SMED30001461

Overview
NameSMED30001461
Smed IDSMED30001461
Length (bp)315
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001461

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30001461h1SMcG0014159 Contig38194uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001461h1SMcG0014159 Contig38194newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30001461h1SMcG0014159 dd_Smed_v4_15951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001461h1SMcG0014159 dd_Smed_v4_15951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001461h1SMcG0014159 dd_Smed_v4_15951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001461h1SMcG0014159 dd_Smed_v4_15951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30001461h1SMcG0014159 Smed-meissmed_ncbi_20240424PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30001461h1SMcG0014159 meissmed_ncbi_20240424PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30001461h1SMcG0014159 meissmed_ncbi_20240424PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
enteric muscle cellSMED30001461h1SMcG0014159 dd_Smed_v4_15951_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30001461 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.014489:3203..4992 -1544
Homology
BLAST of SMED30001461 vs. Ensembl Human
Match: MEIS3 (Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537])

HSP 1 Score: 94.7449 bits (234), Expect = 6.252e-25
Identity = 45/79 (56.96%), Postives = 57/79 (72.15%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKD------STNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            +  K +K EIY HPLFPLLAL+FEKCELAT SP+D       T    DVCSS+SFN+DI AF K++  SE+ LFS++P+
Sbjct:   51 DGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQV-RSERPLFSSNPE 128          
BLAST of SMED30001461 vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 92.0485 bits (227), Expect = 2.539e-23
Identity = 41/73 (56.16%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLAL+FEKCELAT +P++   +  DVCSS+SFN+DI  F K++  +EK LFS++P+
Sbjct:   71 DALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQV-RAEKPLFSSNPE 142          
BLAST of SMED30001461 vs. Ensembl Human
Match: MEIS1 (Meis homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7000])

HSP 1 Score: 92.0485 bits (227), Expect = 6.909e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   69 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 140          
BLAST of SMED30001461 vs. Ensembl Human
Match: MEIS1 (Meis homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7000])

HSP 1 Score: 92.0485 bits (227), Expect = 6.958e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   69 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 140          
BLAST of SMED30001461 vs. Ensembl Human
Match: MEIS1 (Meis homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7000])

HSP 1 Score: 91.6633 bits (226), Expect = 1.494e-22
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   67 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 138          
BLAST of SMED30001461 vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 72.7886 bits (177), Expect = 2.614e-16
Identity = 35/75 (46.67%), Postives = 54/75 (72.00%), Query Frame = -1
Query:    4 SFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDST---NSANDVCSSESFNDDITAFVKEIM-TSEKDLFSADP 216
            + K DK+ IY HPL+PLL L+FEKCELAT++P+D++   ++++DVCSS SF DD+  FV+     ++K  +  +P
Sbjct:   18 AMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNP 92          
BLAST of SMED30001461 vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 72.4034 bits (176), Expect = 4.108e-16
Identity = 35/75 (46.67%), Postives = 54/75 (72.00%), Query Frame = -1
Query:    4 SFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDST---NSANDVCSSESFNDDITAFVKEIM-TSEKDLFSADP 216
            + K DK+ IY HPL+PLL L+FEKCELAT++P+D++   ++++DVCSS SF DD+  FV+     ++K  +  +P
Sbjct:   55 AMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNP 129          
BLAST of SMED30001461 vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 72.4034 bits (176), Expect = 4.350e-16
Identity = 35/75 (46.67%), Postives = 54/75 (72.00%), Query Frame = -1
Query:    4 SFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDST---NSANDVCSSESFNDDITAFVKEIM-TSEKDLFSADP 216
            + K DK+ IY HPL+PLL L+FEKCELAT++P+D++   ++++DVCSS SF DD+  FV+     ++K  +  +P
Sbjct:   92 AMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNP 166          
BLAST of SMED30001461 vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 72.0182 bits (175), Expect = 4.934e-16
Identity = 35/75 (46.67%), Postives = 54/75 (72.00%), Query Frame = -1
Query:    4 SFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDST---NSANDVCSSESFNDDITAFVKEIM-TSEKDLFSADP 216
            + K DK+ IY HPL+PLL L+FEKCELAT++P+D++   ++++DVCSS SF DD+  FV+     ++K  +  +P
Sbjct:   18 AMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNP 92          
BLAST of SMED30001461 vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 71.633 bits (174), Expect = 7.506e-16
Identity = 35/75 (46.67%), Postives = 54/75 (72.00%), Query Frame = -1
Query:    4 SFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDST---NSANDVCSSESFNDDITAFVKEIM-TSEKDLFSADP 216
            + K DK+ IY HPL+PLL L+FEKCELAT++P+D++   ++++DVCSS SF DD+  FV+     ++K  +  +P
Sbjct:   92 AMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNP 166          
BLAST of SMED30001461 vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0344145)

HSP 1 Score: 90.8929 bits (224), Expect = 1.865e-23
Identity = 43/71 (60.56%), Postives = 52/71 (73.24%), Query Frame = -1
Query:    1 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 213
             K DK  IY HPLFPLLALIFEKCELAT +P++      DVCSSESFN+DI  F K+I  S+K  ++ADP+
Sbjct:   90 HKRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQI-RSQKPYYTADPE 159          
BLAST of SMED30001461 vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0100455)

HSP 1 Score: 90.8929 bits (224), Expect = 1.865e-23
Identity = 43/71 (60.56%), Postives = 52/71 (73.24%), Query Frame = -1
Query:    1 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 213
             K DK  IY HPLFPLLALIFEKCELAT +P++      DVCSSESFN+DI  F K+I  S+K  ++ADP+
Sbjct:   90 HKRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQI-RSQKPYYTADPE 159          
BLAST of SMED30001461 vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0100454)

HSP 1 Score: 90.5077 bits (223), Expect = 2.728e-23
Identity = 43/71 (60.56%), Postives = 52/71 (73.24%), Query Frame = -1
Query:    1 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 213
             K DK  IY HPLFPLLALIFEKCELAT +P++      DVCSSESFN+DI  F K+I  S+K  ++ADP+
Sbjct:   90 HKRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQI-RSQKPYYTADPE 159          
BLAST of SMED30001461 vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082256)

HSP 1 Score: 87.8113 bits (216), Expect = 1.621e-21
Identity = 43/70 (61.43%), Postives = 52/70 (74.29%), Query Frame = -1
Query:    1 KLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 210
            K DK  IY HPLFPLLALIFEKCELAT +P++      DVCSSESFN+DI  F K+I  S+K  ++ADP+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQI-RSQKPYYTADPE 159          
BLAST of SMED30001461 vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082255)

HSP 1 Score: 87.4261 bits (215), Expect = 2.537e-21
Identity = 43/70 (61.43%), Postives = 52/70 (74.29%), Query Frame = -1
Query:    1 KLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 210
            K DK  IY HPLFPLLALIFEKCELAT +P++      DVCSSESFN+DI  F K+I  S+K  ++ADP+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQI-RSQKPYYTADPE 159          
BLAST of SMED30001461 vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 92.8189 bits (229), Expect = 4.547e-25
Identity = 41/71 (57.75%), Postives = 55/71 (77.46%), Query Frame = -1
Query:    1 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 213
             K DK +IY HPLFPLLAL+FEKCELAT +P++   +  DVCSS+SFN+DI  F K++  +EK LFS++P+
Sbjct:   68 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQV-RAEKPLFSSNPE 137          
BLAST of SMED30001461 vs. Ensembl Zebrafish
Match: meis3 (myeloid ecotropic viral integration site 3 [Source:ZFIN;Acc:ZDB-GENE-010406-2])

HSP 1 Score: 93.2041 bits (230), Expect = 1.410e-24
Identity = 48/84 (57.14%), Postives = 61/84 (72.62%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSAN-----------DVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            +S K  + +IY HPLFPLLAL+FEKCELAT SP+DST+ +N           DVCSS+SFNDDI AF K+I  SEK +FS++P+
Sbjct:   40 DSLKHHRDQIYGHPLFPLLALVFEKCELATCSPRDSTSMSNPAHLPGMTNHSDVCSSDSFNDDIAAFAKQI-RSEKPIFSSNPE 122          
BLAST of SMED30001461 vs. Ensembl Zebrafish
Match: meis1a (Meis homeobox 1 a [Source:ZFIN;Acc:ZDB-GENE-020122-3])

HSP 1 Score: 89.3521 bits (220), Expect = 4.460e-24
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLAL+FEKCELAT +P++S     DVCSSESF++DIT F K+I  +EK  FS++PD
Sbjct:   49 DALKRDKDAIYGHPLFPLLALVFEKCELATCTPRES-GVTGDVCSSESFDEDITVFSKQI-RAEKPFFSSNPD 119          
BLAST of SMED30001461 vs. Ensembl Zebrafish
Match: meis3 (myeloid ecotropic viral integration site 3 [Source:ZFIN;Acc:ZDB-GENE-010406-2])

HSP 1 Score: 93.5893 bits (231), Expect = 5.616e-24
Identity = 48/84 (57.14%), Postives = 61/84 (72.62%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSAN-----------DVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            +S K  + +IY HPLFPLLAL+FEKCELAT SP+DST+ +N           DVCSS+SFNDDI AF K+I  SEK +FS++P+
Sbjct:   40 DSLKHHRDQIYGHPLFPLLALVFEKCELATCSPRDSTSMSNPAHLPGMTNHSDVCSSDSFNDDIAAFAKQI-RSEKPIFSSNPE 122          
BLAST of SMED30001461 vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 92.4337 bits (228), Expect = 6.110e-24
Identity = 41/71 (57.75%), Postives = 55/71 (77.46%), Query Frame = -1
Query:    1 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 213
             K DK +IY HPLFPLLAL+FEKCELAT +P++   +  DVCSS+SFN+DI  F K++  +EK LFS++P+
Sbjct:   69 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQV-RAEKPLFSSNPE 138          
BLAST of SMED30001461 vs. Ensembl Xenopus
Match: meis3 (Meis homeobox 3 [Source:NCBI gene;Acc:448474])

HSP 1 Score: 93.9745 bits (232), Expect = 1.202e-23
Identity = 45/75 (60.00%), Postives = 58/75 (77.33%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNS--ANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            +  K +K EIY HPLFPLLAL+FEKCELAT SP+D++ S    DVCSS+SFN+DI  F K++ T EK LFS++P+
Sbjct:   63 DGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDNSGSFPGGDVCSSDSFNEDIAVFAKQVRT-EKPLFSSNPE 136          
BLAST of SMED30001461 vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 92.4337 bits (228), Expect = 5.372e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   69 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 140          
BLAST of SMED30001461 vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 92.0485 bits (227), Expect = 5.663e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   71 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 142          
BLAST of SMED30001461 vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 92.4337 bits (228), Expect = 5.769e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   69 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 140          
BLAST of SMED30001461 vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 92.4337 bits (228), Expect = 8.896e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   69 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 140          
BLAST of SMED30001461 vs. Ensembl Mouse
Match: Meis3 (Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519])

HSP 1 Score: 92.4337 bits (228), Expect = 7.069e-25
Identity = 45/79 (56.96%), Postives = 59/79 (74.68%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNS------ANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            +S K +K +IY HPLFPLLAL+FEKCELAT SP+D  ++        DVCSS+SFN+DI AF K+I  SE+ LFS++P+
Sbjct:   54 DSLKREKDDIYGHPLFPLLALVFEKCELATCSPRDGASAGLGSPPGGDVCSSDSFNEDIAAFAKQI-RSERPLFSSNPE 131          
BLAST of SMED30001461 vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 93.2041 bits (230), Expect = 1.725e-24
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   42 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 113          
BLAST of SMED30001461 vs. Ensembl Mouse
Match: Meis3 (Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519])

HSP 1 Score: 92.4337 bits (228), Expect = 1.829e-23
Identity = 45/79 (56.96%), Postives = 59/79 (74.68%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNS------ANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            +S K +K +IY HPLFPLLAL+FEKCELAT SP+D  ++        DVCSS+SFN+DI AF K+I  SE+ LFS++P+
Sbjct:   54 DSLKREKDDIYGHPLFPLLALVFEKCELATCSPRDGASAGLGSPPGGDVCSSDSFNEDIAAFAKQIR-SERPLFSSNPE 131          
BLAST of SMED30001461 vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 92.0485 bits (227), Expect = 4.729e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   69 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 140          
BLAST of SMED30001461 vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 92.0485 bits (227), Expect = 5.030e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   69 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 140          
BLAST of SMED30001461 vs. UniProt/SwissProt
Match: sp|Q60954|MEIS1_MOUSE (Homeobox protein Meis1 OS=Mus musculus OX=10090 GN=Meis1 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.308e-22
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   69 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 140          
BLAST of SMED30001461 vs. UniProt/SwissProt
Match: sp|O00470|MEIS1_HUMAN (Homeobox protein Meis1 OS=Homo sapiens OX=9606 GN=MEIS1 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.342e-22
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   69 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 140          
BLAST of SMED30001461 vs. UniProt/SwissProt
Match: sp|Q6DIF3|MEIS3_XENTR (Homeobox protein meis3 OS=Xenopus tropicalis OX=8364 GN=meis3 PE=2 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 6.497e-22
Identity = 45/75 (60.00%), Postives = 58/75 (77.33%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNS--ANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            +  K +K EIY HPLFPLLAL+FEKCELAT SP+D++ S    DVCSS+SFN+DI  F K++ T EK LFS++P+
Sbjct:   61 DGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDNSGSFPGGDVCSSDSFNEDIAVFAKQVRT-EKPLFSSNPE 134          
BLAST of SMED30001461 vs. UniProt/SwissProt
Match: sp|Q5U4X3|MEI3A_XENLA (Homeobox protein meis3-A OS=Xenopus laevis OX=8355 GN=meis3-a PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 6.695e-22
Identity = 45/75 (60.00%), Postives = 58/75 (77.33%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNS--ANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            +  K +K EIY HPLFPLLAL+FEKCELAT SP+D++ S    DVCSS+SFN+DI  F K++ T EK LFS++P+
Sbjct:   61 DGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDNSGSFPGGDVCSSDSFNEDIAVFAKQVRT-EKPLFSSNPE 134          
BLAST of SMED30001461 vs. UniProt/SwissProt
Match: sp|Q7ZY13|MEI3B_XENLA (Homeobox protein meis3-B OS=Xenopus laevis OX=8355 GN=meis3-b PE=2 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 7.483e-22
Identity = 45/75 (60.00%), Postives = 58/75 (77.33%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNS--ANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            +  K +K EIY HPLFPLLAL+FEKCELAT SP+D++ S    DVCSS+SFN+DI  F K++ T EK LFS++P+
Sbjct:   61 DGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDNSGSFPGGDVCSSDSFNEDIAVFAKQVRT-EKPLFSSNPE 134          
BLAST of SMED30001461 vs. TrEMBL
Match: J7FUV3 (Meis OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 5.884e-47
Identity = 80/80 (100.00%), Postives = 80/80 (100.00%), Query Frame = -1
Query:    1 YIPQEPFNSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 240
            YIPQEPFNSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD
Sbjct:  292 YIPQEPFNSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 371          
BLAST of SMED30001461 vs. TrEMBL
Match: A0A1S3KHW9 (homeobox protein Meis1-like OS=Salmo salar OX=8030 GN=LOC106560216 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.722e-23
Identity = 44/73 (60.27%), Postives = 57/73 (78.08%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK +IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   67 DALKRDKDQIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 138          
BLAST of SMED30001461 vs. TrEMBL
Match: A0A226N868 (Meis_PKNOX_N domain-containing protein (Fragment) OS=Callipepla squamata OX=9009 GN=ASZ78_003124 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 8.848e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   65 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 136          
BLAST of SMED30001461 vs. TrEMBL
Match: A0A401RJD9 (Meis_PKNOX_N domain-containing protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0020755 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.610e-22
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            +S K +K  IY HPLFPLLAL+FEKCELAT +P+D   +  DVCSS+SFN+DI  F K+I T EK LFS++P+
Sbjct:   66 DSLKREKDTIYGHPLFPLLALVFEKCELATCTPRDCGMAGGDVCSSDSFNEDIAVFAKQIRT-EKPLFSSNPE 137          
BLAST of SMED30001461 vs. TrEMBL
Match: A0A4Z2EZ94 (Homeobox protein Meis1 OS=Liparis tanakae OX=230148 GN=meis1 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.927e-22
Identity = 44/73 (60.27%), Postives = 57/73 (78.08%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++S  +  DVCSS+SFN+DI  F K+I  SE+ LFS++P+
Sbjct:   78 DAVKRDKDAIYGHPLFPLLALIFEKCELATCTPRESGVAGGDVCSSDSFNEDIAVFSKQI-RSERPLFSSNPE 149          
BLAST of SMED30001461 vs. Ensembl Cavefish
Match: meis1b (Meis homeobox 1 [Source:NCBI gene;Acc:103042376])

HSP 1 Score: 93.2041 bits (230), Expect = 1.774e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   67 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 138          
BLAST of SMED30001461 vs. Ensembl Cavefish
Match: meis1b (Meis homeobox 1 [Source:NCBI gene;Acc:103042376])

HSP 1 Score: 93.2041 bits (230), Expect = 1.968e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   86 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 157          
BLAST of SMED30001461 vs. Ensembl Cavefish
Match: meis1b (Meis homeobox 1 [Source:NCBI gene;Acc:103042376])

HSP 1 Score: 93.2041 bits (230), Expect = 2.691e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   86 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 157          
BLAST of SMED30001461 vs. Ensembl Cavefish
Match: meis2a (homeobox protein Meis1-like [Source:NCBI gene;Acc:103032373])

HSP 1 Score: 90.5077 bits (223), Expect = 1.408e-22
Identity = 43/74 (58.11%), Postives = 55/74 (74.32%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKD-STNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            +S K DK  IY HPLFPLLAL+FEKCELAT +P+D    +  DVCSS SFN+DI  F K+I  +EK LF+++P+
Sbjct:   62 DSLKRDKDHIYGHPLFPLLALVFEKCELATCTPRDPGAGAGGDVCSSHSFNEDIAVFAKQI-RAEKPLFTSNPE 134          
BLAST of SMED30001461 vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 90.5077 bits (223), Expect = 1.551e-22
Identity = 41/71 (57.75%), Postives = 55/71 (77.46%), Query Frame = -1
Query:    1 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 213
             K DK +IY HPLFPLLAL+FEKCELAT +P++   +  DVCSS+SFN+DI  F K++  +EK LFS++P+
Sbjct:   73 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQV-RAEKPLFSSNPE 142          
BLAST of SMED30001461 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001860.1 (pep scaffold:Pmarinus_7.0:GL485367:2529:11155:-1 gene:ENSPMAG00000001690.1 transcript:ENSPMAT00000001860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 6.558e-21
Identity = 36/61 (59.02%), Postives = 49/61 (80.33%), Query Frame = -1
Query:    1 HPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 183
            HPLFPLLAL+FEKCELAT +P++   +  DVCSS+SFN+DI  F K++  +EK LFS++P+
Sbjct:    1 HPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQV-RAEKPLFSSNPE 60          
BLAST of SMED30001461 vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 48.521 bits (114), Expect = 3.017e-8
Identity = 24/78 (30.77%), Postives = 41/78 (52.56%), Query Frame = -1
Query:    1 PQEPFNSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 234
            P +P      DK  IY+HPLFPLL L+  +CE AT   +  T++             ++A ++ ++ ++ +LFS + D
Sbjct:   31 PLDPKAQMDADKNSIYSHPLFPLLRLMMLRCEEATQGAEGITSAG------------LSAEIQAMLGTQSELFSGNGD 96          
BLAST of SMED30001461 vs. Ensembl Nematostella
Match: EDO36439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN3])

HSP 1 Score: 83.9593 bits (206), Expect = 6.615e-21
Identity = 40/68 (58.82%), Postives = 51/68 (75.00%), Query Frame = -1
Query:    7 KLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSAD 210
            K DK+ +Y HPLFPLLALIFEKCELAT +P++      DVCSS SFN+DI AF K+   S+K +FS++
Sbjct:   31 KRDKEVLYGHPLFPLLALIFEKCELATCTPREPGAVGGDVCSSASFNEDIQAFAKQF-KSDKAIFSSN 97          
BLAST of SMED30001461 vs. Ensembl Nematostella
Match: EDO39375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC9])

HSP 1 Score: 51.2174 bits (121), Expect = 4.926e-9
Identity = 27/66 (40.91%), Postives = 39/66 (59.09%), Query Frame = -1
Query:    7 DKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSAD 204
            +K  IY HPLFPLLA++ EKCE AT +        +D  +S++F++DI  F+ +     K  FS D
Sbjct:    4 EKVAIYRHPLFPLLAMLLEKCEHATQT--------SDCPTSDAFDNDIKNFMMQHNREGKPCFSGD 61          
BLAST of SMED30001461 vs. Ensembl Medaka
Match: meis1b (Meis homeobox 1 [Source:NCBI gene;Acc:101167316])

HSP 1 Score: 92.8189 bits (229), Expect = 1.992e-23
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = -1
Query:    1 NSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 219
            ++ K DK  IY HPLFPLLALIFEKCELAT +P++   +  DVCSSESFN+DI  F K+I  +EK LFS++P+
Sbjct:   68 DALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI-RAEKPLFSSNPE 139          
BLAST of SMED30001461 vs. Ensembl Medaka
Match: meis3 (homeobox protein meis3-B [Source:NCBI gene;Acc:101154966])

HSP 1 Score: 91.6633 bits (226), Expect = 8.324e-23
Identity = 52/92 (56.52%), Postives = 63/92 (68.48%), Query Frame = -1
Query:    1 YIPQEPFNSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSA------------NDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 240
            Y P  P +S K  K  IY HPLFPLLAL+FEKCELAT SP+DS++S             +DVCSSESFNDDI AF K+I  SEK +FS++P+
Sbjct:   63 YGPTLP-DSLKHHKDLIYGHPLFPLLALVFEKCELATCSPRDSSSSLTATSHLPGMTNHSDVCSSESFNDDIAAFAKQI-RSEKPIFSSNPE 152          
BLAST of SMED30001461 vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 89.7373 bits (221), Expect = 3.311e-22
Identity = 41/71 (57.75%), Postives = 55/71 (77.46%), Query Frame = -1
Query:    1 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 213
             K DK +IY HPLFPLLAL+FEKCELAT +P++   +  DVCSS+SFN+DI  F K++  +EK LFS++P+
Sbjct:   71 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQV-RAEKPLFSSNPE 140          
BLAST of SMED30001461 vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 89.3521 bits (220), Expect = 4.026e-22
Identity = 41/71 (57.75%), Postives = 55/71 (77.46%), Query Frame = -1
Query:    1 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 213
             K DK +IY HPLFPLLAL+FEKCELAT +P++   +  DVCSS+SFN+DI  F K++  +EK LFS++P+
Sbjct:   70 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQV-RAEKPLFSSNPE 139          
BLAST of SMED30001461 vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 89.3521 bits (220), Expect = 5.462e-22
Identity = 41/71 (57.75%), Postives = 55/71 (77.46%), Query Frame = -1
Query:    1 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 213
             K DK +IY HPLFPLLAL+FEKCELAT +P++   +  DVCSS+SFN+DI  F K++  +EK LFS++P+
Sbjct:   71 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQV-RAEKPLFSSNPE 140          
BLAST of SMED30001461 vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 182.57 bits (462), Expect = 2.675e-55
Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = -1
Query:    1 PYLESISNSGIXXXXXXXXXXXXSYIPQEPFNSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 312
            PYLESISNSGINQYSNNSLSNNSSYIPQEPFNSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD
Sbjct:   90 PYLESISNSGINQYSNNSLSNNSSYIPQEPFNSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 193          
BLAST of SMED30001461 vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 182.57 bits (462), Expect = 2.724e-55
Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = -1
Query:    1 PYLESISNSGIXXXXXXXXXXXXSYIPQEPFNSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 312
            PYLESISNSGINQYSNNSLSNNSSYIPQEPFNSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD
Sbjct:   90 PYLESISNSGINQYSNNSLSNNSSYIPQEPFNSFKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 193          
BLAST of SMED30001461 vs. Planmine SMEST
Match: SMESG000078684.1 (SMESG000078684.1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.263e-16
Identity = 39/69 (56.52%), Postives = 55/69 (79.71%), Query Frame = -1
Query:    7 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSAD 213
            FK +K+ IY+H LFPLLA+IFEKCELAT +PK S++S +   SSESFN+D+  F KE++TS+K ++S +
Sbjct:   93 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYSSSSMDIC-SSESFNEDVMVFAKELVTSDKKIYSQN 160          
BLAST of SMED30001461 vs. Planmine SMEST
Match: SMESG000013307.1 (SMESG000013307.1)

HSP 1 Score: 49.6766 bits (117), Expect = 4.134e-8
Identity = 25/68 (36.76%), Postives = 40/68 (58.82%), Query Frame = -1
Query:    1 DKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPD 204
            +KK IY HPL+P+L+L+ E+CE AT SP        D  S ++F  D+ +++     +EK  F+ + D
Sbjct:   25 EKKSIYGHPLYPILSLLLEQCEQATASP--------DSQSPDTFEADLQSYILRNDNNEKYFFTDNKD 84          
The following BLAST results are available for this feature:
BLAST of SMED30001461 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEIS36.252e-2556.96Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537... [more]
MEIS22.539e-2356.16Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS16.909e-2360.27Meis homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7000][more]
MEIS16.958e-2360.27Meis homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7000][more]
MEIS11.494e-2260.27Meis homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7000][more]
back to top
BLAST of SMED30001461 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-622.614e-1646.67Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-624.108e-1646.67Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-624.350e-1646.67Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-624.934e-1646.67Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-627.506e-1646.67Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of SMED30001461 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hth1.865e-2360.56gene:FBgn0001235 transcript:FBtr0344145[more]
hth1.865e-2360.56gene:FBgn0001235 transcript:FBtr0100455[more]
hth2.728e-2360.56gene:FBgn0001235 transcript:FBtr0100454[more]
hth1.621e-2161.43gene:FBgn0001235 transcript:FBtr0082256[more]
hth2.537e-2161.43gene:FBgn0001235 transcript:FBtr0082255[more]
back to top
BLAST of SMED30001461 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a4.547e-2557.75Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis31.410e-2457.14myeloid ecotropic viral integration site 3 [Source... [more]
meis1a4.460e-2460.27Meis homeobox 1 a [Source:ZFIN;Acc:ZDB-GENE-020122... [more]
meis35.616e-2457.14myeloid ecotropic viral integration site 3 [Source... [more]
meis2a6.110e-2457.75Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
back to top
BLAST of SMED30001461 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis31.202e-2360.00Meis homeobox 3 [Source:NCBI gene;Acc:448474][more]
MEIS15.372e-2360.27Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
MEIS15.663e-2360.27Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
MEIS15.769e-2360.27Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
MEIS18.896e-2360.27Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
back to top
BLAST of SMED30001461 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Meis37.069e-2556.96Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519][more]
Meis11.725e-2460.27Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
Meis31.829e-2356.96Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519][more]
Meis14.729e-2360.27Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
Meis15.030e-2360.27Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
back to top
BLAST of SMED30001461 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60954|MEIS1_MOUSE3.308e-2260.27Homeobox protein Meis1 OS=Mus musculus OX=10090 GN... [more]
sp|O00470|MEIS1_HUMAN3.342e-2260.27Homeobox protein Meis1 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q6DIF3|MEIS3_XENTR6.497e-2260.00Homeobox protein meis3 OS=Xenopus tropicalis OX=83... [more]
sp|Q5U4X3|MEI3A_XENLA6.695e-2260.00Homeobox protein meis3-A OS=Xenopus laevis OX=8355... [more]
sp|Q7ZY13|MEI3B_XENLA7.483e-2260.00Homeobox protein meis3-B OS=Xenopus laevis OX=8355... [more]
back to top
BLAST of SMED30001461 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J7FUV35.884e-47100.00Meis OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A1S3KHW98.722e-2360.27homeobox protein Meis1-like OS=Salmo salar OX=8030... [more]
A0A226N8688.848e-2360.27Meis_PKNOX_N domain-containing protein (Fragment) ... [more]
A0A401RJD92.610e-2260.27Meis_PKNOX_N domain-containing protein OS=Chiloscy... [more]
A0A4Z2EZ943.927e-2260.27Homeobox protein Meis1 OS=Liparis tanakae OX=23014... [more]
back to top
BLAST of SMED30001461 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis1b1.774e-2360.27Meis homeobox 1 [Source:NCBI gene;Acc:103042376][more]
meis1b1.968e-2360.27Meis homeobox 1 [Source:NCBI gene;Acc:103042376][more]
meis1b2.691e-2360.27Meis homeobox 1 [Source:NCBI gene;Acc:103042376][more]
meis2a1.408e-2258.11homeobox protein Meis1-like [Source:NCBI gene;Acc:... [more]
meis2a1.551e-2257.75Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
back to top
BLAST of SMED30001461 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001860.16.558e-2159.02pep scaffold:Pmarinus_7.0:GL485367:2529:11155:-1 g... [more]
pknox23.017e-830.77pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30001461 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001461 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO364396.615e-2158.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393754.926e-940.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30001461 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis1b1.992e-2360.27Meis homeobox 1 [Source:NCBI gene;Acc:101167316][more]
meis38.324e-2356.52homeobox protein meis3-B [Source:NCBI gene;Acc:101... [more]
meis2a3.311e-2257.75Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a4.026e-2257.75Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a5.462e-2257.75Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
back to top
BLAST of SMED30001461 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000006530.12.675e-55100.00SMESG000006530.1[more]
SMESG000006530.12.724e-55100.00SMESG000006530.1[more]
SMESG000078684.14.263e-1656.52SMESG000078684.1[more]
SMESG000013307.14.134e-836.76SMESG000013307.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001461 ID=SMED30001461|Name=SMED30001461|organism=Schmidtea mediterranea sexual|type=transcript|length=315bp
GTCAGGATCTGCGCTGAAAAGATCTTTTTCTGATGTCATAATTTCTTTTA
CAAAAGCTGTGATGTCATCATTGAATGATTCAGATGAGCAAACATCATTT
GCTGAATTGGTTGAATCTTTTGGTGAAGTTGTTGCTAATTCACATTTTTC
GAAAATCAACGCCAAAAGAGGAAAAAGTGGATGATTGTAAATTTCTTTTT
TGTCCAATTTGAAACTATTAAACGGCTCTTGAGGAATATATGATGAATTA
TTTGAGAGAGAATTATTAGAATATTGATTGATTCCAGAATTCGAAATCGA
TTCCAAATATGGATT
back to top

protein sequence of SMED30001461-orf-1

>SMED30001461-orf-1 ID=SMED30001461-orf-1|Name=SMED30001461-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
NPYLESISNSGINQYSNNSLSNNSSYIPQEPFNSFKLDKKEIYNHPLFPL
LALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLF
SADPD
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000103central nervous system
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR11850:SF266HOMEOBOX PROTEIN HOMOTHORAXcoord: 13..104
NoneNo IPR availablePANTHERPTHR11850HOMEOBOX PROTEIN TRANSCRIPTION FACTORScoord: 13..104