SMED30001454

Overview
NameSMED30001454
Smed IDSMED30001454
Length (bp)1711
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001454

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001454SMESG000068028.1 Contig2424GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001454SMESG000011835.1 Contig2424GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30001454SMESG000011835.1 dd_Smed_v4_3825_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001454SMESG000011835.1 dd_Smed_v4_3825_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30001454 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003323:4933..31257 -7922
Homology
BLAST of SMED30001454 vs. Planmine SMEST
Match: SMESG000011835.1 (SMESG000011835.1)

HSP 1 Score: 376.711 bits (966), Expect = 3.219e-123
Identity = 213/242 (88.02%), Postives = 215/242 (88.84%), Query Frame = 3
Query:  399 KKKHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIE--------------KVDPFKMKTTGSEKSQDSR-----------VDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEXXXXXXXXXXXXXXKDSKVSYKPLDSEDQEAGKNSYKYVY 1049
            ++KHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIE              KVDPFKMKTTGSEKSQDS            VDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEGRRRTSRSRRTSGGKDSKV YKPLDSEDQEAGKNSYKYVY
Sbjct:  390 RRKHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIETTIHETVLNPEESKKVDPFKMKTTGSEKSQDSSLIDLAKPDENIVDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEGRRRTSRSRRTSGGKDSKVLYKPLDSEDQEAGKNSYKYVY 631          

HSP 2 Score: 173.326 bits (438), Expect = 1.389e-46
Identity = 119/166 (71.69%), Postives = 124/166 (74.70%), Query Frame = 3
Query:   51 VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKEXXXXXXXXXXXXXXXXXXXXXXXXXXX------------XXHPIDVENSNKK-KHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSS 509
            VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKETLLVNTTYTTLKT                          NTHPIDVENSNKK ++PEN  K K NNNT  I+ +N NK +    K  S
Sbjct:    8 VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKETLLVNTTYTTLKTKSKNPMKIYLTKTENPENPEKPKTNNNTHPIDVENSNKKTENPENPEKPKTNNNTHPIDVENSNKKKEIFCKGGS 173          
BLAST of SMED30001454 vs. Planmine SMEST
Match: SMESG000011835.1 (SMESG000011835.1)

HSP 1 Score: 376.711 bits (966), Expect = 4.224e-123
Identity = 213/242 (88.02%), Postives = 215/242 (88.84%), Query Frame = 3
Query:  399 KKKHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIE--------------KVDPFKMKTTGSEKSQDSR-----------VDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEXXXXXXXXXXXXXXKDSKVSYKPLDSEDQEAGKNSYKYVY 1049
            ++KHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIE              KVDPFKMKTTGSEKSQDS            VDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEGRRRTSRSRRTSGGKDSKV YKPLDSEDQEAGKNSYKYVY
Sbjct:  392 RRKHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIETTIHETVLNPEESKKVDPFKMKTTGSEKSQDSSLIDLAKPDENIVDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEGRRRTSRSRRTSGGKDSKVLYKPLDSEDQEAGKNSYKYVY 633          

HSP 2 Score: 173.326 bits (438), Expect = 1.509e-46
Identity = 119/166 (71.69%), Postives = 124/166 (74.70%), Query Frame = 3
Query:   51 VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKEXXXXXXXXXXXXXXXXXXXXXXXXXXX------------XXHPIDVENSNKK-KHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSS 509
            VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKETLLVNTTYTTLKT                          NTHPIDVENSNKK ++PEN  K K NNNT  I+ +N NK +    K  S
Sbjct:   10 VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKETLLVNTTYTTLKTKSKNPMKIYLTKTENPENPEKPKTNNNTHPIDVENSNKKTENPENPEKPKTNNNTHPIDVENSNKKKEIFCKGGS 175          
BLAST of SMED30001454 vs. Planmine SMEST
Match: SMESG000011835.1 (SMESG000011835.1)

HSP 1 Score: 376.711 bits (966), Expect = 5.351e-123
Identity = 214/249 (85.94%), Postives = 218/249 (87.55%), Query Frame = 3
Query:  378 IDVENSNKKKHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIE--------------KVDPFKMKTTGSEKSQDSR-----------VDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEXXXXXXXXXXXXXXKDSKVSYKPLDSEDQEAGKNSYKYVY 1049
            + V+   ++KHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIE              KVDPFKMKTTGSEKSQDS            VDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEGRRRTSRSRRTSGGKDSKV YKPLDSEDQEAGKNSYKYVY
Sbjct:  396 VMVDRFFRRKHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIETTIHETVLNPEESKKVDPFKMKTTGSEKSQDSSLIDLAKPDENIVDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEGRRRTSRSRRTSGGKDSKVLYKPLDSEDQEAGKNSYKYVY 644          

HSP 2 Score: 173.711 bits (439), Expect = 1.499e-46
Identity = 119/166 (71.69%), Postives = 124/166 (74.70%), Query Frame = 3
Query:   51 VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKEXXXXXXXXXXXXXXXXXXXXXXXXXXX------------XXHPIDVENSNKK-KHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSS 509
            VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKETLLVNTTYTTLKT                          NTHPIDVENSNKK ++PEN  K K NNNT  I+ +N NK +    K  S
Sbjct:    8 VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKETLLVNTTYTTLKTKSKNPMKIYLTKTENPENPEKPKTNNNTHPIDVENSNKKTENPENPEKPKTNNNTHPIDVENSNKKKEIFCKGGS 173          
BLAST of SMED30001454 vs. Planmine SMEST
Match: SMESG000011835.1 (SMESG000011835.1)

HSP 1 Score: 376.326 bits (965), Expect = 6.509e-123
Identity = 214/249 (85.94%), Postives = 218/249 (87.55%), Query Frame = 3
Query:  378 IDVENSNKKKHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIE--------------KVDPFKMKTTGSEKSQDSR-----------VDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEXXXXXXXXXXXXXXKDSKVSYKPLDSEDQEAGKNSYKYVY 1049
            + V+   ++KHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIE              KVDPFKMKTTGSEKSQDS            VDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEGRRRTSRSRRTSGGKDSKV YKPLDSEDQEAGKNSYKYVY
Sbjct:  398 VMVDRFFRRKHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIETTIHETVLNPEESKKVDPFKMKTTGSEKSQDSSLIDLAKPDENIVDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEGRRRTSRSRRTSGGKDSKVLYKPLDSEDQEAGKNSYKYVY 646          

HSP 2 Score: 173.326 bits (438), Expect = 1.580e-46
Identity = 119/166 (71.69%), Postives = 124/166 (74.70%), Query Frame = 3
Query:   51 VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKEXXXXXXXXXXXXXXXXXXXXXXXXXXX------------XXHPIDVENSNKK-KHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSS 509
            VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKETLLVNTTYTTLKT                          NTHPIDVENSNKK ++PEN  K K NNNT  I+ +N NK +    K  S
Sbjct:   10 VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKETLLVNTTYTTLKTKSKNPMKIYLTKTENPENPEKPKTNNNTHPIDVENSNKKTENPENPEKPKTNNNTHPIDVENSNKKKEIFCKGGS 175          
BLAST of SMED30001454 vs. Planmine SMEST
Match: SMESG000011835.1 (SMESG000011835.1)

HSP 1 Score: 377.096 bits (967), Expect = 1.507e-122
Identity = 214/249 (85.94%), Postives = 218/249 (87.55%), Query Frame = 3
Query:  378 IDVENSNKKKHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIE--------------KVDPFKMKTTGSEKSQDSR-----------VDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEXXXXXXXXXXXXXXKDSKVSYKPLDSEDQEAGKNSYKYVY 1049
            + V+   ++KHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIE              KVDPFKMKTTGSEKSQDS            VDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEGRRRTSRSRRTSGGKDSKV YKPLDSEDQEAGKNSYKYVY
Sbjct:  447 VMVDRFFRRKHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTESTNSSHHDKSLTTKQIETTIHETVLNPEESKKVDPFKMKTTGSEKSQDSSLIDLAKPDENIVDNKLKKDEIKNSEDTNHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYVIEGRRRTSRSRRTSGGKDSKVLYKPLDSEDQEAGKNSYKYVY 695          

HSP 2 Score: 174.096 bits (440), Expect = 1.744e-46
Identity = 119/166 (71.69%), Postives = 124/166 (74.70%), Query Frame = 3
Query:   51 VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKEXXXXXXXXXXXXXXXXXXXXXXXXXXX------------XXHPIDVENSNKK-KHPENSSKSKINNNTQTINPKNPNKAQAEHPKSSS 509
            VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKETLLVNTTYTTLKT                          NTHPIDVENSNKK ++PEN  K K NNNT  I+ +N NK +    K  S
Sbjct:    8 VCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQFSPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKETLLVNTTYTTLKTKSKNPMKIYLTKTENPENPEKPKTNNNTHPIDVENSNKKTENPENPEKPKTNNNTHPIDVENSNKKKEIFCKGGS 173          
The following BLAST results are available for this feature:
BLAST of SMED30001454 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001454 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011835.13.219e-12388.02SMESG000011835.1[more]
SMESG000011835.14.224e-12388.02SMESG000011835.1[more]
SMESG000011835.15.351e-12385.94SMESG000011835.1[more]
SMESG000011835.16.509e-12385.94SMESG000011835.1[more]
SMESG000011835.11.507e-12285.94SMESG000011835.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001454 ID=SMED30001454|Name=SMED30001454|organism=Schmidtea mediterranea sexual|type=transcript|length=1711bp
CTTAGATATTTTAAATTTTCAAAATGTTTATGAAAATTAATTTTATTTTT
GTATGCTATTTAACAATCTCAATAAAGTCTGCAGAAATCAATTCAAATGT
TGAGTCAGATGAATCTCCGAGGAAAAACGATTCGAATACCAACAGAAATG
ACCAAAAAATGCCTTCTCAATTTAGTCCAAACACAGCTATAACTGTTATT
TTAAATATATCCACAATCTTGCCACAAAAAACTTCAAATTCTGTGAGTTT
AAATTCTTTTACCTCGACTAATACGAGAAAAGAAACTTTGCTTGTTAACA
CGACTTATACAACATTAAAAACAACTGAAAATCCTGAAAATCCAGAAAAA
CCAAAAACTAATAATAACACCCATCCGATAGATGTGGAAAATTCGAATAA
AAAAAAACATCCAGAAAATTCATCGAAATCAAAAATTAATAATAACACGC
AAACAATAAATCCTAAAAACCCAAATAAAGCACAAGCGGAACATCCCAAA
AGTTCAAGCAAAACGAAAAAAAATGAAAATGCCCCGACAAATTCCGAAAA
CTCAGATAAATCTCAAACGAAAGATCAGAAAACTACAGGTAATATAAAAC
CCCATAAGAAAACTGAATCAACGAATTCGAGTCATCACGATAAATCATTG
ACCACAAAACAAATAGAAAAAGTAGATCCCTTTAAAATGAAAACGACTGG
ATCTGAAAAATCACAGGACTCAAGAGTTGACAATAAACTTAAAAAAGATG
AAATCAAAAATTCAGAAGACACAAATCACTTAAAAAGACAAAAAAGTCAA
AATTTAGGTGAAACGAACGATAACAGTAGTTCTCATTTTATGATCTTCAT
TTTTTTTGGATTGCTTTTCACAATTGTCGCTTATGTAGCCTTCCAGAAGC
GTAAAAAGATTATGGCATATGTTATCGAAGGCCGAAGACGAACGTCAAGA
AGCCGTCGGACTTCCGGTGGAAAGGATTCGAAAGTTTCATATAAACCTTT
AGACTCTGAAGATCAAGAAGCTGGAAAAAACAGCTATAAATATGTCTATT
AATTGATAAGAATTTACCATTATTTGTAAAATGTTCTTCATGTGTTACAT
TGGCCTTTAATGTAATTATTTATACATATTTATCAATTTTAATATATGTA
ATTTGTTTGGTCAATGAGGAAATATTTCTGAAATGTTTGAAAACTTTCCA
TGTGATTATTTTATAAAGTTCAGTGCTATAGGAGAATTGCGTATACGATA
TATTTGAATTTAGAATAATTAAATGACTACTTTATTGTTTTATTAGTATT
AACTCTAGGTCAGTAAAAATGATGCCTTTTAATTAGACGAGAATTGAGTC
TGCTGACTGCCTCGTGTTTTATCGTGTCAGAATTTGCATGATACAAACTA
TTTTTCATTATTATTCAACATTCTGATGTAATATTACATATATCGTGATG
TTTATTGGCGATATTTTTATTTTCATTAAAATAATTATTGTCATTATAAA
TCAGGGGTGGGCACAGTTGTGTGTCTTGGGTGCCACATTCATATGAAATC
AATTTATTTTATCAAAACAGTGTGCTTGGATTATGGTGCAATTTAAGTAT
ATTGTTGAAATAAAGTCAAATACTTATTATTTACTATATTGATTTAACTT
AAAAACATTATTTATTGAGAATTCCCAAATCAGAATAAATCAATCAAAAC
ATTTAACAGAG
back to top

protein sequence of SMED30001454-orf-1

>SMED30001454-orf-1 ID=SMED30001454-orf-1|Name=SMED30001454-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=343bp
MFMKINFIFVCYLTISIKSAEINSNVESDESPRKNDSNTNRNDQKMPSQF
SPNTAITVILNISTILPQKTSNSVSLNSFTSTNTRKETLLVNTTYTTLKT
TENPENPEKPKTNNNTHPIDVENSNKKKHPENSSKSKINNNTQTINPKNP
NKAQAEHPKSSSKTKKNENAPTNSENSDKSQTKDQKTTGNIKPHKKTEST
NSSHHDKSLTTKQIEKVDPFKMKTTGSEKSQDSRVDNKLKKDEIKNSEDT
NHLKRQKSQNLGETNDNSSSHFMIFIFFGLLFTIVAYVAFQKRKKIMAYV
IEGRRRTSRSRRTSGGKDSKVSYKPLDSEDQEAGKNSYKYVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 188..256
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 135..157
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 24..52
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 165..187
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 90..264
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 90..120
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 305..334
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 305..342
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.553
NoneNo IPR availableTMHMMTMhelixcoord: 271..290