HSP 2 Score: 275.018 bits (702), Expect = 4.977e-79
Identity = 135/231 (58.44%), Postives = 162/231 (70.13%), Query Frame = 2
Query: 1592 LKVTACSNC---ASKMFQSTNSDGSGATGNTDSALKAGD------RRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            L+  AC +     S + +   S  S     T SA   GD      R + LL  P+   +  K    I+VKIADLGNACW   HFTEDIQTRQYR++EVLIGAGY TPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH+IELLG IPRH ALSG+YSR+FF ++GELRHI  L PW L+ VL EKY W    A  FT+FL+PML    ++R +A +CL+HPWLN+
Sbjct:  455 LEPVACGSVISEGSPLTEQEESSPSHDRSRTVSASSTGDLPKTKTRAADLLVNPLDPRNADK----IRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS 681          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UPE1|SRPK3_HUMAN (SRSF protein kinase 3 OS=Homo sapiens OX=9606 GN=SRPK3 PE=1 SV=2)

HSP 1 Score: 330.872 bits (847), Expect = 7.624e-101
Identity = 153/210 (72.86%), Postives = 180/210 (85.71%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASS-VSTAPKE 898
            +LGSD+EEQEDPKDYCKGGYHPVK+G V+N RYHVVRKLGWGHFSTVWLCWD++ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP+   R+  VQLIDDFR++G+NG HVCMV EVLG  LLK IIKSNY+G+P   V++I+RQ L GL YLHTKC+IIHTDIKPENILLCV D+++RRLAAEA + Q+ G P  + S VSTAP+E
Sbjct:   47 LLGSDDEEQEDPKDYCKGGYHPVKIGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQE 256          

HSP 2 Score: 270.011 bits (689), Expect = 2.044e-78
Identity = 120/164 (73.17%), Postives = 137/164 (83.54%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            I++KIADLGNACW   HFTEDIQTRQYRA+EVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH++ELLG IP   ALSGRYSR+FF ++GELRHIHNL  W LY VL EKY+W    A  F+ FLLPM+ Y  ++R +A DCLQHPWLN
Sbjct:  403 IKIKIADLGNACWVHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLN 566          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P78362|SRPK2_HUMAN (SRSF protein kinase 2 OS=Homo sapiens OX=9606 GN=SRPK2 PE=1 SV=3)

HSP 1 Score: 333.569 bits (854), Expect = 1.507e-100
Identity = 150/210 (71.43%), Postives = 183/210 (87.14%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPKE 898
            +LGSD+EEQEDP DYCKGGYHPVK+G ++N RYHV+RKLGWGHFSTVWLCWD++ KRFVAMKVVKSA HYTETA DEIKLLKCVRE+DP+   +D  VQLIDDF+++G+NG HVCMVFEVLG +LLK IIKSNY+G+P + V++IIRQ L+GL YLH+KC+IIHTDIKPENIL+CV D++VRR+AAEA + Q+ G  P   S+VSTAP++
Sbjct:   49 ILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQ 258          

HSP 2 Score: 275.018 bits (702), Expect = 5.448e-79
Identity = 139/241 (57.68%), Postives = 167/241 (69.29%), Query Frame = 2
Query: 1562 FSTIVHPETLLKVTACSNC---ASKMFQSTNSDGSGATGNTDSALKAGD------RRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            FST +   +L  V AC +     S + +   S  S     T SA   GD      R + LL  P+   +  K    I+VKIADLGNACW   HFTEDIQTRQYR++EVLIGAGY TPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH+IELLG IPRH ALSG+YSR+FF ++GELRHI  L PW L+ VL EKY W    A  FT+FL+PML    ++R +A +CL+HPWLN+
Sbjct:  453 FSTSLFSGSLEPV-ACGSVLSEGSPLTEQEESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPLDPRNADK----IRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS 688          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Z0G2|SRPK3_MOUSE (SRSF protein kinase 3 OS=Mus musculus OX=10090 GN=Srpk3 PE=1 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 4.403e-100
Identity = 151/210 (71.90%), Postives = 180/210 (85.71%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPKE 898
            +LGSD+EEQEDPKDYCKGGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWD++ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP+   R+  VQLIDDFR++G+NG HVCMV EVLG  LLK IIKSNY+G+P   V++I+RQ L GL YLHTKC+IIHTDIKPENILLCV D+++RRLAAEA + Q+ G  P   S+VSTAP+E
Sbjct:   46 LLGSDDEEQEDPKDYCKGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQSGAQPPSRSTVSTAPQE 255          

HSP 2 Score: 267.7 bits (683), Expect = 1.533e-77
Identity = 130/223 (58.30%), Postives = 157/223 (70.40%), Query Frame = 2
Query: 1586 TLLKVTACSNCASKMFQSTNSDGSGATGNTDSALKAGDRRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            +L    +CS  +     S+N   +G   +  +   A +    LL  P+   +  K    I++KIADLGNACW   HFTEDIQTRQYRA+EVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH++ELLG IP   ALSGRYSR+FF ++GELRHI NL  W LY VL EKY+W    A  F+ FLLPM+ Y  ++R +A DCLQHPWLN
Sbjct:  354 SLFSTASCSILSG----SSNQRETGGLLSPSTPFGASN----LLVNPLEPQNADK----IKIKIADLGNACWVHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIPNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLN 564          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|B8Y466|SRPK3_PIG (SRSF protein kinase 3 OS=Sus scrofa OX=9823 GN=SRPK3 PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 8.900e-100
Identity = 151/210 (71.90%), Postives = 181/210 (86.19%), Query Frame = 2
Query:  272 VLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMA-SSVSTAPKE 898
            +LGSD+EEQEDPKDYCKGGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWD++ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP+   R+  VQLIDDFR++G+NG HVCMV EVLG  LLK IIKSNY+G+P   V++I+RQ L GL YLHTKC+IIHTDIKPENILLCV D+++RRLAAEA + Q+ G P  + S+VSTAP+E
Sbjct:   47 LLGSDDEEQEDPKDYCKGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQSGAPPPSRSTVSTAPQE 256          

HSP 2 Score: 267.314 bits (682), Expect = 2.552e-77
Identity = 119/164 (72.56%), Postives = 136/164 (82.93%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            I++KIADLGNACW   HFTE IQTRQYRA+EVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH++ELLG IP   ALSGRYSR+FF ++GELRHIHNL  W LY VL EKY+W    A  F+ FLLPM+ Y  ++R +A DCLQHPWLN
Sbjct:  402 IRIKIADLGNACWVHKHFTEGIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLN 565          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A3S5AL72 (Protein kinase domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS12804 PE=3 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 1.121e-113
Identity = 163/211 (77.25%), Postives = 194/211 (91.94%), Query Frame = 2
Query:  266 NEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKE 898
            NEVLGSD++EQEDP+DYCK GYHPVK+GQVYN RYHVVRKLGWGHFSTVWLCWDL+ KRFVAMK+VKSA+HYTETA DEI+LL CVR++DP+  FR RTVQL+DDFRV+G+N   VCM+FE+LG NLLKLII+S+YRGIP +NVR+II+QTL+GLHYLHTKC+IIHTDIKPEN+L+CVSD++VRRLAAEA+D QRRG+ L  S+VSTAPK+
Sbjct:   22 NEVLGSDDDEQEDPRDYCKDGYHPVKIGQVYNSRYHVVRKLGWGHFSTVWLCWDLQAKRFVAMKIVKSALHYTETALDEIRLLTCVRDSDPSDPFRQRTVQLLDDFRVSGLND--VCMIFEILGHNLLKLIIRSSYRGIPLENVRSIIKQTLQGLHYLHTKCQIIHTDIKPENVLVCVSDAYVRRLAAEAIDAQRRGIQLSGSAVSTAPKD 230          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A4Z2CUX2 (SRSF protein kinase 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_007400 PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 4.180e-111
Identity = 168/210 (80.00%), Postives = 191/210 (90.95%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKE 898
            E+LGSD++EQEDP+DYCKGGYHPVK+GQVYN RYHVVRKLGWGHFSTVWLCWDL  KRFVAMKVVKSA+HYTETA DEIKLL CVRE+ P   FR++TVQL+DDFRV+G+NG HVCM+FEVLG NLLKLII+S YRGIP +NVR+II+QTL+GLHYLHTKC IIHTDIKPENIL+C+SDS +RR+AAEALD QRRGV L  S+VSTAPKE
Sbjct:   39 EILGSDDDEQEDPRDYCKGGYHPVKIGQVYNSRYHVVRKLGWGHFSTVWLCWDLCSKRFVAMKVVKSALHYTETALDEIKLLSCVRESAPDDPFRNKTVQLLDDFRVSGVNGNHVCMIFEVLGHNLLKLIIRSQYRGIPLENVRSIIKQTLQGLHYLHTKCHIIHTDIKPENILVCISDSQIRRMAAEALDAQRRGVQLSGSAVSTAPKE 248          

HSP 2 Score: 317.775 bits (813), Expect = 3.239e-90
Identity = 166/315 (52.70%), Postives = 193/315 (61.27%), Query Frame = 2
Query: 1466 KFRNHDNIISDSNEQPSTVPQEPVKMHLK-GNRFSTIVHPETLLKVTACS------NCASKM------------FQSTNSDG-----------SGATGNTDSALKAG-----------------------DRRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            K  +H     D  + P     EP K     G+R S IV P+ LL   A S       C SK             F S+ S+G           S +T  T++    G                        RRS+L D  I EPD SKE C I+VKIADLGNACWT+ HFTEDIQTRQYRALEVLIG+GYG PADIWSTACMAFELATGDYLFEPHSG+DY+RD+DHLAH+IELLGPIPR+IALSG+YSR++F K+  LRHI  L PW+L++VL EKYDW P  A  FT FL PMLAYD   R +AWDCLQH W+
Sbjct:  419 KLPDHSGAADDKADTPVASVTEPKKTSTTTGDRRSVIVQPDGLLAAAAASVMSDTNECTSKSLTNNNSTKVKSNFTSSKSNGTEGNQKKLNSESKSTSATNTTSCEGVNSKRLSLAAPPNNSVSSQSVSNKRRSLLFDTVIHEPDASKEPCDIEVKIADLGNACWTYRHFTEDIQTRQYRALEVLIGSGYGPPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHLAHIIELLGPIPRNIALSGKYSREYFDKRACLRHIRRLKPWNLFNVLTEKYDWPPNEAALFTSFLEPMLAYDPNRRASAWDCLQHSWI 733          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A4S2LMV8 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007624 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 5.610e-111
Identity = 171/210 (81.43%), Postives = 193/210 (91.90%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKE 898
            E+LGSD++EQEDP+DYCKGGYHPVK+GQVYN RYHVVRKLGWGHFSTVWLCWDL  KRFVAMKVVKSA+HYTETA DEIKLL CVRE+ P   FRD+TVQL+DDFRV+G+NG HVCMVFEVLG NLLKLII+S+YRGIP +NVR+II+QTL+GLHYLHTKC+IIHTDIKPENIL+CVSDS +RR+AAEALD QRRGV L  S+VSTAPKE
Sbjct:   69 EILGSDDDEQEDPRDYCKGGYHPVKIGQVYNGRYHVVRKLGWGHFSTVWLCWDLNIKRFVAMKVVKSALHYTETAIDEIKLLTCVRESAPEDPFRDKTVQLLDDFRVSGVNGQHVCMVFEVLGHNLLKLIIRSSYRGIPLENVRSIIKQTLQGLHYLHTKCQIIHTDIKPENILVCVSDSQIRRMAAEALDAQRRGVQLSGSAVSTAPKE 278          

HSP 2 Score: 320.087 bits (819), Expect = 2.268e-89
Identity = 140/184 (76.09%), Postives = 158/184 (85.87%), Query Frame = 2
Query: 1700 RRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            RRS+L +  ++EPDPSKEVC I VKIADLGNACWT+ HFTEDIQTRQYRALEVLIGAGYG PADIWSTACMAFELATGDYLFEPHSG+DY+RD+DHLAH+IELLGPIPR++ALSG+YSR++F K+  LRHI  L PW L++VL EKYDW    A  FT FL PMLAYD  ER TAWDCLQHPW+
Sbjct:  559 RRSLLFEPVVTEPDPSKEVCKIDVKIADLGNACWTYRHFTEDIQTRQYRALEVLIGAGYGPPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHLAHIIELLGPIPRNLALSGKYSREYFDKRACLRHIRRLKPWSLFNVLTEKYDWPANEAMQFTSFLEPMLAYDPNERATAWDCLQHPWI 742          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A074ZM97 (Protein kinase domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_05953 PE=4 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 1.492e-110
Identity = 171/210 (81.43%), Postives = 193/210 (91.90%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKE 898
            E+LGSD++EQEDP+DYCKGGYHPVK+GQVYN RYHVVRKLGWGHFSTVWLCWDL  KRFVAMKVVKSA+HYTETA DEIKLL CVRE+ P   FRD+TVQL+DDFRV+G+NG HVCMVFEVLG NLLKLII+S+YRGIP +NVR+II+QTL+GLHYLHTKC+IIHTDIKPENIL+CVSDS +RR+AAEALD QRRGV L  S+VSTAPKE
Sbjct:   34 EILGSDDDEQEDPRDYCKGGYHPVKIGQVYNGRYHVVRKLGWGHFSTVWLCWDLNIKRFVAMKVVKSALHYTETAIDEIKLLTCVRESAPEDPFRDKTVQLLDDFRVSGVNGQHVCMVFEVLGHNLLKLIIRSSYRGIPLENVRSIIKQTLQGLHYLHTKCQIIHTDIKPENILVCVSDSQIRRMAAEALDAQRRGVQLSGSAVSTAPKE 243          

HSP 2 Score: 323.939 bits (829), Expect = 3.460e-90
Identity = 141/185 (76.22%), Postives = 159/185 (85.95%), Query Frame = 2
Query: 1700 RRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            RRS+L +  ++EPDPSKEVC I VKIADLGNACWT+ HFTEDIQTRQYRALEVLIGAGYG PADIWSTACMAFELATGDYLFEPHSG+DY+RD+DHLAH+IELLGPIPR++ALSG+YSR++F K+  LRHI  L PW L++VL EKYDW P  A  FT FL PMLAYD  ER TAWDCLQHPW+ 
Sbjct:  682 RRSLLFEPVVTEPDPSKEVCKIDVKIADLGNACWTYRHFTEDIQTRQYRALEVLIGAGYGPPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHLAHIIELLGPIPRNLALSGKYSREYFDKRACLRHIRRLKPWSLFNVLTEKYDWPPNEAMQFTSFLEPMLAYDPNERATAWDCLQHPWIT 866          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A4S2LFN3 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007624 PE=4 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 3.418e-110
Identity = 171/210 (81.43%), Postives = 193/210 (91.90%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKE 898
            E+LGSD++EQEDP+DYCKGGYHPVK+GQVYN RYHVVRKLGWGHFSTVWLCWDL  KRFVAMKVVKSA+HYTETA DEIKLL CVRE+ P   FRD+TVQL+DDFRV+G+NG HVCMVFEVLG NLLKLII+S+YRGIP +NVR+II+QTL+GLHYLHTKC+IIHTDIKPENIL+CVSDS +RR+AAEALD QRRGV L  S+VSTAPKE
Sbjct:   69 EILGSDDDEQEDPRDYCKGGYHPVKIGQVYNGRYHVVRKLGWGHFSTVWLCWDLNIKRFVAMKVVKSALHYTETAIDEIKLLTCVRESAPEDPFRDKTVQLLDDFRVSGVNGQHVCMVFEVLGHNLLKLIIRSSYRGIPLENVRSIIKQTLQGLHYLHTKCQIIHTDIKPENILVCVSDSQIRRMAAEALDAQRRGVQLSGSAVSTAPKE 278          

HSP 2 Score: 320.472 bits (820), Expect = 8.324e-89
Identity = 140/185 (75.68%), Postives = 158/185 (85.41%), Query Frame = 2
Query: 1700 RRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            RRS+L +  ++EPDPSKEVC I VKIADLGNACWT+ HFTEDIQTRQYRALEVLIGAGYG PADIWSTACMAFELATGDYLFEPHSG+DY+RD+DHLAH+IELLGPIPR++ALSG+YSR++F K+  LRHI  L PW L++VL EKYDW    A  FT FL PMLAYD  ER TAWDCLQHPW+ 
Sbjct:  717 RRSLLFEPVVTEPDPSKEVCKIDVKIADLGNACWTYRHFTEDIQTRQYRALEVLIGAGYGPPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHLAHIIELLGPIPRNLALSGKYSREYFDKRACLRHIRRLKPWSLFNVLTEKYDWPANEAMQFTSFLEPMLAYDPNERATAWDCLQHPWIT 901          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: srpk3 (SRSF protein kinase 3 [Source:NCBI gene;Acc:103025375])

HSP 1 Score: 323.939 bits (829), Expect = 4.673e-97
Identity = 151/211 (71.56%), Postives = 177/211 (83.89%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPKE 898
            E+LGSD+EEQE+P DYC+GGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWDL+ KRFVA+KVVKSA HYTETA DEIKLLKCVR++DP    RD  VQLIDDF+++GING HVCMV EVLG  LLK IIKSNY G+P   V++I+RQ L+GL YLHTKC+IIHTDIKPENILL V+D +VRRLAAEA   Q+ G  P   SSVSTAP++
Sbjct:  226 ELLGSDDEEQENPADYCRGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDLQRKRFVALKVVKSAPHYTETALDEIKLLKCVRDSDPTDPKRDTVVQLIDDFKISGINGVHVCMVLEVLGHQLLKWIIKSNYMGMPLVCVKSILRQVLQGLDYLHTKCKIIHTDIKPENILLDVTDVYVRRLAAEATLWQKSGAPPPSGSSVSTAPRD 436          

HSP 2 Score: 270.011 bits (689), Expect = 2.027e-77
Identity = 138/237 (58.23%), Postives = 171/237 (72.15%), Query Frame = 2
Query: 1559 RFSTIVHPETLLKVTACSNCASKMFQSTNSDGSGATGNTDS--ALKAGDRRSI--LLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            RFS+   P + L  T+ S+  S   +S  S  SG +   DS  +L + +  S    L  P+ +P  + ++C   +KIADLGNACW   HFTEDIQTRQYRA+EVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DY+RD+DHLAHVIELLG IP H ALSGRYSR++F ++GELRHI NL PW L+ VL EKY+W    A  F++FLL ML ++ ++R TA  CLQHPWL++
Sbjct:  537 RFSS---PGSALSGTS-SSILSATSESALSTLSGYSTERDSQRSLSSPNNFSAADFLVNPL-DPQNADKIC---IKIADLGNACWVHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHLAHVIELLGAIPAHFALSGRYSREYFNRRGELRHISNLKPWGLFEVLLEKYEWPLEQAAQFSDFLLTMLEFEPEKRATAAQCLQHPWLSS 765          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: srpk1b (SRSF protein kinase 1-like [Source:NCBI gene;Acc:103045240])

HSP 1 Score: 319.316 bits (817), Expect = 1.551e-96
Identity = 147/209 (70.33%), Postives = 178/209 (85.17%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRG-VPLMASSVSTAP 892
            E+LGSD+EEQEDP DYCKGGYH VK+G ++N RYHV+RKLGWGHFSTVWL WD++ KRFVAMKVVKSA HYTETA DEIKLL+ VR +DP    R++ VQL+DDF+++G+NGTHVCMVFEVLG +LLK IIKSNY+G+P   V++IIRQ L+GL YLHTKC+IIHTDIKPENIL+ V+DS++RRLAAEA + Q+ G  P   S+VSTAP
Sbjct:   36 EILGSDDEEQEDPNDYCKGGYHHVKIGDLFNGRYHVIRKLGWGHFSTVWLAWDIQGKRFVAMKVVKSAEHYTETALDEIKLLRAVRNSDPNDPSREKVVQLLDDFKISGVNGTHVCMVFEVLGHHLLKWIIKSNYQGLPSPCVKSIIRQVLQGLDYLHTKCKIIHTDIKPENILMNVNDSYIRRLAAEATEWQKSGAAPPSGSAVSTAP 244          

HSP 2 Score: 260.766 bits (665), Expect = 5.484e-75
Identity = 115/165 (69.70%), Postives = 136/165 (82.42%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            IQVKIADLGNACW   HFT+DIQTRQYR+LEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+A +IELLG +PR +  +G+YS++FFTKKGELRHI  L PW L  VL EKY+W    A++F  FLLPML    ++R TA +CL+H W+ +
Sbjct:  496 IQVKIADLGNACWVHKHFTDDIQTRQYRSLEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIALIIELLGKVPRKLITNGKYSKEFFTKKGELRHITKLKPWGLLDVLVEKYEWQREEAQSFASFLLPMLDLIPEKRATAAECLRHAWITS 660          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: srpk1b (SRSF protein kinase 1-like [Source:NCBI gene;Acc:103045240])

HSP 1 Score: 319.316 bits (817), Expect = 1.963e-96
Identity = 147/209 (70.33%), Postives = 178/209 (85.17%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRG-VPLMASSVSTAP 892
            E+LGSD+EEQEDP DYCKGGYH VK+G ++N RYHV+RKLGWGHFSTVWL WD++ KRFVAMKVVKSA HYTETA DEIKLL+ VR +DP    R++ VQL+DDF+++G+NGTHVCMVFEVLG +LLK IIKSNY+G+P   V++IIRQ L+GL YLHTKC+IIHTDIKPENIL+ V+DS++RRLAAEA + Q+ G  P   S+VSTAP
Sbjct:   45 EILGSDDEEQEDPNDYCKGGYHHVKIGDLFNGRYHVIRKLGWGHFSTVWLAWDIQGKRFVAMKVVKSAEHYTETALDEIKLLRAVRNSDPNDPSREKVVQLLDDFKISGVNGTHVCMVFEVLGHHLLKWIIKSNYQGLPSPCVKSIIRQVLQGLDYLHTKCKIIHTDIKPENILMNVNDSYIRRLAAEATEWQKSGAAPPSGSAVSTAP 253          

HSP 2 Score: 260.381 bits (664), Expect = 8.251e-75
Identity = 115/165 (69.70%), Postives = 136/165 (82.42%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            IQVKIADLGNACW   HFT+DIQTRQYR+LEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+A +IELLG +PR +  +G+YS++FFTKKGELRHI  L PW L  VL EKY+W    A++F  FLLPML    ++R TA +CL+H W+ +
Sbjct:  505 IQVKIADLGNACWVHKHFTDDIQTRQYRSLEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIALIIELLGKVPRKLITNGKYSKEFFTKKGELRHITKLKPWGLLDVLVEKYEWQREEAQSFASFLLPMLDLIPEKRATAAECLRHAWITS 669          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: srpk1b (SRSF protein kinase 1-like [Source:NCBI gene;Acc:103045240])

HSP 1 Score: 319.316 bits (817), Expect = 1.963e-96
Identity = 147/209 (70.33%), Postives = 178/209 (85.17%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRG-VPLMASSVSTAP 892
            E+LGSD+EEQEDP DYCKGGYH VK+G ++N RYHV+RKLGWGHFSTVWL WD++ KRFVAMKVVKSA HYTETA DEIKLL+ VR +DP    R++ VQL+DDF+++G+NGTHVCMVFEVLG +LLK IIKSNY+G+P   V++IIRQ L+GL YLHTKC+IIHTDIKPENIL+ V+DS++RRLAAEA + Q+ G  P   S+VSTAP
Sbjct:   45 EILGSDDEEQEDPNDYCKGGYHHVKIGDLFNGRYHVIRKLGWGHFSTVWLAWDIQGKRFVAMKVVKSAEHYTETALDEIKLLRAVRNSDPNDPSREKVVQLLDDFKISGVNGTHVCMVFEVLGHHLLKWIIKSNYQGLPSPCVKSIIRQVLQGLDYLHTKCKIIHTDIKPENILMNVNDSYIRRLAAEATEWQKSGAAPPSGSAVSTAP 253          

HSP 2 Score: 260.381 bits (664), Expect = 8.251e-75
Identity = 115/165 (69.70%), Postives = 136/165 (82.42%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            IQVKIADLGNACW   HFT+DIQTRQYR+LEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+A +IELLG +PR +  +G+YS++FFTKKGELRHI  L PW L  VL EKY+W    A++F  FLLPML    ++R TA +CL+H W+ +
Sbjct:  505 IQVKIADLGNACWVHKHFTDDIQTRQYRSLEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIALIIELLGKVPRKLITNGKYSKEFFTKKGELRHITKLKPWGLLDVLVEKYEWQREEAQSFASFLLPMLDLIPEKRATAAECLRHAWITS 669          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: srpk1b (SRSF protein kinase 1-like [Source:NCBI gene;Acc:103045240])

HSP 1 Score: 319.316 bits (817), Expect = 2.301e-96
Identity = 147/209 (70.33%), Postives = 178/209 (85.17%), Query Frame = 2
Query:  269 EVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRG-VPLMASSVSTAP 892
            E+LGSD+EEQEDP DYCKGGYH VK+G ++N RYHV+RKLGWGHFSTVWL WD++ KRFVAMKVVKSA HYTETA DEIKLL+ VR +DP    R++ VQL+DDF+++G+NGTHVCMVFEVLG +LLK IIKSNY+G+P   V++IIRQ L+GL YLHTKC+IIHTDIKPENIL+ V+DS++RRLAAEA + Q+ G  P   S+VSTAP
Sbjct:   46 EILGSDDEEQEDPNDYCKGGYHHVKIGDLFNGRYHVIRKLGWGHFSTVWLAWDIQGKRFVAMKVVKSAEHYTETALDEIKLLRAVRNSDPNDPSREKVVQLLDDFKISGVNGTHVCMVFEVLGHHLLKWIIKSNYQGLPSPCVKSIIRQVLQGLDYLHTKCKIIHTDIKPENILMNVNDSYIRRLAAEATEWQKSGAAPPSGSAVSTAP 254          

HSP 2 Score: 259.996 bits (663), Expect = 1.159e-74
Identity = 115/165 (69.70%), Postives = 136/165 (82.42%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            IQVKIADLGNACW   HFT+DIQTRQYR+LEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+A +IELLG +PR +  +G+YS++FFTKKGELRHI  L PW L  VL EKY+W    A++F  FLLPML    ++R TA +CL+H W+ +
Sbjct:  506 IQVKIADLGNACWVHKHFTDDIQTRQYRSLEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIALIIELLGKVPRKLITNGKYSKEFFTKKGELRHITKLKPWGLLDVLVEKYEWQREEAQSFASFLLPMLDLIPEKRATAAECLRHAWITS 670          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: SRPK2 (SRSF protein kinase 2 [Source:HGNC Symbol;Acc:HGNC:11306])

HSP 1 Score: 325.094 bits (832), Expect = 1.269e-104
Identity = 153/219 (69.86%), Postives = 180/219 (82.19%), Query Frame = 2
Query:  257 NESNEVLGSDEEEQEDPKDYCK----GGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPKE 898
            +   E+LGSD+EEQEDP DYCK    GGYH VK+G ++N RYHVVRKLGWGHFSTVWLCWD+  KRFVAMKVVKSA HYTETA DEIKLLKCVR++DP    RD  V L+DDF++TG+NGTHVCMVFEVLG +LLK IIKS+Y+G+P   VR+II Q L+GL YLHTKC+IIHTDIKPENILLCV D++VRR+AAEA   Q++G  P   S+VSTAP+E
Sbjct:   19 SHQEEILGSDDEEQEDPNDYCKAHGAGGYHAVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDMMGKRFVAMKVVKSAQHYTETALDEIKLLKCVRDSDPCDSNRDMVVNLLDDFKITGVNGTHVCMVFEVLGHHLLKWIIKSSYQGLPTPCVRSIIHQVLQGLDYLHTKCKIIHTDIKPENILLCVDDAYVRRMAAEATQWQQQGAPPPSGSAVSTAPQE 237          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: srpk1b (SRSF protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-070112-2292])

HSP 1 Score: 254.603 bits (649), Expect = 1.993e-74
Identity = 125/220 (56.82%), Postives = 158/220 (71.82%), Query Frame = 2
Query:  251 ANNESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFS----TVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRR-GVPLMASSVSTAPK 895
             ++E   ++GSD+EEQEDP DY KGGYHPVK+G ++N RYHVVRKLGWGHFS     +     L E     +       H ++      +LLKCVR+ DP    R++ VQL+DDF+V+G+NG HVCMVFEVLG  LLK IIKSNY+G+P   V++II+Q L+GL YLHTKC+IIHTDIKPENILLCV D++VRRLAAEA   Q++ G P   S+VSTAP+
Sbjct:    8 GHSEPEGLVGSDDEEQEDPADYTKGGYHPVKIGDLFNGRYHVVRKLGWGHFSHRVALLGHAVSLDEHTRPPLTHAHGPTHNSQRPASSWRLLKCVRDGDPKDPNREKVVQLVDDFKVSGVNGLHVCMVFEVLGHQLLKWIIKSNYKGLPLPCVKSIIQQVLQGLDYLHTKCKIIHTDIKPENILLCVDDAYVRRLAAEATQWQQQGGPPPSGSAVSTAPQ 227          

HSP 2 Score: 181.8 bits (460), Expect = 6.651e-49
Identity = 80/105 (76.19%), Postives = 92/105 (87.62%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKG 2077
            + +KIADLGNACW   HFTEDIQTRQYRA EVLIGAGYG  ADIWSTACMAFELATGDYLFEPHSG+DY RD+DH+A + EL+G +PR  ALSG+YS++FFTK+G
Sbjct:  457 LTIKIADLGNACWVHKHFTEDIQTRQYRAPEVLIGAGYGVAADIWSTACMAFELATGDYLFEPHSGEDYCRDEDHIALITELMGRLPRKYALSGKYSKEFFTKQG 561          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 93.2041 bits (230), Expect = 7.650e-20
Identity = 58/177 (32.77%), Postives = 84/177 (47.46%), Query Frame = 2
Query: 1769 VKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVL-----REKYDWSPRAARNFT------------EFLLPMLAYDTKERVTAWDCLQHPW 2248
            +K+ D G++C+        IQ+R YRA EV++GA YG P D+WS  C+  EL TG  L     G+D   + D LA  +ELLG  P+ +   G+ SR+F + +G  R+       D   VL     R      P  +R               +FL   L ++  ER+T    L+HPW
Sbjct:  304 IKVIDFGSSCFEHQRVYTYIQSRFYRAPEVVLGARYGPPIDMWSLGCILAELLTGSPLL---PGED---EGDQLACAMELLGMPPQRLLAQGKRSRNFVSSRGHPRYCGVTEAPDGAVVLNAGRSRRGKPRGPPGSRELPAALRGCDDPLLLDFLRGCLEWEPSERLTPAQALRHPW 474          

HSP 2 Score: 90.5077 bits (223), Expect = 5.340e-19
Identity = 53/143 (37.06%), Postives = 81/143 (56.64%), Query Frame = 2
Query:  365 RYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILL 793
            RY V++ +G G F  V   +D K +  VA+K+V++   +   A +EI++L+ +R+ D  +      + L++ F   G    HVCM FE+L  NL +LI K+ ++G     VR      L+ L  LH + RIIH D+KPENILL
Sbjct:  161 RYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDRENSMN--IIHLLESFTFRG----HVCMTFELLSMNLYELIKKNKFQGFSLALVRKFAHSILQCLDTLH-RNRIIHCDLKPENILL 296          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 92.0485 bits (227), Expect = 3.212e-19
Identity = 55/171 (32.16%), Postives = 89/171 (52.05%), Query Frame = 2
Query:  338 VKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHT-KCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQ 847
            VK G+ + DRY +   +G G F  V   +D +E+ +VA+K++K+   +   A  E++LL+ + + D   K+    ++    FR       H+C+VFE+L  NL  L+  +N+RG+     R   +Q    L +L T +  IIH D+KPENILLC       ++      CQ
Sbjct:  152 VKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHQEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTDMKYYIVHLKRHFMFR------NHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQ 316          

HSP 2 Score: 75.0998 bits (183), Expect = 4.594e-14
Identity = 56/196 (28.57%), Postives = 86/196 (43.88%), Query Frame = 2
Query: 1769 VKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTK-----------KGELRHIHNLNPWDLYSVLREKYDWSPRAAR------------NFTEFLLPMLAYDTKERVTAWDCLQHPWL--NTDSPDDTDN 2281
            +KI D G++C       + IQ+R YR+ EVL+G  Y    D+WS  C+  E+ TG+ LF   SG   S + D +  ++E+LG  P H+      +R +F +           K   R         L+ ++  +    P   R             F + +L ML YD K R+T +  LQH +    TD   +T N
Sbjct:  306 IKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLF---SG---SNEVDQMNKIVEVLGLPPTHMLEQAPKARKYFERLSDGSWTVKKTKDSKREYKTAGSRKLHDIIGVE-SGGPGGRRMGEAGHTVADYLKFKDLILRMLDYDPKTRITPFYALQHNFFKKTTDEGTNTSN 494          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 87.4261 bits (215), Expect = 5.023e-18
Identity = 50/143 (34.97%), Postives = 82/143 (57.34%), Query Frame = 2
Query:  365 RYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILL 793
            RY V+R +G G F  V   +D +  ++VA+K+V++   +   A +EI++L+ +++ D  +      + +++ F        H+CM FE+L  NL +LI K+ ++G   + VR      L  L+ LH K RIIH D+KPENILL
Sbjct:  171 RYEVLRVIGKGSFGQVVKAYDHRTHQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKENTMN--VIHMLESFNFR----NHICMTFELLSMNLYELIKKNKFQGFSLQVVRKFAHSILLCLNALH-KNRIIHCDLKPENILL 306          

HSP 2 Score: 70.8626 bits (172), Expect = 6.848e-13
Identity = 54/176 (30.68%), Postives = 75/176 (42.61%), Query Frame = 2
Query: 1775 IADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVL-----REKYDWSPRAARN------------FTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            I D G++C+        IQ+R YRA     G  YG P D+WS  C+  EL TG  L     G+D   + D LA  +EL G  P  +    + +R FF+  G  R+           VL     R      P ++R+            F +FL   L +D   R+T    L+HPWL
Sbjct:  317 IIDFGSSCYEHQRVYTYIQSRFYRA----PGGRYGLPIDMWSLGCILAELLTGSPLL---PGED---EGDQLACAMELTGSPPARLLEQSKRARQFFSSLGHPRYCTVTTLPGGPVVLNGGRTRRGKLRGPPSSRDWTTALKGCDDHLFIDFLKKCLDWDPATRLTPSQALKHPWL 482          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SKY1 (SR protein kinase (SRPK); involved in regulating proteins involved in mRNA metabolism and cation homeostasis; similar to human SRPK1 [Source:SGD;Acc:S000004829])

HSP 1 Score: 197.208 bits (500), Expect = 3.348e-53
Identity = 88/163 (53.99%), Postives = 115/163 (70.55%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            IQ+KIADLGNACW   H+T  IQTR+YR+ EVL+GA +G  ADIWSTAC+ FEL TGD+LFEP  G  Y++DDDH+A +IELLG +P ++  +G+Y+R FF  +G LR+I  L  W L  VL EKY +S   A+  ++FL PML  D ++R  A   + HPWL
Sbjct:  544 IQIKIADLGNACWYDEHYTNSIQTREYRSPEVLLGAPWGCGADIWSTACLIFELITGDFLFEPDEGHSYTKDDDHIAQIIELLGELPSYLLRNGKYTRTFFNSRGLLRNISKLKFWPLEDVLTEKYKFSKDEAKEISDFLSPMLQLDPRKRADAGGLVNHPWL 706          

HSP 2 Score: 186.037 bits (471), Expect = 1.678e-49
Identity = 102/203 (50.25%), Postives = 125/203 (61.58%), Query Frame = 2
Query:  287 EEEQEDPKDYCKGGYHPVKLGQVYND-RYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHK---FRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVS 883
            E  +E  KDY  GGYHP   G+ Y D RY +VRKLGWGHFSTVWL  D+     VAMK+V+    YTE A DEIKLL+ V +AD   +     +  ++L+D F   G NG HV MVFEVLG NLL LI K  +RGIP   V+ I +Q L GL Y+H +C IIHTDIKPEN+L+ + D        EALD Q+R    +   VS
Sbjct:  130 ERNEESLKDYRPGGYHPAFKGEPYKDARYILVRKLGWGHFSTVWLAKDMVNNTHVAMKIVRGDKVYTEAAEDEIKLLQRVNDADNTKEDSMGANHILKLLDHFNHKGPNGVHVVMVFEVLGENLLALIKKYEHRGIPLIYVKQISKQLLLGLDYMHRRCGIIHTDIKPENVLMEIGDVEGIVQMVEALDKQKREAKRLQRHVS 332          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: YAK1 (Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose [Source:SGD;Acc:S000003677])

HSP 1 Score: 93.5893 bits (231), Expect = 5.541e-20
Identity = 56/155 (36.13%), Postives = 89/155 (57.42%), Query Frame = 2
Query:  344 LGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCV-READPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSD 805
            LG   N +Y V+  LG G F  V  C +L  K  +A+KVVKS   Y   +  E K+L+ + ++ DP +K     +++ D F    ++  H+C+VFE+L  NL +L+ ++ + G+  + +RT   Q L+ L  L  + ++IH D+KPENILLC  D
Sbjct:  361 LGVEQNRKYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTNK--HHFLRMYDSF----VHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLK-ESKLIHCDLKPENILLCAPD 508          

HSP 2 Score: 57.7658 bits (138), Expect = 7.339e-9
Identity = 33/102 (32.35%), Postives = 50/102 (49.02%), Query Frame = 2
Query: 1766 QVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTK 2071
            ++KI D G++C         IQ+R YRA E+++G  Y T  D+WS  C+  EL  G  +F   S      + + L  +I+ LG  P  +   G+ S  F  K
Sbjct:  511 ELKIIDFGSSCEEARTVYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGAS------EYNQLTRIIDTLGYPPSWMIDMGKNSGKFMKK 606          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KNS1 (Protein kinase involved in negative regulation of PolIII transcription; effector kinase of the TOR signaling pathway and phosphorylates Rpc53p to regulate ribosome and tRNA biosynthesis; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues; capable of autophosphorylation [Source:SGD;Acc:S000003942])

HSP 1 Score: 81.6481 bits (200), Expect = 2.631e-16
Identity = 50/167 (29.94%), Postives = 88/167 (52.69%), Query Frame = 2
Query:  365 RYHVVRKLGWGHFSTVWLCWDLK-EKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRL---AAEALDCQRR 853
            R+ V   LG G F  V  C D K E  +VA+KV+++   Y E A  E+++L+ +   DP  +F+   ++   D++       H+C+V ++ G ++   +  +     P  +++ I RQ +  + +LH    IIHTD+KPENIL+C      ++L     ++L  +RR
Sbjct:  312 RFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELRILQTILNNDPQGQFQCLLLRECFDYK------NHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAIARQLIRSVCFLH-DLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRR 471          

HSP 2 Score: 65.0846 bits (157), Expect = 3.956e-11
Identity = 40/127 (31.50%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 1766 QVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLG-PIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYD 2143
            ++KI D G+A + + +    I TR YRA E+++G G+  P DIWS AC+  EL  G+ L+  H       + +H+A +  + G P P  I       + F+  K +L +    +P DL S + + +D
Sbjct:  485 EIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIGESLYPIHE------NLEHMAMMQRINGTPFPTDII-----DKMFYKSKHKLGN----SPSDLNSTVIKHFD 596          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SLT2 (Serine/threonine MAP kinase; coordinates expression of all 19S regulatory particle assembly-chaperones (RACs) to control proteasome abundance; involved in regulating maintenance of cell wall integrity, cell cycle progression, nuclear mRNA retention in heat shock, septum assembly; required for mitophagy, pexophagy; affects recruitment of mitochondria to phagophore assembly site; plays role in adaptive response of cells to cold; regulated by the PKC1-mediated signaling pathway [Source:SGD;Acc:S000001072])

HSP 1 Score: 62.003 bits (149), Expect = 2.274e-10
Identity = 46/173 (26.59%), Postives = 78/173 (45.09%), Query Frame = 2
Query: 1766 QVKIADLG-------NACWTFHHFTEDIQTRQYRALEVLIG-AGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIA--LSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            Q+KI D G       N        TE + TR YRA E+++   GY    D+WS  C+  E   G  +F+   G DY    + L  ++++LG  P      +  +  +D+  + G +  +  +N +             P A     + L  MLA+D ++R+T  + L+HP+L+
Sbjct:  166 QLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFK---GKDYV---NQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLY-------------PNANSQALDLLEQMLAFDPQKRITVDEALEHPYLS 319          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KDX1 (Protein kinase; implicated in Slt2p mitogen-activated (MAP) kinase signaling pathway; interacts with numerous components in the mating pheromone and CWI MAPK pathways; associates with Rlm1p; KDX1 has a paralog, SLT2, that arose from the whole genome duplication [Source:SGD;Acc:S000001644])

HSP 1 Score: 61.6178 bits (148), Expect = 2.633e-10
Identity = 56/175 (32.00%), Postives = 82/175 (46.86%), Query Frame = 2
Query: 1766 QVKIADLGNAC-WTFHHFTED------IQTRQYRALEVLIGAGYGTPA-DIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIP----RHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            Q+KI + G +C ++ +H   D      I +  Y+A E+L+     T A DIWST C+  EL     +FE   G DY    DHL H++++LG  P    + IA    Y+  F           N+      S+L       P A     E L  ML +D K+R+T  D L+HP+L+
Sbjct:  166 QLKICNFGLSCSYSENHKVNDGFIKGYITSIWYKAPEILLNYQECTKAVDIWSTGCILAELLGRKPMFE---GKDYV---DHLNHILQILGTPPEETLQEIASQKVYNYIF--------QFGNIPGRSFESIL-------PGANPEALELLKKMLEFDPKKRITVEDALEHPYLS 319          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO38245 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDE5])

HSP 1 Score: 286.574 bits (732), Expect = 2.279e-85
Identity = 129/185 (69.73%), Postives = 156/185 (84.32%), Query Frame = 2
Query:  281 SDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEA 835
            SD+EEQEDP DYCKGGYHPV+LG ++N+RY V+RKLGWGHFSTVWL WD+ E ++VA+K+VKSA HYTETA DE+KLL+ V  ADP H      VQL DDF++ GING+H+CMVFEVLG NLLKLIIKSNY+GIP K V++I+ QTL+GL YLHTKC+IIHTDIKPENILLC+S   +++LA EA
Sbjct:   51 SDDEEQEDPNDYCKGGYHPVQLGDLFNNRYSVIRKLGWGHFSTVWLAWDVSENKYVALKIVKSASHYTETAIDEMKLLRTVHTADPKHHGHKHVVQLTDDFKIVGINGSHICMVFEVLGHNLLKLIIKSNYKGIPIKLVKSIVTQTLKGLDYLHTKCKIIHTDIKPENILLCISQHEIQQLADEA 235          

HSP 2 Score: 270.396 bits (690), Expect = 2.043e-79
Identity = 118/163 (72.39%), Postives = 138/163 (84.66%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            ++VKIADLGNACWT HHFTE+IQTRQYR LEVLIGA YG P+DIWSTACMAFEL TGD+LFEPHSG+DYSRD+DHLAH+IELLG IP+HIALSG+YS+D+F KKGEL+HI  L PW L  VL EKY+WS ++A  F  FL PML Y+ + R TA +CL+HPWL
Sbjct:  448 LRVKIADLGNACWTHHHFTEEIQTRQYRCLEVLIGAKYGPPSDIWSTACMAFELCTGDFLFEPHSGEDYSRDEDHLAHIIELLGRIPKHIALSGKYSKDYFNKKGELKHITKLRPWGLSEVLMEKYEWSRQSADEFVSFLAPMLDYNQENRATAAECLKHPWL 610          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO33758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR83])

HSP 1 Score: 93.9745 bits (232), Expect = 3.916e-20
Identity = 59/175 (33.71%), Postives = 89/175 (50.86%), Query Frame = 2
Query: 1766 QVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYS----VLRE------KYDWSPRAARN-FTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
             +++ D G+A +   H +  + TR YRA EV++  G+  P DIWS  C+ FEL TG  LF+ H       + +HLA +  ++GPIP   A   R ++ F+  KG+L        WD  S     +RE      KY  S       F   L  +L YD ++R+TA + +QHP+ N+
Sbjct:  283 HMRLIDFGSATFEHEHHSTTVSTRHYRAPEVILELGWSYPCDIWSIGCIMFELYTGFTLFQTHE------NREHLAMMERIIGPIPSDFAKKSRKTKYFY--KGKLE-------WDEKSSSGKYVRENCKPLKKYMLSDSEGHQLFFNLLDYLLEYDPEKRITAKEAMQHPFFNS 442          

HSP 2 Score: 83.1889 bits (204), Expect = 1.448e-16
Identity = 54/156 (34.62%), Postives = 83/156 (53.21%), Query Frame = 2
Query:  347 GQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHV 814
            G   + RY V   LG G F  V  C+D K    VA+KV+K+   Y E A  EIK+L+ + + +   K     ++++D F   G    H+C+VFE +G ++   +  +NY   P   VR I  Q +  + +LH + ++ HTD+KPEN+L   SD  V
Sbjct:  118 GDQLHSRYEVHCLLGEGTFGKVLECYDKKTGDVVAVKVIKNIEKYREAAKLEIKVLEKINQKNRYGK--SLCIKMLDWFNHHG----HMCLVFEKMGLSVFDFMKDNNYEPYPLDQVRHISYQLIVAVKFLH-EMKLTHTDLKPENMLFVNSDCDV 266          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO45187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC8])

HSP 1 Score: 92.0485 bits (227), Expect = 1.447e-19
Identity = 57/171 (33.33%), Postives = 90/171 (52.63%), Query Frame = 2
Query:  338 VKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHT-KCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQ 847
            VK G+ + DRY +   +G G F  V   +D +EK  +A+K++K+   +   A  E+KLL+ + + DP  K+    V+L   F    +   H+C+VFE+L  NL  L+  +N+RG+     R   +Q    L +L + +  IIH D+KPENILLC       ++      CQ
Sbjct:   69 VKAGEKWFDRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKIIKNKKPFLNQAQIEVKLLELMNKNDPDGKYY--IVRLKRHF----MWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLCSPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQ 233          

HSP 2 Score: 71.2478 bits (173), Expect = 8.194e-13
Identity = 51/194 (26.29%), Postives = 86/194 (44.33%), Query Frame = 2
Query: 1769 VKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTK-----------KGELRHIHNLNPWDLYSVLREKYDWSPRAAR------------NFTEFLLPMLAYDTKERVTAWDCLQHPWLNTDSPDDTDN 2281
            +KI D G++C       + IQ+R YR+ EVL+G  Y    D+WS  C+  E+ TG+ LF   SG   + + D +  ++E+LG  P+ I  +   +R FF +           K  ++   +     L+ +L  +    P   R             F + +L ML YD K R+  +  L H +    + + T+ 
Sbjct:  223 IKIVDFGSSCQIGQRIYQYIQSRFYRSPEVLLGIPYNLAIDMWSLGCILVEMHTGEPLF---SG---ANEFDQMMKIVEVLGMPPKDILDNAPKARKFFDRLPDGSYQCLKVKDGVKEYLSPGSRKLHDILGCE-TGGPGGRRLGEAGHTLQDYLKFKDLILRMLDYDRKTRIVPYAALHHCFFKKTAEEGTNT 409          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO46144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP1])

HSP 1 Score: 90.1225 bits (222), Expect = 1.138e-18
Identity = 59/178 (33.15%), Postives = 84/178 (47.19%), Query Frame = 2
Query: 1769 VKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRH--IHNLNPWDLYSVLREKYDWSPRAARN---------------FTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            +K+ D G++C+        IQ+R YRA EV++GA YG P D+WS  C+  EL TG  LF    G+D   + D LA  +ELLG IP  +  + + +++F   KG  R+  I  L    +            R A N               F +FL   L +D   R+T    L+HPWL
Sbjct:  309 IKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGARYGMPIDMWSFGCILAELLTGYPLF---PGED---EGDQLACNMELLGYIPEKLRETSKRAKNFINSKGYPRYCTITTLPDGSVAVSGGRSRRGKTRGAPNSKTFVQALKGCDDAMFIDFLKRCLEWDPSARMTPSQALRHPWL 480          

HSP 2 Score: 84.7297 bits (208), Expect = 5.660e-17
Identity = 53/146 (36.30%), Postives = 80/146 (54.79%), Query Frame = 2
Query:  365 RYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRT---VQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILL 793
            RY V++ +G G F  V    D K    VA+K+V++   +   A +EI++L+ +++ D     +D T   + +++ F        HVCM FE+L  NL +LI K+ ++G     VR      L+ L  LH K RIIH D+KPENILL
Sbjct:  166 RYEVLKIIGKGSFGQVVKALDHKTNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQD-----KDNTHNIIHMLEHFTFR----NHVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALH-KNRIIHCDLKPENILL 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO36294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ45])

HSP 1 Score: 79.337 bits (194), Expect = 7.879e-16
Identity = 51/146 (34.93%), Postives = 80/146 (54.79%), Query Frame = 2
Query:  365 RYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRT---VQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILL 793
            RY V+  LG G F  V    D K  + VA+K++++   + + A  E+K+L  +R+ D     +D T   + +I+ F        H+C+ FE++G NL +LI K+N++G     +R      L  L  +H K +IIH D+KPENILL
Sbjct:   59 RYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALVEVKILDNLRKKD-----KDNTHNLIHMIEHFYFR----NHLCITFELMGMNLYELIKKNNFQGFSLALIRRFAFALLHCLKVIH-KEKIIHCDLKPENILL 194          

HSP 2 Score: 63.929 bits (154), Expect = 8.202e-11
Identity = 41/111 (36.94%), Postives = 61/111 (54.95%), Query Frame = 2
Query: 1769 VKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLG-PIPRHIALSGRYSRDFFTKKGELRHIHN 2098
            +K+ D G++C+        IQ+R YR+ EV++G  Y    D+WS  C+  EL TG  LF    G++   + + LA ++E+LG P P+ I  + R  R FF  KG  R I N
Sbjct:  202 IKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGLPYSMAIDMWSFGCILAELYTGYPLF---PGEN---EVEQLACIMEVLGLPSPKLIESASR-RRLFFDSKGIPRCITN 305          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: SRPK2 (SRSF protein kinase 2 [Source:NCBI gene;Acc:101167956])

HSP 1 Score: 333.183 bits (853), Expect = 1.850e-101
Identity = 148/213 (69.48%), Postives = 180/213 (84.51%), Query Frame = 2
Query:  260 ESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPK 895
            +  E+LGSD+EEQEDP DYCKGGYHPVK+G ++N RYHV+RKLGWGHFSTVWLCWD++ K FVAMKVVKSA HYTETA DEIKLL+CVRE+DP    +D  VQLIDDF+++G+NG HVCMVFEVLG +LLK IIKSNY+G+P + V++IIRQ L+GL YLH+KC+IIHTDIKPENIL+CV D+ VRR+A EA + Q+ G  P   S+VSTAP+
Sbjct:   59 QEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDIQVKNFVAMKVVKSAQHYTETALDEIKLLRCVRESDPGDPNKDMVVQLIDDFKISGVNGIHVCMVFEVLGHHLLKWIIKSNYQGLPLQCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAFVRRMAMEATEWQKAGAPPPSGSAVSTAPQ 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: SRPK2 (SRSF protein kinase 2 [Source:NCBI gene;Acc:101167956])

HSP 1 Score: 329.717 bits (844), Expect = 1.660e-98
Identity = 148/213 (69.48%), Postives = 180/213 (84.51%), Query Frame = 2
Query:  260 ESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPK 895
            +  E+LGSD+EEQEDP DYCKGGYHPVK+G ++N RYHV+RKLGWGHFSTVWLCWD++ K FVAMKVVKSA HYTETA DEIKLL+CVRE+DP    +D  VQLIDDF+++G+NG HVCMVFEVLG +LLK IIKSNY+G+P + V++IIRQ L+GL YLH+KC+IIHTDIKPENIL+CV D+ VRR+A EA + Q+ G  P   S+VSTAP+
Sbjct:   44 QEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDIQVKNFVAMKVVKSAQHYTETALDEIKLLRCVRESDPGDPNKDMVVQLIDDFKISGVNGIHVCMVFEVLGHHLLKWIIKSNYQGLPLQCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAFVRRMAMEATEWQKAGAPPPSGSAVSTAPQ 256          

HSP 2 Score: 277.715 bits (709), Expect = 1.421e-79
Identity = 120/165 (72.73%), Postives = 140/165 (84.85%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            I+VKIADLGNACW   HFTEDIQTRQYR++EVLIGAGY TPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH+IELLG IPRH ALSG+YSR+FF ++G+LRHI  L PW L+ VL EKY WSP  A  FT+FLLPML    ++R +A +CL HPW+N+
Sbjct:  676 IRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGDLRHITKLKPWSLFDVLVEKYGWSPEDASQFTQFLLPMLEMVPEKRASASECLNHPWINS 840          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: SRPK2 (SRSF protein kinase 2 [Source:NCBI gene;Acc:101167956])

HSP 1 Score: 329.331 bits (843), Expect = 3.599e-98
Identity = 148/213 (69.48%), Postives = 180/213 (84.51%), Query Frame = 2
Query:  260 ESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPK 895
            +  E+LGSD+EEQEDP DYCKGGYHPVK+G ++N RYHV+RKLGWGHFSTVWLCWD++ K FVAMKVVKSA HYTETA DEIKLL+CVRE+DP    +D  VQLIDDF+++G+NG HVCMVFEVLG +LLK IIKSNY+G+P + V++IIRQ L+GL YLH+KC+IIHTDIKPENIL+CV D+ VRR+A EA + Q+ G  P   S+VSTAP+
Sbjct:   61 QEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDIQVKNFVAMKVVKSAQHYTETALDEIKLLRCVRESDPGDPNKDMVVQLIDDFKISGVNGIHVCMVFEVLGHHLLKWIIKSNYQGLPLQCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAFVRRMAMEATEWQKAGAPPPSGSAVSTAPQ 273          

HSP 2 Score: 266.544 bits (680), Expect = 1.500e-75
Identity = 115/165 (69.70%), Postives = 137/165 (83.03%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            I+VKIADLGNACW   HFTEDIQTRQYR++EVLIGAGY TPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+A + ELLG +PR +  +G+YSR+FF+KKG+LRHI  L PW L+ VL EKY WSP  A  FT+FLLPML    ++R +A +CL HPW+N+
Sbjct:  693 IRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIALITELLGKVPRKVVAAGKYSREFFSKKGDLRHITKLKPWSLFDVLVEKYGWSPEDASQFTQFLLPMLEMVPEKRASASECLNHPWINS 857          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: SRPK2 (SRSF protein kinase 2 [Source:NCBI gene;Acc:101167956])

HSP 1 Score: 328.946 bits (842), Expect = 4.107e-98
Identity = 148/213 (69.48%), Postives = 180/213 (84.51%), Query Frame = 2
Query:  260 ESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGV-PLMASSVSTAPK 895
            +  E+LGSD+EEQEDP DYCKGGYHPVK+G ++N RYHV+RKLGWGHFSTVWLCWD++ K FVAMKVVKSA HYTETA DEIKLL+CVRE+DP    +D  VQLIDDF+++G+NG HVCMVFEVLG +LLK IIKSNY+G+P + V++IIRQ L+GL YLH+KC+IIHTDIKPENIL+CV D+ VRR+A EA + Q+ G  P   S+VSTAP+
Sbjct:   59 QEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDIQVKNFVAMKVVKSAQHYTETALDEIKLLRCVRESDPGDPNKDMVVQLIDDFKISGVNGIHVCMVFEVLGHHLLKWIIKSNYQGLPLQCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAFVRRMAMEATEWQKAGAPPPSGSAVSTAPQ 271          

HSP 2 Score: 277.33 bits (708), Expect = 2.041e-79
Identity = 120/165 (72.73%), Postives = 140/165 (84.85%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            I+VKIADLGNACW   HFTEDIQTRQYR++EVLIGAGY TPADIWSTACMAFELATGDYLFEPHSG+DYSRD+DH+AH+IELLG IPRH ALSG+YSR+FF ++G+LRHI  L PW L+ VL EKY WSP  A  FT+FLLPML    ++R +A +CL HPW+N+
Sbjct:  691 IRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGDLRHITKLKPWSLFDVLVEKYGWSPEDASQFTQFLLPMLEMVPEKRASASECLNHPWINS 855          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: srpk3 (SRSF protein kinase 3 [Source:NCBI gene;Acc:101165710])

HSP 1 Score: 310.071 bits (793), Expect = 1.957e-95
Identity = 142/201 (70.65%), Postives = 169/201 (84.08%), Query Frame = 2
Query:  260 ESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVP 862
            +   +LGSD+EEQEDP DYC+GGY+PVK+G ++N RYHVVRKLGWGHFSTVWLCWDL++KRFVA+KVVKSA HYTETA DEI+LL+CVR++DP+   R+  VQLIDDF+V+G++G HVCMV EVLG  LLK IIKSNY G+P   V+TIIRQ L+GL YLHTKC+IIHTDIKPENILL V D ++RRLAAEA   QR G P
Sbjct:   12 QGQSLLGSDDEEQEDPSDYCRGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDLQKKRFVALKVVKSAPHYTETALDEIRLLRCVRDSDPSDPHRETIVQLIDDFKVSGVSGVHVCMVLEVLGHQLLKWIIKSNYMGLPLVCVKTIIRQVLQGLDYLHTKCKIIHTDIKPENILLVVDDVYIRRLAAEATVWQRIGAP 212          

HSP 2 Score: 261.536 bits (667), Expect = 1.812e-77
Identity = 119/165 (72.12%), Postives = 134/165 (81.21%), Query Frame = 2
Query: 1763 IQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNT 2257
            I+VKIADLGNACW   HFTEDIQTRQYRALEVLIGA YG PADIWSTACMAFELATGDYLFEPHSG+DY+RD+DH+AH+IELLGPIP   ALSGRYSR++F ++GELRHI +L PW L+ VL EKY+WS   A  F++FLL ML      R TA  CLQHPWL  
Sbjct:  296 IRVKIADLGNACWVHKHFTEDIQTRQYRALEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHIAHIIELLGPIPVPFALSGRYSREYFDRRGELRHISSLKPWGLFEVLLEKYEWSLDQAAAFSDFLLTMLELQPGRRATAAQCLQHPWLQA 460          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000069574.1 (SMESG000069574.1)

HSP 1 Score: 1516.52 bits (3925), Expect = 0.000e+0
Identity = 872/873 (99.89%), Postives = 872/873 (99.89%), Query Frame = 2
Query:   35 MSKLNRKMLIVQXXXXXXXXXXXXXXXXXXXXLEVADSGEAVSVSDAPSEEMQVLNXXXXXXXXXXXXXXYYANNESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKEFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKDPKDQICIYCRMSLCDIQNDFLXXXXXXXXXXXXXXXXXXKQQNCDISENLNPEIGAQNDHANENSVETIPFEEINVDNTDPSLEENVKEKVNGDVENNFNIKKNIAASTDAINIQESESDDENVNTTKRIIRDREPSPNIKFRNHDNIISDSNEQPSTVPQEPVKMHLKGNRFSTIVHPETLLKVTACSNCASKMFQSTNSDGSGATGNTDSALKAGDRRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNTDSPDDTDNEDYENDRDIINLRYNMNXXXXXXXXXXXXXXXETMEHLWDLNKDQDKDYPYNXXXXXXXXXXXXXXNHYNHLMKNKLVNINKEGDKKSNFPNSSDVKQQSSVEDSFVKETNNNPIHLLDNSEKN 2653
            MSKLNRKMLIVQTKKKHKKEKKAANKITINNKLEVADSGEAVSVSDAPSEEMQVLNDEDDIDDDISKEDDYYANNESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKEFSEESMKMTKNKKKRLKKKQKKQQKILEQELNEIEEMELREIAKERLKDPKDQICIYCRMSLCDIQNDFLNTYEIEINENIISDNNGNKQQNCDISENLNPEIGAQNDHANENSVETIPFEEINVDNTDPSLEENVKEKVNGDVENNFNI KNIAASTDAINIQESESDDENVNTTKRIIRDREPSPNIKFRNHDNIISDSNEQPSTVPQEPVKMHLKGNRFSTIVHPETLLKVTACSNCASKMFQSTNSDGSGATGNTDSALKAGDRRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNTDSPDDTDNEDYENDRDIINLRYNMNLLSGSSASSSRSLSLETMEHLWDLNKDQDKDYPYNSSSGSSSPVAGSGSNHYNHLMKNKLVNINKEGDKKSNFPNSSDVKQQSSVEDSFVKETNNNPIHLLDNSEKN
Sbjct:    1 MSKLNRKMLIVQTKKKHKKEKKAANKITINNKLEVADSGEAVSVSDAPSEEMQVLNDEDDIDDDISKEDDYYANNESNEVLGSDEEEQEDPKDYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKEFSEESMKMTKNKKKRLKKKQKKQQKILEQELNEIEEMELREIAKERLKDPKDQICIYCRMSLCDIQNDFLNTYEIEINENIISDNNGNKQQNCDISENLNPEIGAQNDHANENSVETIPFEEINVDNTDPSLEENVKEKVNGDVENNFNINKNIAASTDAINIQESESDDENVNTTKRIIRDREPSPNIKFRNHDNIISDSNEQPSTVPQEPVKMHLKGNRFSTIVHPETLLKVTACSNCASKMFQSTNSDGSGATGNTDSALKAGDRRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNTDSPDDTDNEDYENDRDIINLRYNMNLLSGSSASSSRSLSLETMEHLWDLNKDQDKDYPYNSSSGSSSPVAGSGSNHYNHLMKNKLVNINKEGDKKSNFPNSSDVKQQSSVEDSFVKETNNNPIHLLDNSEKN 873          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000030798.1 (SMESG000030798.1)

HSP 1 Score: 249.98 bits (637), Expect = 1.565e-72
Identity = 109/197 (55.33%), Postives = 148/197 (75.13%), Query Frame = 2
Query:  311 DYCKGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKEF 901
            DY KGGYHP+ + ++YN++Y ++RK+GWGHFSTVWLCWD K K+FVA+KVVKSA HYTE A DEI+LL  ++  DP H  +   V+L+D+F+  G NGTHVCMVFE+LGCNLLK+I +SNY GIP   V++I++Q L GL Y+H  C++IHTDIK ENI+L   + +V+ LA EA+   + G+ L  ++VS  P+ F
Sbjct:   46 DYRKGGYHPIYINEIYNNKYKIIRKIGWGHFSTVWLCWDFKSKKFVALKVVKSARHYTEAALDEIELLNQIKTNDPLHPGKSAVVELLDNFKTHGPNGTHVCMVFEILGCNLLKIIKQSNYAGIPISQVKSIVKQILSGLSYMHNCCQMIHTDIKLENIILTADEKYVKCLATEAILAWKAGIELPLAAVSNLPENF 242          

HSP 2 Score: 234.187 bits (596), Expect = 6.230e-67
Identity = 105/162 (64.81%), Postives = 125/162 (77.16%), Query Frame = 2
Query: 1769 VKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLN 2254
            VKIADLGNACW  +HFTEDIQTRQYR+LEV+IG+GY T ADIWS ACM FEL TG++LF P  GDD+SRD DH+AH +ELLGPIP+ IALSG+YS + F + G +R+I  L+ WDLYSVL +KY +SP  A     FL  ML YD K+R TA  CL+HPWLN
Sbjct:  327 VKIADLGNACWVANHFTEDIQTRQYRSLEVIIGSGYDTSADIWSLACMTFELITGEFLFNPERGDDWSRDQDHVAHFVELLGPIPKSIALSGKYSSEIFQRDGSIRNIEELSYWDLYSVLVDKYRFSPEEASELDSFLTQMLHYDKKKRATAEQCLKHPWLN 488          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000071751.1 (SMESG000071751.1)

HSP 1 Score: 94.3597 bits (233), Expect = 8.682e-20
Identity = 56/158 (35.44%), Postives = 89/158 (56.33%), Query Frame = 2
Query:  326 GYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLK-EKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLC 796
            GY  +K  Q+   RY +++ LG G F  V  C DLK     VA+KV+K+   Y E A  EIK+L+ +++ DP  + R   +  +D F   G    H+C+VF +LG ++   +  ++Y G P + VR +  Q  + + +LH+  ++ HTD+KPENIL  
Sbjct:  137 GYLVMKEDQLLKKRYKILKLLGEGTFGRVAQCKDLKNHNNEVAVKVIKAVEKYREAALLEIKVLELIKKTDP--QGRKLVIFALDSFNYHG----HMCIVFPLLGPSVFDFLKANHYVGYPMRQVRYMTYQISKAVDFLHS-LKLTHTDLKPENILFV 287          

HSP 2 Score: 78.1814 bits (191), Expect = 1.065e-14
Identity = 50/171 (29.24%), Postives = 80/171 (46.78%), Query Frame = 2
Query: 1769 VKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLREKYDWSPRAARNFT------------EFLLPMLAYDTKERVTAWDCLQHP 2245
            ++I DLG+A +   H T  + TR YR LEV++  G+  P D+WS  C+ FEL TG  +F  H       + +HLA +  +LG +P  +    +  R +F   G L+       WD  S   +      +  R +             + +  ML Y+ K+R+T  + L+HP
Sbjct:  311 IQIIDLGSATFEDEHHTTIVATRHYRPLEVILELGWSYPCDVWSIGCILFELYTGITMFMTHD------NIEHLAMMERILGHLPVRMTRKSK-KRKYFDDCGRLK-------WDGESKEGKYVRGEVKPLRRYITRHDDIKELDLFDLIQEMLEYNPKKRITMSESLRHP 467          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000033729.1 (SMESG000033729.1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.671e-19
Identity = 58/166 (34.94%), Postives = 91/166 (54.82%), Query Frame = 2
Query:  320 KGGYHPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKR-FVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPENILLCVSDSHV 814
            + G+   K+G   ++RY +   LG G F  V  C DLK K   VA+K++K+   Y E A  EI +LK ++E DP  K+    +++ D F   G    H+C+ F++LG ++   + ++ Y   P + VR I  Q    +++LH    + HTD+KPENIL   SD +V
Sbjct:  325 ESGHLMYKIGDNLHNRYEINNTLGEGTFGKVVECLDLKRKYDKVAVKIIKNIEKYREAAMLEINVLKFLQEKDPDGKY--LCIKMYDWFNYNG----HICISFQLLGLSVFNFLKENEYVPYPMEQVRHIAYQMCFAVNFLHENG-LTHTDLKPENILFVNSDYNV 483          

HSP 2 Score: 77.0258 bits (188), Expect = 4.693e-14
Identity = 50/170 (29.41%), Postives = 78/170 (45.88%), Query Frame = 2
Query: 1766 QVKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFFTKKGEL--------RHIHNLNPWDLYSVLREKYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            ++++ D G+A +     +  + TR YRA EV++  G+  P D+WS  C+ FEL +G  LF+ H       + +HLA +  +LG IP  +  S    +D+F   G+L              N   L+S  +   +     A    + L  ML YD K RV   D L H + 
Sbjct:  499 EIRLIDFGSATFDHEKHSTVVSTRHYRAPEVILELGWSQPCDVWSIGCIVFELFSGSTLFQTHD------NREHLAMMDRILGHIPYKMTRST--PKDYFDIDGKLIWNPIEKDAKFVRENCKRLFSYCKPNNE----VAVELFDLLSRMLEYDPKARVKLSDALNHSFF 656          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000041146.1 (SMESG000041146.1)

HSP 1 Score: 92.0485 bits (227), Expect = 8.539e-19
Identity = 58/185 (31.35%), Postives = 97/185 (52.43%), Query Frame = 2
Query:  308 KDYCKGGY-HPVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYTETANDEIKLLKCVREADPAHKFRDRTVQ-----LIDDFRVTGINGTHVCMVFEVLGCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHT-KCRIIHTDIKPENILLCVSDSHVRRLAAEALD 841
            K+  +G Y + +K G+++  RY++ + +G G F  V    D+  +  VA+K++K+  ++ E A  EI LL  + +    ++  D   Q      I   + T  +  H+C+VFE+L  NL  L+  +N++G+     R    Q  E L +L   + +IIH D+KPENILL     H RR A + +D
Sbjct:  247 KNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAIKIIKNKKNFVEQAQTEIALLMEMAK----YQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLI----HPRRSAIKVVD 423          

HSP 2 Score: 69.707 bits (169), Expect = 8.138e-12
Identity = 46/194 (23.71%), Postives = 77/194 (39.69%), Query Frame = 2
Query: 1769 VKIADLGNACWTFHHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDDHLAHVIELLGPIPRHIALSGRYSRDFF---------------------TKKGELRHIHNLNPWDLYSVLREKYDWSPRAAR------------NFTEFLLPMLAYDTKERVTAWDCLQHPWL 2251
            +K+ D G++C         IQ+R YR+ E+++   Y    DIWS  C+  EL TG  LF          + + +  ++EL+G  P H+ ++G+ +  +F                      KK   R + + N  D+  V    Y   P   R             F + +  ML  D + R+     L+HP+ 
Sbjct:  419 IKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQ------FEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGV----YTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 602          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRPK34.823e-10272.86SRSF protein kinase 3 [Source:HGNC Symbol;Acc:HGNC... [more]
SRPK35.952e-10272.86SRSF protein kinase 3 [Source:HGNC Symbol;Acc:HGNC... [more]
SRPK36.553e-10272.86SRSF protein kinase 3 [Source:HGNC Symbol;Acc:HGNC... [more]
SRPK31.435e-10172.86SRSF protein kinase 3 [Source:HGNC Symbol;Acc:HGNC... [more]
SRPK31.587e-10172.86SRSF protein kinase 3 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spk-11.349e-8463.64Serine/threonine-protein kinase spk-1 [Source:Uni... [more]
spk-11.349e-8463.64Serine/threonine-protein kinase spk-1 [Source:Uni... [more]
spk-11.349e-8463.64Serine/threonine-protein kinase spk-1 [Source:Uni... [more]
spk-11.349e-8463.64Serine/threonine-protein kinase spk-1 [Source:Uni... [more]
spk-13.914e-8463.64Serine/threonine-protein kinase spk-1 [Source:Uni... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRPK3.037e-9066.67gene:FBgn0286813 transcript:FBtr0087384[more]
SRPK3.037e-9066.67gene:FBgn0286813 transcript:FBtr0087383[more]
SRPK6.705e-8966.67gene:FBgn0286813 transcript:FBtr0330628[more]
SRPK1.160e-7767.78gene:FBgn0286813 transcript:FBtr0087385[more]
Srpk79D5.187e-7160.33gene:FBgn0025702 transcript:FBtr0304724[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srpk33.414e-10070.53SRSF protein kinase 3 [Source:ZFIN;Acc:ZDB-GENE-10... [more]
srpk33.533e-9872.04SRSF protein kinase 3 [Source:ZFIN;Acc:ZDB-GENE-10... [more]
srpk1b2.241e-9368.40SRSF protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
srpk1a4.442e-9369.38SRSF protein kinase 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
srpk1a5.627e-9369.38SRSF protein kinase 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srpk21.126e-9469.27SRSF protein kinase 2 [Source:NCBI gene;Acc:100124... [more]
srpk26.246e-9470.62SRSF protein kinase 2 [Source:NCBI gene;Acc:100124... [more]
srpk21.662e-9368.66SRSF protein kinase 2 [Source:NCBI gene;Acc:100124... [more]
srpk21.666e-9368.66SRSF protein kinase 2 [Source:NCBI gene;Acc:100124... [more]
srpk22.076e-9370.62SRSF protein kinase 2 [Source:NCBI gene;Acc:100124... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srpk29.548e-10271.43serine/arginine-rich protein specific kinase 2 [So... [more]
Srpk36.295e-10171.90serine/arginine-rich protein specific kinase 3 [So... [more]
Srpk13.231e-9767.14serine/arginine-rich protein specific kinase 1 [So... [more]
Srpk11.378e-9566.51serine/arginine-rich protein specific kinase 1 [So... [more]
Srpk12.758e-9367.14serine/arginine-rich protein specific kinase 1 [So... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O54781|SRPK2_MOUSE5.994e-10171.43SRSF protein kinase 2 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9UPE1|SRPK3_HUMAN7.624e-10172.86SRSF protein kinase 3 OS=Homo sapiens OX=9606 GN=S... [more]
sp|P78362|SRPK2_HUMAN1.507e-10071.43SRSF protein kinase 2 OS=Homo sapiens OX=9606 GN=S... [more]
sp|Q9Z0G2|SRPK3_MOUSE4.403e-10071.90SRSF protein kinase 3 OS=Mus musculus OX=10090 GN=... [more]
sp|B8Y466|SRPK3_PIG8.900e-10071.90SRSF protein kinase 3 OS=Sus scrofa OX=9823 GN=SRP... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S5AL721.121e-11377.25Protein kinase domain-containing protein OS=Protop... [more]
A0A4Z2CUX24.180e-11180.00SRSF protein kinase 2 OS=Schistosoma japonicum OX=... [more]
A0A4S2LMV85.610e-11181.43Protein kinase domain-containing protein OS=Opisth... [more]
A0A074ZM971.492e-11081.43Protein kinase domain-containing protein OS=Opisth... [more]
A0A4S2LFN33.418e-11081.43Protein kinase domain-containing protein OS=Opisth... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srpk34.673e-9771.56SRSF protein kinase 3 [Source:NCBI gene;Acc:103025... [more]
srpk1b1.551e-9670.33SRSF protein kinase 1-like [Source:NCBI gene;Acc:1... [more]
srpk1b1.963e-9670.33SRSF protein kinase 1-like [Source:NCBI gene;Acc:1... [more]
srpk1b1.963e-9670.33SRSF protein kinase 1-like [Source:NCBI gene;Acc:1... [more]
srpk1b2.301e-9670.33SRSF protein kinase 1-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRPK21.269e-10469.86SRSF protein kinase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
srpk1b1.993e-7456.82SRSF protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
dyrk27.650e-2032.77dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1aa3.212e-1932.16dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk25.023e-1834.97dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SKY13.348e-5353.99SR protein kinase (SRPK); involved in regulating p... [more]
YAK15.541e-2036.13Serine-threonine protein kinase; component of a gl... [more]
KNS12.631e-1629.94Protein kinase involved in negative regulation of ... [more]
SLT22.274e-1026.59Serine/threonine MAP kinase; coordinates expressio... [more]
KDX12.633e-1032.00Protein kinase; implicated in Slt2p mitogen-activa... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO382452.279e-8569.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337583.916e-2033.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451871.447e-1933.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461441.138e-1833.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362947.879e-1634.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRPK21.850e-10169.48SRSF protein kinase 2 [Source:NCBI gene;Acc:101167... [more]
SRPK21.660e-9869.48SRSF protein kinase 2 [Source:NCBI gene;Acc:101167... [more]
SRPK23.599e-9869.48SRSF protein kinase 2 [Source:NCBI gene;Acc:101167... [more]
SRPK24.107e-9869.48SRSF protein kinase 2 [Source:NCBI gene;Acc:101167... [more]
srpk31.957e-9570.65SRSF protein kinase 3 [Source:NCBI gene;Acc:101165... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069574.10.000e+099.89SMESG000069574.1[more]
SMESG000030798.11.565e-7255.33SMESG000030798.1[more]
SMESG000071751.18.682e-2035.44SMESG000071751.1[more]
SMESG000033729.12.671e-1934.94SMESG000033729.1[more]
SMESG000041146.18.539e-1931.35SMESG000041146.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001465 ID=SMED30001465|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2919bp
ATAAATTTATTTGTTTTGTTGATACTTGATAGTAATGAGTAAATTAAATC
GTAAGATGCTTATTGTCCAAACCAAAAAGAAACATAAGAAAGAAAAAAAA
GCAGCAAATAAAATTACTATCAATAACAAGCTGGAGGTTGCTGACTCTGG
AGAAGCTGTGTCTGTTTCGGATGCACCGAGCGAGGAAATGCAAGTACTAA
ACGATGAAGATGATATCGACGATGATATTTCTAAAGAAGACGATTATTAT
GCCAATAATGAGTCCAATGAAGTATTAGGTAGTGACGAAGAAGAACAAGA
AGACCCAAAAGATTATTGCAAAGGTGGATATCATCCCGTAAAGCTGGGAC
AAGTGTACAATGATCGCTACCATGTCGTTAGAAAACTTGGTTGGGGACAT
TTTTCAACAGTTTGGCTTTGTTGGGATTTAAAGGAAAAACGATTCGTTGC
TATGAAGGTCGTCAAAAGTGCAATGCATTACACTGAAACTGCAAATGATG
AAATAAAATTGTTAAAATGTGTAAGAGAGGCTGATCCGGCTCATAAGTTT
AGAGACAGAACCGTTCAACTAATTGATGATTTCAGAGTTACTGGAATCAA
TGGAACTCATGTTTGTATGGTGTTTGAAGTGTTAGGGTGCAATCTATTAA
AGTTAATTATTAAATCGAATTATCGTGGAATTCCCCGTAAAAATGTTCGT
ACAATCATAAGACAAACTCTTGAAGGATTACATTACCTTCATACAAAGTG
CAGAATTATCCATACCGATATTAAACCAGAAAATATTCTGCTTTGTGTTT
CTGATTCCCATGTTCGCAGATTAGCGGCTGAAGCCCTTGATTGTCAAAGA
CGTGGTGTGCCTCTTATGGCATCGTCAGTCAGTACAGCTCCTAAAGAATT
TTCTGAAGAATCTATGAAAATGACTAAAAATAAGAAAAAACGATTAAAAA
AGAAGCAAAAGAAGCAGCAGAAAATCTTGGAACAAGAATTAAATGAGATT
GAAGAAATGGAATTAAGAGAAATTGCTAAGGAAAGGTTAAAGGATCCAAA
AGATCAAATTTGTATTTATTGTAGAATGTCACTATGTGACATTCAGAATG
ATTTTTTGAATACCTATGAGATAGAAATTAACGAAAACATTATCAGTGAT
AATAATGGTAACAAACAACAGAATTGTGACATTTCAGAAAATCTAAACCC
AGAAATAGGAGCTCAAAATGATCATGCTAATGAAAACTCAGTTGAAACTA
TTCCATTTGAAGAGATTAATGTAGATAACACGGATCCAAGTTTAGAAGAA
AACGTGAAAGAAAAGGTTAACGGTGATGTAGAAAACAATTTTAACATAAA
AAAAAATATTGCGGCGTCCACTGATGCAATAAATATTCAAGAGTCAGAAT
CAGACGATGAAAATGTTAATACCACCAAACGAATAATTCGAGACCGAGAG
CCTTCTCCCAATATTAAATTCCGGAATCATGATAATATAATCAGTGATTC
AAACGAACAGCCATCAACTGTTCCTCAAGAACCTGTAAAAATGCATTTAA
AGGGCAATCGATTCTCAACAATTGTTCACCCAGAAACATTGCTTAAAGTT
ACTGCATGTAGTAACTGTGCTTCAAAAATGTTTCAGTCCACAAATAGTGA
TGGTAGTGGTGCTACTGGCAACACAGACTCTGCACTCAAAGCAGGCGATA
GAAGATCAATTCTTTTAGATCAACCAATTTCAGAGCCAGATCCTAGTAAA
GAAGTTTGTCCAATACAAGTGAAAATCGCAGATTTAGGTAATGCTTGTTG
GACTTTTCATCATTTCACAGAAGACATTCAAACTCGTCAGTATCGAGCTC
TTGAAGTTTTAATAGGTGCTGGTTATGGAACCCCAGCAGATATATGGAGC
ACTGCTTGCATGGCATTTGAACTTGCAACTGGTGATTATTTATTTGAACC
TCATTCCGGAGATGATTATTCTAGAGATGATGATCACCTTGCACACGTCA
TTGAATTATTGGGCCCGATACCTCGGCACATTGCATTGTCTGGGCGATAT
TCAAGAGATTTTTTCACTAAAAAAGGCGAATTGAGGCACATTCATAATCT
AAATCCATGGGATCTCTATTCAGTTCTTCGGGAAAAATATGATTGGTCCC
CAAGAGCTGCACGTAATTTCACCGAATTTTTGTTACCTATGTTGGCATAT
GATACCAAGGAACGTGTTACTGCTTGGGATTGTTTGCAACATCCTTGGTT
GAATACAGATTCACCTGATGATACGGACAATGAAGATTATGAAAACGACA
GAGACATAATCAATTTGAGATATAATATGAATCTATTATCAGGAAGTAGT
GCCAGCAGTTCTCGGTCTCTTTCCTTAGAAACTATGGAACATCTATGGGA
TCTCAACAAAGATCAAGATAAAGACTATCCCTATAATTCATCGTCTGGAT
CTTCTAGTCCAGTAGCTGGATCCGGCAGTAATCATTACAATCATTTAATG
AAAAACAAGCTTGTCAATATCAACAAAGAAGGTGATAAAAAGTCGAATTT
CCCAAACAGTAGCGATGTGAAACAACAGTCGTCTGTTGAAGATTCATTTG
TCAAAGAAACAAATAACAATCCTATTCATTTGTTAGACAATTCAGAGAAA
AATTGAATTTTAAGATGCTAAAAAATATCTATTTTATTTGTATTTGGTTT
GTCTGATTGATTTTTTGGCCTTTATCCTATAATATCAGCAGAATATCAGC
GATAAATGGGCGATCCAAGACCGCAATCTTGTGATATGCAATATTGTATA
TGTAGGTATTGTAAGCTCTATTATATACTTCAGTTACATGAAAATAATAA
TCACAATAATAATAATATAATAATAATAATTAGTTTCTTTGTTGTAACTT
CGTTCGGTCATAATCGAGG
back to top

protein sequence of SMED30001465-orf-1

>SMED30001465-orf-1 ID=SMED30001465-orf-1|Name=SMED30001465-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=874bp
MSKLNRKMLIVQTKKKHKKEKKAANKITINNKLEVADSGEAVSVSDAPSE
EMQVLNDEDDIDDDISKEDDYYANNESNEVLGSDEEEQEDPKDYCKGGYH
PVKLGQVYNDRYHVVRKLGWGHFSTVWLCWDLKEKRFVAMKVVKSAMHYT
ETANDEIKLLKCVREADPAHKFRDRTVQLIDDFRVTGINGTHVCMVFEVL
GCNLLKLIIKSNYRGIPRKNVRTIIRQTLEGLHYLHTKCRIIHTDIKPEN
ILLCVSDSHVRRLAAEALDCQRRGVPLMASSVSTAPKEFSEESMKMTKNK
KKRLKKKQKKQQKILEQELNEIEEMELREIAKERLKDPKDQICIYCRMSL
CDIQNDFLNTYEIEINENIISDNNGNKQQNCDISENLNPEIGAQNDHANE
NSVETIPFEEINVDNTDPSLEENVKEKVNGDVENNFNIKKNIAASTDAIN
IQESESDDENVNTTKRIIRDREPSPNIKFRNHDNIISDSNEQPSTVPQEP
VKMHLKGNRFSTIVHPETLLKVTACSNCASKMFQSTNSDGSGATGNTDSA
LKAGDRRSILLDQPISEPDPSKEVCPIQVKIADLGNACWTFHHFTEDIQT
RQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHSGDDYSRDDD
HLAHVIELLGPIPRHIALSGRYSRDFFTKKGELRHIHNLNPWDLYSVLRE
KYDWSPRAARNFTEFLLPMLAYDTKERVTAWDCLQHPWLNTDSPDDTDNE
DYENDRDIINLRYNMNLLSGSSASSSRSLSLETMEHLWDLNKDQDKDYPY
NSSSGSSSPVAGSGSNHYNHLMKNKLVNINKEGDKKSNFPNSSDVKQQSS
VEDSFVKETNNNPIHLLDNSEKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0000287magnesium ion binding
GO:0003723RNA binding
GO:0004674protein serine/threonine kinase activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:007188914-3-3 protein binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000245spliceosomal complex assembly
GO:0001525angiogenesis
GO:0006397mRNA processing
GO:0008284positive regulation of cell proliferation
GO:0008380RNA splicing
GO:0010628positive regulation of gene expression
GO:0016310phosphorylation
GO:0030154cell differentiation
GO:0035063nuclear speck organization
GO:0035556intracellular signal transduction
GO:0043525positive regulation of neuron apoptotic process
GO:0045070positive regulation of viral genome replication
GO:0045071negative regulation of viral genome replication
GO:0045787positive regulation of cell cycle
GO:0050684regulation of mRNA processing
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 287..335
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 95..195
e-value: 4.6E-41
score: 141.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 829..873
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 286..309
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 39..65
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 834..867
NoneNo IPR availablePANTHERPTHR24055MITOGEN-ACTIVATED PROTEIN KINASEcoord: 65..740
NoneNo IPR availablePANTHERPTHR24055:SF102SRSF PROTEIN KINASE 2coord: 65..740
NoneNo IPR availableCDDcd14136STKc_SRPKcoord: 101..260
e-value: 2.47079E-108
score: 334.16
NoneNo IPR availableCDDcd14136STKc_SRPKcoord: 577..739
e-value: 8.717E-112
score: 343.019
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 112..739
e-value: 7.1E-38
score: 141.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 112..259
e-value: 5.4E-22
score: 78.4
coord: 578..739
e-value: 9.4E-17
score: 61.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 112..739
score: 20.782
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 241..253
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 118..141
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 99..744