Tetratricopeptide repeat protein 25

Overview
NameTetratricopeptide repeat protein 25
Smed IDSMED30001450
Length (bp)979
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetratricopeptide repeat protein 25 (SMED30001450) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetratricopeptide repeat protein 25 (SMED30001450) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Human
Match: TTC25 (tetratricopeptide repeat domain 25 [Source:HGNC Symbol;Acc:HGNC:25280])

HSP 1 Score: 61.2326 bits (147), Expect = 7.671e-10
Identity = 65/274 (23.72%), Postives = 116/274 (42.34%), Query Frame = 2
Query:   32 SDSESFDKGHSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENP 853
            SD E      ++ S+ A G  L     + +A    + A+   +      V R++C+L +   + +L D + +L+ D      +L  AET Y  G+FE ALV + +G  K + D +F +G++K+++ I  S G          +  +L +  D +F   +   I  +Q+   +      K L  P +  PK       +++TVR LL     D+       E   K +   D I G               ++++++ G  YLD    F+ Q+ P
Sbjct:    2 SDPEGETLRSTFPSYMAEGERLYLCGEFSKAAQSFSNALYLQDGDKNCLVARSKCFLKMGDLERSLKDAEASLQSDPAFCKGILQKAETLYTMGDFEFALVFYHRGY-KLRPDREFRVGIQKAQEAINNSVGSP--------SSIKLENKGDLSFLSKQAENIKAQQKPQPM------KHLLHPTKGEPKWKASLK-SEKTVRQLLGELYVDK-------EYLEKLLLDEDLIKGT--------MKGGLTVEDLIMTGINYLDTHSNFWRQQKP 244          
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Human
Match: TTC25 (tetratricopeptide repeat domain 25 [Source:HGNC Symbol;Acc:HGNC:25280])

HSP 1 Score: 58.9214 bits (141), Expect = 5.422e-9
Identity = 67/280 (23.93%), Postives = 118/280 (42.14%), Query Frame = 2
Query:   32 SDSESFDKGHSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKL--DNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFF----YNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENP 853
            SD E      ++ S+ A G  L     + +A    + A+   +      V R++C+L +   + +L D + +L+ D      +L  AET Y  G+FE ALV + +G   YKL  D +F +G++K+++ I  S G          +  +L +  D +F   +   I  +Q+   +      K L  P +  PK       +++TVR LL     D+ +      D D I+G     L                    ++++++ G  YLD    F+ Q+ P
Sbjct:    2 SDPEGETLRSTFPSYMAEGERLYLCGEFSKAAQSFSNALYLQDGDKNCLVARSKCFLKMGDLERSLKDAEASLQSDPAFCKGILQKAETLYTMGDFEFALVFYHRG---YKLRPDREFRVGIQKAQEAINNSVGSP--------SSIKLENKGDLSFLSKQAENIKAQQKPQPM------KHLLHPTKGEPKWKASLK-SEKTVRQLLGELYVDKEYLEKLLLDEDLIKGTMKGGL-------------------TVEDLIMTGINYLDTHSNFWRQQKP 244          
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Fly
Match: CG13502 (gene:FBgn0034692 transcript:FBtr0071799)

HSP 1 Score: 77.411 bits (189), Expect = 1.495e-15
Identity = 42/119 (35.29%), Postives = 73/119 (61.34%), Query Frame = 2
Query:   71 SFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCG 427
            S  A+G   +K+ + + AI++  KA+E  ++ + A + R++CYL + +  +AL D + AL +DKNN  A+   AE+ Y  G+FE++L+ F +GLR       F LGV+K+++ I  + G
Sbjct:  163 SVIALGLKEIKNANPENAIHFFCKALELNSTDINALISRSKCYLLLGEASKALQDAETALGEDKNNIRAIYQKAESLYYLGQFEQSLMFFHRGLRARPELALFRLGVQKTQEAIENTIG 281          
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Fly
Match: CG13502 (gene:FBgn0034692 transcript:FBtr0308241)

HSP 1 Score: 73.1738 bits (178), Expect = 1.288e-14
Identity = 38/110 (34.55%), Postives = 69/110 (62.73%), Query Frame = 2
Query:   98 LKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCG 427
            +K  +Y++A++   +A+E  ++ + A + R++CYL + +  +AL D + AL +DKNN  A+   AE+ Y  G+FE++L+ F +GLR       F LGV+K+++ I  + G
Sbjct:   29 MKVRAYEKALFGYNQALELNSTDINALISRSKCYLLLGEASKALQDAETALGEDKNNIRAIYQKAESLYYLGQFEQSLMFFHRGLRARPELALFRLGVQKTQEAIENTIG 138          
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Zebrafish
Match: ttc25 (tetratricopeptide repeat domain 25 [Source:NCBI gene;Acc:393286])

HSP 1 Score: 61.6178 bits (148), Expect = 4.368e-10
Identity = 64/264 (24.24%), Postives = 113/264 (42.80%), Query Frame = 2
Query:   62 SYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENP 853
            ++ ++ A G  L +   Y +A+   T A+          V R++CY+ +   + AL D + +LK +KN    +   AE  Y  G+FE ALV + +G +      +F LG++K+++ I  S G    V  K + +  LS F++   P+  +    KE +K      K +K                     T + LL    +DR +   L + E               D+ + K    E +++++V   +YLD R  F+ Q+ P
Sbjct:   13 TFTTYMAEGDQLFQRGEYVKAVESFTTALTLQPDDKNCLVSRSRCYVKLGDAENALKDAESSLKDNKNYFKGLYQKAEALYTMGDFEFALVYYHRGHKLRPELQEFRLGIQKAQEAIDNSVGSPSSV--KLVNKGDLSFFHNGVHPQNLNPSNKKESKKHSKKTDKGEK---------------------TAKQLLGELYSDREYLKKLLQDE---------------DLVKCKIRSGERVQDLIVGSISYLDTRMAFWQQQKP 238          
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Xenopus
Match: TTC25 (tetratricopeptide repeat domain 25 [Source:NCBI gene;Acc:100145076])

HSP 1 Score: 51.9878 bits (123), Expect = 8.644e-7
Identity = 55/264 (20.83%), Postives = 110/264 (41.67%), Query Frame = 2
Query:   62 SYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENP 853
            ++ ++ A G  L     YK+A    T A+          V R++C+L +   + AL D + +L+ +K+    +   AE  Y  G+FE ALV + +G +       F LG++K+++ I  S G    V  +   + Q     +E+    +  ++  +++        +                 P  +++T R LL    +D+ +   L  +  + +   +  SGV              + ++++ G  YLD R +F+ Q+ P
Sbjct:   35 TFATYMAEGEQLYHKAEYKKAKDSFTAALHLQPEDKNCLVARSKCFLKLGDPECALKDAETSLQIEKDFFKGLYQKAEALYSMGDFEFALVHYHRGYKLRPEFQGFRLGIQKAQEAIENSVGTPASVKLQNKADLQFISRQEESKKAKQKAQVKVQKKDTKQQKKVD-----------------PERSQKTARQLLGELYSDKEYLESL--LRDEALVNGNTRSGV-------------KLHDLIINGILYLDTRTEFWRQQKP 266          
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Xenopus
Match: TTC25 (tetratricopeptide repeat domain 25 [Source:NCBI gene;Acc:100145076])

HSP 1 Score: 51.6026 bits (122), Expect = 1.151e-6
Identity = 62/267 (23.22%), Postives = 112/267 (41.95%), Query Frame = 2
Query:   62 SYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLD---NKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENP 853
            ++ ++ A G  L     YK+A    T A+          V R++C+L +   + AL D + +L+ +K+    +   AE  Y  G+FE ALV + +G   YKL      F LG++K+++ I  S G    V  +   + Q                IS+++           K  KK  +   +    P  +++T R LL    +D+ +   L  +  + +   +  SGV              + ++++ G  YLD R +F+ Q+ P
Sbjct:   14 TFATYMAEGEQLYHKAEYKKAKDSFTAALHLQPEDKNCLVARSKCFLKLGDPECALKDAETSLQIEKDFFKGLYQKAEALYSMGDFEFALVHYHRG---YKLRPEFQGFRLGIQKAQEAIENSVGTPASVKLQNKADLQF---------------ISRQEESKKAKQKAQVKVQKKDTKQ--QKKVDPERSQKTARQLLGELYSDKEYLESL--LRDEALVNGNTRSGV-------------KLHDLIINGILYLDTRTEFWRQQKP 245          
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Mouse
Match: Ttc25 (tetratricopeptide repeat domain 25 [Source:MGI Symbol;Acc:MGI:1921657])

HSP 1 Score: 61.6178 bits (148), Expect = 4.626e-10
Identity = 39/124 (31.45%), Postives = 66/124 (53.23%), Query Frame = 2
Query:   62 SYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKL--DNKFYLGVRKSEDRIRASCG 427
            ++ S+ A G  L     + +AI   T A+   +      V R++CYL +   +++L D + +L+ D      +L  AET Y  G+FE ALV + +G   YKL  D +F +G++K+++ I  S G
Sbjct:   10 TFPSYMAEGERLYLCGEFTKAIQSFTNALHLQSGDKNCLVARSKCYLKMGDLEKSLNDAEASLRNDPTFCKGILQKAETLYTMGDFEFALVFYHRG---YKLRPDREFKVGIQKAQEAINNSVG 130          
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Mouse
Match: Ttc25 (tetratricopeptide repeat domain 25 [Source:MGI Symbol;Acc:MGI:1921657])

HSP 1 Score: 61.2326 bits (147), Expect = 6.781e-10
Identity = 39/124 (31.45%), Postives = 66/124 (53.23%), Query Frame = 2
Query:   62 SYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKL--DNKFYLGVRKSEDRIRASCG 427
            ++ S+ A G  L     + +AI   T A+   +      V R++CYL +   +++L D + +L+ D      +L  AET Y  G+FE ALV + +G   YKL  D +F +G++K+++ I  S G
Sbjct:   10 TFPSYMAEGERLYLCGEFTKAIQSFTNALHLQSGDKNCLVARSKCYLKMGDLEKSLNDAEASLRNDPTFCKGILQKAETLYTMGDFEFALVFYHRG---YKLRPDREFKVGIQKAQEAINNSVG 130          
BLAST of Tetratricopeptide repeat protein 25 vs. UniProt/SwissProt
Match: sp|Q7ZU45|TTC25_DANRE (Tetratricopeptide repeat protein 25 OS=Danio rerio OX=7955 GN=ttc25 PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.959e-9
Identity = 64/264 (24.24%), Postives = 113/264 (42.80%), Query Frame = 2
Query:   62 SYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENP 853
            ++ ++ A G  L +   Y +A+   T A+          V R++CY+ +   + AL D + +LK +KN    +   AE  Y  G+FE ALV + +G +      +F LG++K+++ I  S G    V  K + +  LS F++   P+  +    KE +K      K +K                     T + LL    +DR +   L + E               D+ + K    E +++++V   +YLD R  F+ Q+ P
Sbjct:   13 TFTTYMAEGDQLFQRGEYVKAVESFTTALTLQPDNKNCLVSRSRCYVKLGDAENALKDAESSLKDNKNYFKGLYQKAEALYTMGDFEFALVYYHRGHKLRPELQEFRLGIQKAQEAIDNSVGSPSSV--KLVNKGDLSFFHNGVHPQNLNPSNKKESKKHSKKTDKGEK---------------------TAKQLLGELYSDREYLKKLLQDE---------------DLVKCKIRSGERVQDLIVGSISYLDTRMAFWQQQKP 238          
BLAST of Tetratricopeptide repeat protein 25 vs. UniProt/SwissProt
Match: sp|Q9D4B2|TTC25_MOUSE (Tetratricopeptide repeat protein 25 OS=Mus musculus OX=10090 GN=Ttc25 PE=1 SV=3)

HSP 1 Score: 61.2326 bits (147), Expect = 4.743e-9
Identity = 39/124 (31.45%), Postives = 66/124 (53.23%), Query Frame = 2
Query:   62 SYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKL--DNKFYLGVRKSEDRIRASCG 427
            ++ S+ A G  L     + +AI   T A+   +      V R++CYL +   +++L D + +L+ D      +L  AET Y  G+FE ALV + +G   YKL  D +F +G++K+++ I  S G
Sbjct:   10 TFPSYMAEGERLYLCGEFTKAIQSFTNALHLQSGDKNCLVARSKCYLKMGDLEKSLNDAEASLRNDPTFCKGILQKAETLYTMGDFEFALVFYHRG---YKLRPDREFKVGIQKAQEAINNSVG 130          
BLAST of Tetratricopeptide repeat protein 25 vs. UniProt/SwissProt
Match: sp|Q96NG3|TTC25_HUMAN (Tetratricopeptide repeat protein 25 OS=Homo sapiens OX=9606 GN=TTC25 PE=1 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 2.604e-8
Identity = 67/280 (23.93%), Postives = 118/280 (42.14%), Query Frame = 2
Query:   32 SDSESFDKGHSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKL--DNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFF----YNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENP 853
            SD E      ++ S+ A G  L     + +A    + A+   +      V R++C+L +   + +L D + +L+ D      +L  AET Y  G+FE ALV + +G   YKL  D +F +G++K+++ I  S G          +  +L +  D +F   +   I  +Q+   +      K L  P +  PK       +++TVR LL     D+ +      D D I+G     L                    ++++++ G  YLD    F+ Q+ P
Sbjct:    2 SDPEGETLRSTFPSYMAEGERLYLCGEFSKAAQSFSNALYLQDGDKNCLVARSKCFLKMGDLERSLKDAEASLQSDPAFCKGILQKAETLYTMGDFEFALVFYHRG---YKLRPDREFRVGIQKAQEAINNSVGSP--------SSIKLENKGDLSFLSKQAENIKAQQKPQPM------KHLLHPTKGEPKWKASLK-SEKTVRQLLGELYVDKEYLEKLLLDEDLIKGTMKGGL-------------------TVEDLIMTGINYLDTHSNFWRQQKP 244          
BLAST of Tetratricopeptide repeat protein 25 vs. UniProt/SwissProt
Match: sp|Q32NU8|TTC25_XENLA (Tetratricopeptide repeat protein 25 OS=Xenopus laevis OX=8355 GN=ttc25 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.236e-6
Identity = 63/269 (23.42%), Postives = 116/269 (43.12%), Query Frame = 2
Query:   62 SYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLD---NKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIK--EMLVEGATYLDNRCQFYFQENP 853
            ++ ++ A G  L     YK+A    T A++    +    V R++C+L + + + AL D + +L+ + +    +   AE  Y  G+FE ALV + +G   YKL      F LG++K+++ I  S G    V  +  T+ Q     +E+    +  ++  +++        +                 P  +++TVR LL         Y+D + +E    S L        D    K N    +K  ++++ G  YLD R +F+ Q+ P
Sbjct:   14 TFSTYMAEGEQLYHKAEYKKASDSFTAALQLQPEEKNCLVARSKCFLKLGEPECALKDAEASLQIENDFFKGLYQKAEALYAMGDFEFALVHYHRG---YKLRPEFQGFRLGIQKAQEAIENSVGTPASVKLENKTDLQFISRQEESKKAKQKAQVKVQKKDSKQQKKVD-----------------PERSQKTVRQLLGE------LYSDKEYLE----SLL-------RDEALVKGNTRGGVKLHDLIINGILYLDTRSEFWRQQKP 245          
BLAST of Tetratricopeptide repeat protein 25 vs. TrEMBL
Match: A0A0X3PKQ1 (Tetratricopeptide repeat protein 25 (Fragment) OS=Schistocephalus solidus OX=70667 GN=TTC25 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.722e-23
Identity = 78/277 (28.16%), Postives = 145/277 (52.35%), Query Frame = 2
Query:   59 HSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKK-PVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDR--ISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENPHEVLKHYER 880
            ++++++  +G  L+K  ++ RA+ YL +A +   + V   + R  CYL ++K ++AL + + A ++ K N  A+LL+AE YY+KGEFE+AL  F++G R       F +GV K E  I  +CG +  +   P  +  L+ +   AFP    R+    ++KM    +   K ++K P++  P+I          +  L   E  +  +   L E+EGKR  FL +  I+ +P  +   +  +CE+ ++ ++  A  L+ +C  +++ +P   +KH  R
Sbjct:   32 NAFDAYLNIGRHLIKRKAFARALLYLDEAQKLEETNVTCMLLRGTCYLYLTKLEQALEEGRKAHERKKKNPHAVLLMAEAYYRKGEFEEALTLFERGKRMRPSITAFQIGVYKCEQAIENNCGMDCNLELGP--DLDLTAYYLHAFPPKVTRKAP--EKKMGSKAVSAAKKVEKWPIDMPPEI----------LNTLFGKEYPEYVYLRQLYEVEGKREKFLKQTGITLMPTVLPRIQ--RCEDNRKDVMVCANCLNRKCDLWYKMDPS--MKHDRR 290          
BLAST of Tetratricopeptide repeat protein 25 vs. TrEMBL
Match: A0A3R7DPC7 (Tetratricopeptide repeat protein 25 OS=Clonorchis sinensis OX=79923 GN=ttc25 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 2.192e-22
Identity = 74/279 (26.52%), Postives = 132/279 (47.31%), Query Frame = 2
Query:   26 MESDSESFDKGHSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHD-MNEFKK--NKCENIKEMLVEGATYLDNRCQFYFQENP 853
            M  DS      +S +++Y+V   L     Y+RA++YL  A++Q +  + + + R+ C++ + + D+AL D++  L+ +  N  A+LLLAE YY +G+FE+AL  F +G        +F +GV K E  I+ SC        +   +  L++F + AFP           RK    N K   +  KP E    + P P    + ++  L  +  + F Y  L+++ G   + + ++     D M E     N+ +  ++  V   TYLD     + + +P
Sbjct:    1 MSEDSSERPAFNSVDAYYSVARTLQSRKEYQRALFYLALALKQNDKHIPSYLLRSLCHMYLCETDKALADVQTVLQYEPKNPHALLLLAEIYYLRGDFEEALQTFHRGRILRPTIEQFLVGVHKCETAIQNSCTD---CKIRLTADLDLTNFYEGAFP-----------RKKAARNAKILITRGKPPETPEDLAPWPTTRPKDIQRRLMGQGYNEFTY--LEKMFGDETNRIQQLQSANQDVMPEMNATLNRSKENRKTAVRCGTYLDRHADLFHKLDP 263          
BLAST of Tetratricopeptide repeat protein 25 vs. TrEMBL
Match: A0A068WTS3 (Outer arm dynein binding protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000570300 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.951e-21
Identity = 79/283 (27.92%), Postives = 140/283 (49.47%), Query Frame = 2
Query:   11 LSTERMESDSESFDKGHSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAF-PEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPH-DMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENP 853
            + T    +DSE     + +E++  +G  L+    +KRA++YL KA       V   + RA C+L ++  DE +   K A +  K N  A+LL+AE YY+KG+FE AL  F  G R       F  GV K E  I+ +CG +  V+ K   E  L+D+   AF P+      + + RK  +   +   + KK  E  P+++P       T+R +   + ++  + +++  +EGKR  FL  +  +PH D    + ++C+  ++++ + A  L  +   + + +P
Sbjct:    1 METTHALADSEEEVIFNPFEAYLNIGRHLVCRKDFKRALFYLDKAQGIEPKNVECLLMRATCHLFLTNNDETIELAKAAHEITKRNPHAILLIAEGYYRKGDFEMALKYFINGKRMRSSIEAFTSGVHKCEQAIKNNCGND--VDPKLWPEMDLTDYYSYAFPPKNTSNSFTLDARKATVG--EKDTADKKSTEKWPEMMP-----AETLRKVFGKKYSEYLYIHEMYRVEGKRAEFLKHME-MPHLDDLYVRIDRCKQNRKIVRDCANCLRAKADLWHKIDP 273          
BLAST of Tetratricopeptide repeat protein 25 vs. TrEMBL
Match: A0A4S2LQP9 (TPR_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005534 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.797e-20
Identity = 76/280 (27.14%), Postives = 132/280 (47.14%), Query Frame = 2
Query:   26 MESDSESFDKGHSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISG----VPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENP 853
            M  DS      +S +++Y+V   L     Y+RA++YL  A++Q +  + + + R+ C++ + + D+AL D++  L+ +  N  A+LLLAE YY +G+FE+AL  F +G        +F +GV K E  I+ SC        +   +  L++F + AFP           RK    + K   +  KP E    + P P    + ++  L  +  + F Y  L+++ G   + + R+      V  ++N       EN K  L  G TYLD     + + +P
Sbjct:    1 MSEDSSERPAFNSVDAYYSVARTLQYRKEYQRALFYLALALKQNDKHIPSYLLRSVCHMYLCETDKALADVQTVLQYEPKNPHALLLLAEIYYLRGDFEEALQTFHRGRILRPTIEQFLVGVHKCETAIQNSCTD---CKIRLTADLDLTNFYEGAFP-----------RKKAARSNKILSTRGKPPEIPEDLAPWPATRPKDMQRRLMGQGYNEFTY--LEKMFGDETTRIQRLQNANLDVLPEVNAALNQSKENRKAALRCG-TYLDRHADLFHKLDP 263          
BLAST of Tetratricopeptide repeat protein 25 vs. TrEMBL
Match: A0A2H1CSV5 (Tetratricopeptide repeat protein OS=Fasciola hepatica OX=6192 GN=D915_01878 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.793e-20
Identity = 55/158 (34.81%), Postives = 86/158 (54.43%), Query Frame = 2
Query:   26 MESDSESFDKGHSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFP 499
            M  DS       S +++YA+   L     Y+RA++YL  A+ Q      + + R+ CY+ + + D+AL D+K  L+ +  N  A+LLLAE YY +G+FE+AL  F  G++     + F +GV K E  I+ SC  +  +N  P  +  L+DF   AFP
Sbjct:    1 MSEDSSERPAFKSVDAYYAIARTLQVKKEYQRALFYLALALRQDERHTPSYLLRSLCYMILCETDKALADVKTVLQYEPKNPHALLLLAEIYYLRGDFEEALRTFHLGVKLRPTIDHFMVGVHKCETAIQNSCN-DCKINLSP--DMDLTDFYLRAFP 155          
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Sea Lamprey
Match: ttc25 (tetratricopeptide repeat domain 25 [Source:NCBI gene;Acc:393286])

HSP 1 Score: 68.9366 bits (167), Expect = 1.701e-13
Identity = 78/283 (27.56%), Postives = 122/283 (43.11%), Query Frame = 2
Query:   26 MESDSESFDKG--HSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKF--AMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAF---PEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENP 853
            M SD E   +G   S+ ++ A G  L +   Y RAI   + A++   +     V R++CYL +     AL D + +LK D  N+F   +L  AE  Y  G+FE ALV + +G R      +F LG++K+++ I  S G    V        +L +  D +F   PE   R    +Q+K         +S K   + L ++     YN R  +YL +          D + I+G           V   M          ++E++ EG  YLD R  F+ Q+ P
Sbjct:    1 MNSDEEETQEGPKSSFATYLAEGDKLFQKGDYTRAIESYSTALDIQPNDRNCLVARSKCYLKMGDAQYALRDAEASLKDD--NQFFKGLLWKAEALYVMGDFEFALVFYHRGNRLRPELEEFRLGIQKAQEAIDNSVGSPSSV--------KLENKGDLSFFYKPEEPTRAGKTQQQKQASERENRSQSSKTQRQLLGEL-----YNDR--QYLQR-------LMQDQNLIKGS----------VGGGM---------RVEELIREGLEYLDTRTDFWRQQKP 240          
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Nematostella
Match: EDO42886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S020])

HSP 1 Score: 69.3218 bits (168), Expect = 4.025e-13
Identity = 76/292 (26.03%), Postives = 123/292 (42.12%), Query Frame = 2
Query:   26 MESDSESFDKG--HSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPK----------PNYNKRTVRYLLKSEATDRFF----YNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENP 853
            M  D E  ++G   S+ ++ A G  L K   Y++A+   + A+E   +     V R++CYL + K D A  D + AL++DK+    +   AE  Y  G+FE ALV + +G +      +F LG++K+++ I  S G     N K      L +  D +F   +D              +K  K   KP     K  P+          P  + +TV+ LL     D+ +     ND + I G   S                  K   I E++  G  YL++R +F+ Q+ P
Sbjct:    1 MYEDDEEQEEGPKSSFSTYLAEGDVLFKQEEYQKALDSYSLALELKPTDPFCLVARSKCYLKLGKNDAAYRDAEAALEEDKDFNKGLYQKAEALYAMGDFEYALVYYHRGNKLRPELQEFRLGIQKAQEAIDNSIG--VAANVK------LENKGDLSFFAKQDE-------------MKKPKGYSKPKTQAAKTQPQQLNRGKNTKSPAASDKTVKQLLGEMYADKEYLEKLLNDDNFIHGHACS------------------KDNQIYELVSGGLNYLESRTEFWRQQKP 253          
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Medaka
Match: ttc25 (tetratricopeptide repeat domain 25 [Source:NCBI gene;Acc:101170435])

HSP 1 Score: 54.299 bits (129), Expect = 7.556e-8
Identity = 35/130 (26.92%), Postives = 61/130 (46.92%), Query Frame = 2
Query:   62 SYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYK 451
            S+ +  + G  LL    Y+RA    T  ++         + R+ CYL   +   AL D +++LK DK+    +   A+  +  GEFE +LV + +G         F LG++K+++ I+ + G    V  K
Sbjct:   15 SFSTLVSAGKQLLHKREYRRAQSSFTAILDLKPEDKECLIGRSNCYLNTGQLQNALRDAELSLKHDKSFPEGVYQKAKVLFYMGEFEFSLVFYHRGQSIRTQMQCFTLGIKKAQEAIKNAVGDSTNVKLK 144          
BLAST of Tetratricopeptide repeat protein 25 vs. Planmine SMEST
Match: SMESG000011030.1 (SMESG000011030.1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 303/303 (100.00%), Postives = 303/303 (100.00%), Query Frame = 2
Query:   26 MESDSESFDKGHSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENPHEVLKHYERKKASKYETDTVALNSFKN 934
            MESDSESFDKGHSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENPHEVLKHYERKKASKYETDTVALNSFKN
Sbjct:    1 MESDSESFDKGHSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENPHEVLKHYERKKASKYETDTVALNSFKN 303          
BLAST of Tetratricopeptide repeat protein 25 vs. Planmine SMEST
Match: SMESG000067442.1 (SMESG000067442.1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.679e-16
Identity = 76/278 (27.34%), Postives = 121/278 (43.53%), Query Frame = 2
Query:   65 YESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRAQVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSL-KKPV-EALPKIVPKP-NYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENPHEVLKHYERKKA 889
            +ES    G   +       A+   ++A+E         V R++CYL   + D+AL D   +L  +  N   +   AE YY + EFEKALV + +G +       F LG++KSE+ I  S G    +  +   +  LS F                    +    KN + L KKP  E   K+  KP N + +TV+ LL    +DR F   L+++  +  S +++     H            I+ ++V+G  YLD R  F+ Q+ P    K Y+ KK+
Sbjct:   32 FESLRDEGDHFMHVQKISNAVESYSRALELQAGHEHCLVARSRCYLLEGQMDKALADADASLGTNNKNPKGIFQKAEVYYFQSEFEKALVLYHRGHKLRPEMEAFRLGIQKSEEAINNSVGDPETIKLR--LDCDLSYF-------------------FLNTEKKNDRMLKKKPAQEKKQKLERKPCNTDSKTVKQLLGELYSDREF---LEKLLNEEESLVNKTENSEH------------IRHLVVKGLNYLDERSDFWQQQKPMYARKKYQYKKS 273          
BLAST of Tetratricopeptide repeat protein 25 vs. Planmine SMEST
Match: SMESG000067442.1 (SMESG000067442.1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.301e-11
Identity = 65/228 (28.51%), Postives = 101/228 (44.30%), Query Frame = 2
Query:  215 FDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEKALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLSDFNDEAFPEIRDREISKEQRKMVLMNLKNQKSL-KKPV-EALPKIVPKP-NYNKRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKCENIKEMLVEGATYLDNRCQFYFQENPHEVLKHYERKKA 889
             D+AL D   +L  +  N   +   AE YY + EFEKALV + +G +       F LG++KSE+ I  S G    +  +   +  LS F                    +    KN + L KKP  E   K+  KP N + +TV+ LL    +DR F   L+++  +  S +++     H            I+ ++V+G  YLD R  F+ Q+ P    K Y+ KK+
Sbjct:    1 MDKALADADASLGTNNKNPKGIFQKAEVYYFQSEFEKALVLYHRGHKLRPEMEAFRLGIQKSEEAINNSVGDPETIKLR--LDCDLSYF-------------------FLNTEKKNDRMLKKKPAQEKKQKLERKPCNTDSKTVKQLLGELYSDREF---LEKLLNEEESLVNKTENSEH------------IRHLVVKGLNYLDERSDFWQQQKPMYARKKYQYKKS 192          
The following BLAST results are available for this feature:
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TTC257.671e-1023.72tetratricopeptide repeat domain 25 [Source:HGNC Sy... [more]
TTC255.422e-923.93tetratricopeptide repeat domain 25 [Source:HGNC Sy... [more]
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG135021.495e-1535.29gene:FBgn0034692 transcript:FBtr0071799[more]
CG135021.288e-1434.55gene:FBgn0034692 transcript:FBtr0308241[more]
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc254.368e-1024.24tetratricopeptide repeat domain 25 [Source:NCBI ge... [more]
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TTC258.644e-720.83tetratricopeptide repeat domain 25 [Source:NCBI ge... [more]
TTC251.151e-623.22tetratricopeptide repeat domain 25 [Source:NCBI ge... [more]
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ttc254.626e-1031.45tetratricopeptide repeat domain 25 [Source:MGI Sym... [more]
Ttc256.781e-1031.45tetratricopeptide repeat domain 25 [Source:MGI Sym... [more]
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q7ZU45|TTC25_DANRE2.959e-924.24Tetratricopeptide repeat protein 25 OS=Danio rerio... [more]
sp|Q9D4B2|TTC25_MOUSE4.743e-931.45Tetratricopeptide repeat protein 25 OS=Mus musculu... [more]
sp|Q96NG3|TTC25_HUMAN2.604e-823.93Tetratricopeptide repeat protein 25 OS=Homo sapien... [more]
sp|Q32NU8|TTC25_XENLA1.236e-623.42Tetratricopeptide repeat protein 25 OS=Xenopus lae... [more]
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PKQ11.722e-2328.16Tetratricopeptide repeat protein 25 (Fragment) OS=... [more]
A0A3R7DPC72.192e-2226.52Tetratricopeptide repeat protein 25 OS=Clonorchis ... [more]
A0A068WTS37.951e-2127.92Outer arm dynein binding protein OS=Echinococcus g... [more]
A0A4S2LQP92.797e-2027.14TPR_REGION domain-containing protein OS=Opisthorch... [more]
A0A2H1CSV53.793e-2034.81Tetratricopeptide repeat protein OS=Fasciola hepat... [more]
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc251.701e-1327.56tetratricopeptide repeat domain 25 [Source:NCBI ge... [more]
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO428864.025e-1326.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc257.556e-826.92tetratricopeptide repeat domain 25 [Source:NCBI ge... [more]
back to top
BLAST of Tetratricopeptide repeat protein 25 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000011030.10.000e+0100.00SMESG000011030.1[more]
SMESG000067442.12.679e-1627.34SMESG000067442.1[more]
SMESG000067442.12.301e-1128.51SMESG000067442.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001450 ID=SMED30001450|Name=Tetratricopeptide repeat protein 25|organism=Schmidtea mediterranea sexual|type=transcript|length=979bp
GCGGAATTGATTATCAACAGAAAGAATGGAATCAGATTCAGAGTCATTCG
ACAAAGGGCATTCCTATGAATCCTTCTATGCCGTCGGCCACGCATTATTG
AAATCGACAAGCTACAAAAGAGCCATTTATTATTTGACTAAAGCGATTGA
GCAGACTAATTCCAAAGTCCGAGCTCAAGTTGAAAGAGCTCAATGCTATT
TGGCCATTAGTAAATTCGATGAAGCCTTGTTTGATTTGAAGGTCGCCTTA
AAAAAGGATAAAAACAATAAATTCGCAATGCTTCTATTAGCCGAGACTTA
CTACCAGAAAGGGGAATTCGAAAAGGCTCTCGTTTGTTTTCAGAAAGGTC
TTCGGAAATATAAATTAGACAACAAATTCTACCTCGGTGTTCGGAAGTCG
GAAGATAGAATCAGAGCTTCGTGTGGAAAAGAATATTTGGTCAATTATAA
ACCTTTAACTGAGACCCAGTTGAGTGATTTCAATGATGAAGCTTTTCCAG
AAATACGAGATCGGGAAATTTCGAAGGAGCAACGAAAAATGGTGTTGATG
AATTTGAAAAATCAAAAGTCATTGAAGAAACCAGTTGAGGCTTTGCCGAA
AATTGTTCCAAAACCCAATTATAACAAACGTACTGTTAGATATTTGCTGA
AAAGCGAAGCAACTGACAGGTTTTTTTATAATGACCTAGACGAGATTGAA
GGCAAGCGAATTAGTTTTCTTGACAGAATTTCTGGAGTTCCTCACGATAT
GAATGAGTTCAAGAAAAATAAATGTGAAAATATAAAGGAAATGCTCGTGG
AAGGAGCAACTTACCTTGACAACCGTTGCCAGTTCTATTTTCAGGAAAAT
CCTCATGAAGTGCTGAAACACTACGAAAGAAAAAAGGCATCGAAATATGA
AACTGACACAGTTGCTTTAAATTCTTTCAAAAACTAATGAAATTGAAAAT
ATATAAACAAATTATTGTATCAATATTTC
back to top

protein sequence of SMED30001450-orf-1

>SMED30001450-orf-1 ID=SMED30001450-orf-1|Name=SMED30001450-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
MESDSESFDKGHSYESFYAVGHALLKSTSYKRAIYYLTKAIEQTNSKVRA
QVERAQCYLAISKFDEALFDLKVALKKDKNNKFAMLLLAETYYQKGEFEK
ALVCFQKGLRKYKLDNKFYLGVRKSEDRIRASCGKEYLVNYKPLTETQLS
DFNDEAFPEIRDREISKEQRKMVLMNLKNQKSLKKPVEALPKIVPKPNYN
KRTVRYLLKSEATDRFFYNDLDEIEGKRISFLDRISGVPHDMNEFKKNKC
ENIKEMLVEGATYLDNRCQFYFQENPHEVLKHYERKKASKYETDTVALNS
FKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR040111TTC25
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 82..115
e-value: 5.0
score: 16.1
coord: 14..47
e-value: 30.0
score: 10.8
coord: 48..81
e-value: 0.23
score: 20.5
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 4..151
e-value: 1.7E-19
score: 72.4
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 14..113
NoneNo IPR availablePFAMPF14559TPR_19coord: 63..114
e-value: 1.8E-6
score: 28.3
IPR040111Tetratricopeptide repeat protein 25PANTHERPTHR23040UNCHARACTERIZEDcoord: 10..288
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 14..115
score: 19.535