Propionyl-CoA carboxylase subunit beta

Overview
NamePropionyl-CoA carboxylase subunit beta
Smed IDSMED30001449
Length (bp)1722
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Propionyl-CoA carboxylase subunit beta (SMED30001449) t-SNE clustered cells

Violin plots show distribution of expression levels for Propionyl-CoA carboxylase subunit beta (SMED30001449) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Propionyl-CoA carboxylase subunit beta (SMED30001449) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Propionyl-CoA carboxylase subunit beta (SMED30001449) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001449

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior pole progenitor cellSMED30001449 SMED30001449smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30001449 dd_Smed_v4_513_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001449 dd_Smed_v4_513_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30001449 dd_Smed_v4_513_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001449 dd_Smed_v4_513_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001449 dd_Smed_v4_513_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30001449 dd_Smed_v6_513_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30001449 OX_Smed_1.0.10823ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30001449 dd_Smed_v6_513_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Human
Match: PCCB (propionyl-CoA carboxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8654])

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 373/474 (78.69%), Postives = 422/474 (89.03%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            S   +V ++I+  R  ALLGGG +RIDAQH +GKLTARERI LL D   FVE DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHT++SGVAH+AFENDVDAL  LR+FF +LP S++  +P+R  HDP DRLVP LDT+VPLEST AYNM+D+IH VVDE EFFEIMP YAKNII+GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPK+T+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  N + + +AEY++KFANPFPA+VRG +
Sbjct:   30 SQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE-AAQAEYIEKFANPFPAAVRGFV 502          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Human
Match: PCCB (propionyl-CoA carboxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8654])

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 373/474 (78.69%), Postives = 422/474 (89.03%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            S   +V ++I+  R  ALLGGG +RIDAQH +GKLTARERI LL D   FVE DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHT++SGVAH+AFENDVDAL  LR+FF +LP S++  +P+R  HDP DRLVP LDT+VPLEST AYNM+D+IH VVDE EFFEIMP YAKNII+GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPK+T+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  N + + +AEY++KFANPFPA+VRG +
Sbjct:   30 SQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE-AAQAEYIEKFANPFPAAVRGFV 502          

HSP 2 Score: 61.2326 bits (147), Expect = 3.581e-9
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR++IC DLD+L  K +  PW+KH NIPL
Sbjct:  494 FPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL 539          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Human
Match: PCCB (propionyl-CoA carboxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8654])

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 373/494 (75.51%), Postives = 422/494 (85.43%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQ--------------------DFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            S   +V ++I+  R  ALLGGG +RIDAQH +GKLTARERI LL D   FVE DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQ                    DFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHT++SGVAH+AFENDVDAL  LR+FF +LP S++  +P+R  HDP DRLVP LDT+VPLEST AYNM+D+IH VVDE EFFEIMP YAKNII+GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPK+T+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  N + + +AEY++KFANPFPA+VRG +
Sbjct:   30 SQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQQIIGWAQWLPLVISALWEAEDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE-AAQAEYIEKFANPFPAAVRGFV 522          

HSP 2 Score: 60.8474 bits (146), Expect = 4.049e-9
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR++IC DLD+L  K +  PW+KH NIPL
Sbjct:  514 FPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL 559          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Human
Match: PCCB (propionyl-CoA carboxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8654])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 374/494 (75.71%), Postives = 422/494 (85.43%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVA--------------------AGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            S   +V ++I+  R  ALLGGG +RIDAQH +GKLTARERI LL D   FVE DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHT++SGVAH+AFENDVDAL  LR+FF +LP S++  +P+R  HDP DRLVP LDT+VPLEST AYNM+D+IH VVDE EFFEIMP YAKNII+GF RM+GRTVGI+GNQPKVA                    AGCLDIN+SVKGARFVRFCDAFNIPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPK+T+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  N + + +AEY++KFANPFPA+VRG +
Sbjct:   30 SQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPKVASDSISFTPWNYARRQYRPYFAGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE-AAQAEYIEKFANPFPAAVRGFV 522          

HSP 2 Score: 60.8474 bits (146), Expect = 3.745e-9
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR++IC DLD+L  K +  PW+KH NIPL
Sbjct:  514 FPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL 559          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Human
Match: PCCB (propionyl-CoA carboxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8654])

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 373/505 (73.86%), Postives = 422/505 (83.56%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQ-------------------------------DFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            S   +V ++I+  R  ALLGGG +RIDAQH +GKLTARERI LL D   FVE DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQ                               DFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHT++SGVAH+AFENDVDAL  LR+FF +LP S++  +P+R  HDP DRLVP LDT+VPLEST AYNM+D+IH VVDE EFFEIMP YAKNII+GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPK+T+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  N + + +AEY++KFANPFPA+VRG +
Sbjct:   30 SQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQIRASAMSPRLVSDSWTQAIHLPWPPKVLGLQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE-AAQAEYIEKFANPFPAAVRGFV 533          

HSP 2 Score: 60.8474 bits (146), Expect = 4.141e-9
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR++IC DLD+L  K +  PW+KH NIPL
Sbjct:  525 FPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL 570          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Celegans
Match: pccb-1 (Propionyl Coenzyme A Carboxylase Beta subunit [Source:UniProtKB/TrEMBL;Acc:Q8WQF1])

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 370/484 (76.45%), Postives = 418/484 (86.36%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLLMILLNHGELDRK 1613
            +HT+ V  KIDETR KALLGGG KR+DAQH++GKLTARERI LL D N F E+DMF EH C+DFGMQ  ++PGDSV+TG G+I+GR  F+FSQDFTVFGGSLS  HAKKI K+M +AMLVGAPVIGLNDSGGARIQEGV SLAGYA+IFQ NVMASGV+PQIS+IMGPCAGGAVYSPALTDFTFMV+DTSYLFITGPDVVK+VTNE+VTQEELGGAKTHT  SGVAH AF+NDVDALM LRE F +LP SN   +PIR + DP DR VP+LDTVVPLESTAAYNM DV+H +VDE +FFEIMP YAKN++IGF RM+GRTVGI+GN PK AAGCLDIN+SVKGARFVRFCDAFNIP++T VDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKITIITRKA+GGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAV I+FR      +  E EY + F+NPFPA+VRG +  ++   E  +K
Sbjct:   14 AHTIKVAHKIDETREKALLGGGKKRVDAQHARGKLTARERIDLLLDRNTFREYDMFAEHTCNDFGMQKEKYPGDSVVTGRGEINGRTVFVFSQDFTVFGGSLSSIHAKKIVKIMREAMLVGAPVIGLNDSGGARIQEGVESLAGYADIFQENVMASGVVPQISMIMGPCAGGAVYSPALTDFTFMVRDTSYLFITGPDVVKAVTNEEVTQEELGGAKTHTVTSGVAHGAFDNDVDALMSLRELFNYLPLSNTDAAPIRAAEDPWDRAVPSLDTVVPLESTAAYNMKDVVHALVDEGDFFEIMPDYAKNLVIGFARMNGRTVGIVGNNPKFAAGCLDINSSVKGARFVRFCDAFNIPIITLVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITIITRKAFGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVSILFRNDKEHAVQHEEEYTELFSNPFPAAVRGFVDDIIIPSETRKK 497          

HSP 2 Score: 68.1662 bits (165), Expect = 6.710e-12
Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII P  TR K+C+DL++L+ K L NPWKKHGNIPL
Sbjct:  477 FPAAVRGFVDDIIIPSETRKKVCEDLNMLESKKLKNPWKKHGNIPL 522          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Celegans
Match: pccb-1 (Propionyl Coenzyme A Carboxylase Beta subunit [Source:UniProtKB/TrEMBL;Acc:Q8WQF1])

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 370/484 (76.45%), Postives = 418/484 (86.36%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLLMILLNHGELDRK 1613
            +HT+ V  KIDETR KALLGGG KR+DAQH++GKLTARERI LL D N F E+DMF EH C+DFGMQ  ++PGDSV+TG G+I+GR  F+FSQDFTVFGGSLS  HAKKI K+M +AMLVGAPVIGLNDSGGARIQEGV SLAGYA+IFQ NVMASGV+PQIS+IMGPCAGGAVYSPALTDFTFMV+DTSYLFITGPDVVK+VTNE+VTQEELGGAKTHT  SGVAH AF+NDVDALM LRE F +LP SN   +PIR + DP DR VP+LDTVVPLESTAAYNM DV+H +VDE +FFEIMP YAKN++IGF RM+GRTVGI+GN PK AAGCLDIN+SVKGARFVRFCDAFNIP++T VDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKITIITRKA+GGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAV I+FR      +  E EY + F+NPFPA+VRG +  ++   E  +K
Sbjct:   28 AHTIKVAHKIDETREKALLGGGKKRVDAQHARGKLTARERIDLLLDRNTFREYDMFAEHTCNDFGMQKEKYPGDSVVTGRGEINGRTVFVFSQDFTVFGGSLSSIHAKKIVKIMREAMLVGAPVIGLNDSGGARIQEGVESLAGYADIFQENVMASGVVPQISMIMGPCAGGAVYSPALTDFTFMVRDTSYLFITGPDVVKAVTNEEVTQEELGGAKTHTVTSGVAHGAFDNDVDALMSLRELFNYLPLSNTDAAPIRAAEDPWDRAVPSLDTVVPLESTAAYNMKDVVHALVDEGDFFEIMPDYAKNLVIGFARMNGRTVGIVGNNPKFAAGCLDINSSVKGARFVRFCDAFNIPIITLVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITIITRKAFGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVSILFRNDKEHAVQHEEEYTELFSNPFPAAVRGFVDDIIIPSETRKK 511          

HSP 2 Score: 68.1662 bits (165), Expect = 6.892e-12
Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII P  TR K+C+DL++L+ K L NPWKKHGNIPL
Sbjct:  491 FPAAVRGFVDDIIIPSETRKKVCEDLNMLESKKLKNPWKKHGNIPL 536          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Celegans
Match: pccb-1 (Propionyl Coenzyme A Carboxylase Beta subunit [Source:UniProtKB/TrEMBL;Acc:Q8WQF1])

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 370/484 (76.45%), Postives = 418/484 (86.36%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLLMILLNHGELDRK 1613
            +HT+ V  KIDETR KALLGGG KR+DAQH++GKLTARERI LL D N F E+DMF EH C+DFGMQ  ++PGDSV+TG G+I+GR  F+FSQDFTVFGGSLS  HAKKI K+M +AMLVGAPVIGLNDSGGARIQEGV SLAGYA+IFQ NVMASGV+PQIS+IMGPCAGGAVYSPALTDFTFMV+DTSYLFITGPDVVK+VTNE+VTQEELGGAKTHT  SGVAH AF+NDVDALM LRE F +LP SN   +PIR + DP DR VP+LDTVVPLESTAAYNM DV+H +VDE +FFEIMP YAKN++IGF RM+GRTVGI+GN PK AAGCLDIN+SVKGARFVRFCDAFNIP++T VDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKITIITRKA+GGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAV I+FR      +  E EY + F+NPFPA+VRG +  ++   E  +K
Sbjct:   28 AHTIKVAHKIDETREKALLGGGKKRVDAQHARGKLTARERIDLLLDRNTFREYDMFAEHTCNDFGMQKEKYPGDSVVTGRGEINGRTVFVFSQDFTVFGGSLSSIHAKKIVKIMREAMLVGAPVIGLNDSGGARIQEGVESLAGYADIFQENVMASGVVPQISMIMGPCAGGAVYSPALTDFTFMVRDTSYLFITGPDVVKAVTNEEVTQEELGGAKTHTVTSGVAHGAFDNDVDALMSLRELFNYLPLSNTDAAPIRAAEDPWDRAVPSLDTVVPLESTAAYNMKDVVHALVDEGDFFEIMPDYAKNLVIGFARMNGRTVGIVGNNPKFAAGCLDINSSVKGARFVRFCDAFNIPIITLVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITIITRKAFGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVSILFRNDKEHAVQHEEEYTELFSNPFPAAVRGFVDDIIIPSETRKK 511          

HSP 2 Score: 68.1662 bits (165), Expect = 6.892e-12
Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII P  TR K+C+DL++L+ K L NPWKKHGNIPL
Sbjct:  491 FPAAVRGFVDDIIIPSETRKKVCEDLNMLESKKLKNPWKKHGNIPL 536          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Celegans
Match: F02A9.10 (Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34385])

HSP 1 Score: 223.787 bits (569), Expect = 5.230e-65
Identity = 156/495 (31.52%), Postives = 242/495 (48.89%), Query Frame = 3
Query:   78 SINYFRIYSPLLNLSRCFATNAVPLQGSSHTLAVK-KKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENE-FVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGA---RIQEGVASLAGYAEIF-QRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDT--VVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDK 1538
            ++ +  I + + N S  FA N   ++     L  K  KI++        GG K +    S+GK+ ARERI  + D    F+E+     ++   +G +    P   ++TG G + GR   I + D TV GG+      KK  +  + A     P I L DSGGA   R  +  A    +  IF  +  M+S  IPQ++++MG C  G  Y PA++D   +VK T  +F+ GP +VK+ T E+++ EELGGA  H   SGV      ND  AL   R     LP     H     + D P  L PA +   +V       Y++ +VI  +VD S F E    Y + ++ GF  ++G+ VGI+ N      G L   +++KG+ F+  C    IPLL   ++ GF+ G + E GGI +HGAKL+ A A A VPKIT++   +YG     M  +       + WP + ++VMG + A  ++      ++  + A++ D+
Sbjct:   70 TLQWAPIKTSIDNSSDDFAANTAEMKVLVEDLKAKISKIEQA-------GGEKAVKLHRSRGKMLARERIDGIVDAGSPFIEFSQLAGYEM--YGKE--EVPSGGILTGVGIVSGRVCVIVANDATVKGGTYYPITVKKHLRAQEIARENKLPCIYLVDSGGANLPRQADIFADSQHFGRIFYNQATMSSEGIPQLAVVMGSCTAGGAYVPAMSDQAIIVKGTGTVFLGGPPLVKAATGEEISAEELGGADLHCGESGVTDYYAHNDKHALYLARSCIAGLPPVEE-HMTFNPNADEP--LYPAEEIYGIVGSNLKKTYDVREVIARIVDGSRFHEFKERYGETLVTGFATIYGQRVGILANN-----GVLFAESAMKGSHFIELCCQRKIPLLFLQNITGFMVGRDAEAGGIAKHGAKLVTAVACAKVPKITVLVGGSYGAGNYGMCGRGYSPRYVFMWPNSRISVMGGEQAANVLSTVQKEKKKREGADWTDQ 545          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Celegans
Match: pod-2 (pep chromosome:WBcel235:II:1143908:1152665:1 gene:WBGene00004076.1 transcript:W09B6.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pod-2)

HSP 1 Score: 70.0922 bits (170), Expect = 3.486e-12
Identity = 75/313 (23.96%), Postives = 136/313 (43.45%), Query Frame = 3
Query:  573 GVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDV--TQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPI--RHSHDPPDRLVPALDTVVPLESTA-AYNMLDVIH--------GVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARF--------VRFCD-AF------------NIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITR--KAYGGAYDVMSSK 1403
            GV +L G   I      A   +P    + G   G   Y+  L       K  S+L +TG + + ++  + V  +  +LGG +     +GV H   +ND++ + ++  + +FLP       P   +H  D       A D V+P +S    Y++ D+I         G+ D   F EI   +AK+I+ G  R+ G  +G++ ++ +  +  +  + ++ G++         V + D AF            N+PL+    + GF  G    +  +++ GA+++ A A    P I  I    +  GGA+ V+ SK
Sbjct: 1548 GVENLQGSGLIAGETARAYAEVPTYCYVTGRSVGIGAYTARLAHRIVQHKQ-SHLILTGYEALNTLLGKKVYTSNNQLGGPEVMFR-NGVTHAVVDNDLEGIAKVIRWMSFLPTPTE-EFPFFSKHGDD-----CSARDVVIPSDSEQNTYDVRDLIDSKNLSNQTGICDTMSFDEICGDWAKSIVAGRARLCGIPIGVVSSEFRNFSTIVPADPAIDGSQVQNTQRAGQVWYPDSAFKTAEAINDLNKENLPLMIIASLRGFSGGQKDMYDMVLKFGAQIVDALAVYNRPVIVYIPEAGELRGGAWAVLDSK 1852          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Fly
Match: Mccc2 (gene:FBgn0042083 transcript:FBtr0086126)

HSP 1 Score: 225.328 bits (573), Expect = 8.125e-66
Identity = 153/475 (32.21%), Postives = 238/475 (50.11%), Query Frame = 3
Query:  204 NKALLGGGVKRIDAQHSKGKLTARERIHLLCDENE-FVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAG---YAEIF--QRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQS--NRLHSPIRHSHD-------PPDRLV-PALDT-----VVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASV 1565
            ++ L GGG K I+   S+GKL ARERI+LL D+   F+E      H+   +G +     G  ++TG G++ G    + + D TV GGS      KK  +  + A     P I L DSGGA +            +  IF  Q N+ A G IPQI+++MG C  G  Y PA+ D + +VK    +F+ GP +VK+ T E+V+ E+LGGA  H   SGV      +D  AL   R+  + L  S  N  +  + HS         PP  +  P  D      +V    T ++++ +VI  +VD S F E    Y + ++ GF +++G TVGI+GN      G L   +++KGA F++ C    IPL+   ++ GF+ G + E  GI ++GAK++ A A A VPK T+I   +YG     M  +       Y WP + ++VMG   A  ++ + + +++     E+ ++ A    A +
Sbjct:   60 SQVLKGGGQKAIERHTSRGKLLARERINLLLDKGSPFLELSALAGHEL--YGEEVVNSGG--IVTGVGRVCGTECLVVANDATVKGGSYYPITVKKHLRAQEIAQENRLPCIYLVDSGGANLPRQADVFPDKLHFGRIFYNQANMSAQG-IPQIAVVMGSCTAGGAYVPAMADESIIVKKQGTIFLAGPPLVKAATGEEVSAEDLGGADLHCKTSGVTDHYALDDEHALYLARQIVSNLNLSATNSYNDQLMHSSQVNFQTATPPSAVEEPRYDAEELYGIVGPNLTKSFDVREVIARIVDGSRFTEFKKLYGETLVCGFAKLYGHTVGIVGNN-----GVLFSESALKGAHFIQLCAQRKIPLVFLQNITGFMVGRDAEANGIAKNGAKMVTAVACANVPKFTVIIGGSYGAGNYGMCGRAYSPRFLYMWPNSRISVMGGTQAANVMAQITEDQRKRAGKEFSEEEAQKLKAPI 524          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Fly
Match: ACC (gene:FBgn0033246 transcript:FBtr0339124)

HSP 1 Score: 65.0846 bits (157), Expect = 1.463e-10
Identity = 69/289 (23.88%), Postives = 122/289 (42.21%), Query Frame = 3
Query:  723 DTSYLFITGPDVVKSVTNEDV--TQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLE-------STAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAA-------GCLDINA--------------SVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKA--YGGAYDVMSSK-HLRGDINYAWPTAEVAVMGAKGAVQIIFR 1490
            D S++ +TG   +  +    V  +  +LGG +   + +GV HK    D+D +  + ++ +++P       PI   +D  +R V  + T  P +            N  D  +G  D   + EIM ++AK ++ G  R+ G  VG+I  + +            LD  A              S K A+ ++      +PL+ F +  GF  G    +  I++ GA ++    E   P +  +   A   GGA+ V+ S  + R    YA P A   V+  +G V+I ++
Sbjct: 1814 DNSHIILTGYAALNKLLGRKVYASNNQLGGTQIMFN-NGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPIVLPNDRIERPVDFMPTKSPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPEARGGVLEPEGIVEIKYK 2101          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Fly
Match: ACC (gene:FBgn0033246 transcript:FBtr0339125)

HSP 1 Score: 65.0846 bits (157), Expect = 1.463e-10
Identity = 69/289 (23.88%), Postives = 122/289 (42.21%), Query Frame = 3
Query:  723 DTSYLFITGPDVVKSVTNEDV--TQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLE-------STAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAA-------GCLDINA--------------SVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKA--YGGAYDVMSSK-HLRGDINYAWPTAEVAVMGAKGAVQIIFR 1490
            D S++ +TG   +  +    V  +  +LGG +   + +GV HK    D+D +  + ++ +++P       PI   +D  +R V  + T  P +            N  D  +G  D   + EIM ++AK ++ G  R+ G  VG+I  + +            LD  A              S K A+ ++      +PL+ F +  GF  G    +  I++ GA ++    E   P +  +   A   GGA+ V+ S  + R    YA P A   V+  +G V+I ++
Sbjct: 1814 DNSHIILTGYAALNKLLGRKVYASNNQLGGTQIMFN-NGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPIVLPNDRIERPVDFMPTKSPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPEARGGVLEPEGIVEIKYK 2101          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Fly
Match: ACC (gene:FBgn0033246 transcript:FBtr0088872)

HSP 1 Score: 65.0846 bits (157), Expect = 1.463e-10
Identity = 69/289 (23.88%), Postives = 122/289 (42.21%), Query Frame = 3
Query:  723 DTSYLFITGPDVVKSVTNEDV--TQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLE-------STAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAA-------GCLDINA--------------SVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKA--YGGAYDVMSSK-HLRGDINYAWPTAEVAVMGAKGAVQIIFR 1490
            D S++ +TG   +  +    V  +  +LGG +   + +GV HK    D+D +  + ++ +++P       PI   +D  +R V  + T  P +            N  D  +G  D   + EIM ++AK ++ G  R+ G  VG+I  + +            LD  A              S K A+ ++      +PL+ F +  GF  G    +  I++ GA ++    E   P +  +   A   GGA+ V+ S  + R    YA P A   V+  +G V+I ++
Sbjct: 1814 DNSHIILTGYAALNKLLGRKVYASNNQLGGTQIMFN-NGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPIVLPNDRIERPVDFMPTKSPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPEARGGVLEPEGIVEIKYK 2101          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Fly
Match: ACC (gene:FBgn0033246 transcript:FBtr0113053)

HSP 1 Score: 65.0846 bits (157), Expect = 1.463e-10
Identity = 69/289 (23.88%), Postives = 122/289 (42.21%), Query Frame = 3
Query:  723 DTSYLFITGPDVVKSVTNEDV--TQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLE-------STAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAA-------GCLDINA--------------SVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKA--YGGAYDVMSSK-HLRGDINYAWPTAEVAVMGAKGAVQIIFR 1490
            D S++ +TG   +  +    V  +  +LGG +   + +GV HK    D+D +  + ++ +++P       PI   +D  +R V  + T  P +            N  D  +G  D   + EIM ++AK ++ G  R+ G  VG+I  + +            LD  A              S K A+ ++      +PL+ F +  GF  G    +  I++ GA ++    E   P +  +   A   GGA+ V+ S  + R    YA P A   V+  +G V+I ++
Sbjct: 1814 DNSHIILTGYAALNKLLGRKVYASNNQLGGTQIMFN-NGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPIVLPNDRIERPVDFMPTKSPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPEARGGVLEPEGIVEIKYK 2101          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Zebrafish
Match: pccb (propionyl-CoA carboxylase subunit beta [Source:ZFIN;Acc:ZDB-GENE-040426-2467])

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 385/509 (75.64%), Postives = 443/509 (87.03%), Query Frame = 3
Query:  102 SPLLNLSRCFATNAVPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLLMILLNHGELDRKYVK 1622
            S +L  +RC++        SSH ++V+++I++ R  AL GGG  RI AQH +GKLTARER+ LL D + FVE+DMFVEH CSDFGM+A  N++PGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQAMLVGAPVIGLNDSGGARIQEGV SLAGYA+IF RNVMASGV+PQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHT+VSGVAH+AFEND+DAL+ LR+FF FLP SN+  +P+   HDP DRLVP LDTVVP EST AY+MLD++HG+VDE EFFEIMP YAKNI++GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIP++TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKIT+ITRKAYGGAYDVMSSKHLRGD+NYAWPTAEVAVMGAKGAVQIIFRG  N Q   EAEYV+KFANPFPA+VRG +  ++      R+  +
Sbjct:   35 SKVLQNARCYS--------SSH-MSVQERIEQKRQAALTGGGQLRIAAQHKRGKLTARERVELLLDADSFVEYDMFVEHRCSDFGMEADQNKYPGDSVVTGQGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAMLVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVMASGVVPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTAVSGVAHRAFENDIDALLNLRDFFNFLPLSNKDSAPVVECHDPRDRLVPGLDTVVPFESTKAYDMLDIVHGIVDEREFFEIMPNYAKNIVVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPIITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYDVMSSKHLRGDVNYAWPTAEVAVMGAKGAVQIIFRGKQN-QAEAEAEYVEKFANPFPAAVRGFVDDIIQPSTTRRRICR 533          

HSP 2 Score: 62.7734 bits (151), Expect = 6.376e-10
Identity = 26/46 (56.52%), Postives = 34/46 (73.91%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR +IC+DL++L  K  +NPWKKH NIPL
Sbjct:  510 FPAAVRGFVDDIIQPSTTRRRICRDLEVLASKKQTNPWKKHANIPL 555          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Zebrafish
Match: mccc2 (methylcrotonoyl-CoA carboxylase 2 (beta) [Source:ZFIN;Acc:ZDB-GENE-040426-2493])

HSP 1 Score: 211.46 bits (537), Expect = 1.338e-60
Identity = 150/461 (32.54%), Postives = 226/461 (49.02%), Query Frame = 3
Query:  174 AVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDE-NEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAG---YAEIF-QRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDR-LVPA--LDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYV 1532
            A+ K++ +   K  LGGG K  +   S+GKL  RERI  L D  + F+E+  F  +    +G +    P   +ITG G++ G    I + D TV GG+      KK  +  + A     P I L DSGGA +            +  IF  +  ++S  I QI+++MG C  G  Y PA+ D + +V+    +F+ GP +VK+ T E+V+ E+LGGA  H   SGV      +D  AL   R+    L     L   +    +PP+  L PA  L  +V       +++ +VI  +VD S+F E    Y   +I GF R+ G  VGIIGN      G L   ++ KG  F+  C   NIPLL   ++ GF+ G   E GGI + GAK++ A A A VPKIT+I   +YG     M  +       Y WP + ++VMG + A  ++   + +++  +  E+ 
Sbjct:   54 ALVKELKDRAEKIKLGGGEKARNLHTSRGKLLPRERIDRLLDPGSPFLEFSQFAAYQL--YGKE--EVPAGGIITGIGRVSGVECLIVANDATVKGGTYYPVTVKKHLRAQEIAQQNHLPCIYLVDSGGANLPRQADVFPDRDHFGRIFFNQARLSSEGISQIAVVMGSCTAGGAYVPAMADESIIVRKQGTIFLGGPPLVKAATGEEVSAEDLGGADLHCRKSGVTDHYALDDNHALHLARKAVRSLNYKKNLDVTV----EPPEAPLFPADELYGIVGDNLKRNFDIREVIARIVDGSKFDEFKAFYGDTLITGFARIFGYPVGIIGNN-----GVLFSESAKKGTHFIELCCQRNIPLLFLQNITGFMVGREYEAGGIAKDGAKMVTAVACANVPKITVIIGGSYGAGNYGMCGRAYGPRFLYMWPNSRISVMGGEQAATVLATITKDQKAREGKEFT 501          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Zebrafish
Match: si:ch211-198n5.11 (si:ch211-198n5.11 [Source:ZFIN;Acc:ZDB-GENE-050411-52])

HSP 1 Score: 166.007 bits (419), Expect = 7.970e-44
Identity = 124/485 (25.57%), Postives = 228/485 (47.01%), Query Frame = 3
Query:  165 HTLAVKKKIDETRNKALLGGGVKRIDAQHSK--GKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGA--RIQEGV--ASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTF----LPQSN--RLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDV---PGFLPGTNQEFGGIIRHGAK--LLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVR 1568
            ++L  ++K  E + K + GGG   I A+H++   K+  RER+ +L D+ +++E   F     +  G+     P    +TG GKI+G      + D TV GG+      KK  +    AM    P + L DSGGA   +Q  +      G    +   +M++  IPQ++++ G C  G  Y P +++   +V     +F+ GP +VK+ T E+V+ E+LGGA+ H+ VSG        + +A    R   +     LP+ +  ++  P+  + +        L  + P     + ++  ++  + D S F E    Y   ++ GF R+ G  +GI+ N      G L   AS+KG+ FV+ CD  +IPL+   +    P       +      R  A+  ++ A A A+VPK+T++    +GG    M  +    +  + WP A V+++    + + +      E++++  E +++ ++ F ++ R
Sbjct:   99 NSLVCQQKYFEHKEKVMKGGGENAI-ARHTQRNQKVLVRERLRMLLDDEDYLELSPF-----AGLGLPYGDIPSAGCLTGIGKINGLWCMFSANDATVKGGTAYPITVKKQLRAQIVAMQNRLPFVYLVDSGGAFLPLQSEIFPDKNHGGRTFYNEAIMSAMKIPQVAVVCGSCTAGGAYVPTMSEEAVIVHRIGTIFLGGPPLVKAATGEEVSPEDLGGARLHSEVSGCVDHFAAVESEAYEYTRNIISTLNYELPEEDSVQVEEPLYSTEE--------LMGLAPRSYNYSLDIRLIVSRLTDGSRFQEFKARYGTTLLTGFARIDGHQIGIVANN-----GELTYEASLKGSHFVQLCDQRDIPLIFLQNTAPEPAHTTSQTKAESNTNRLKAQGSMMSAVACASVPKMTVVIGGCHGGDSYAMCGRAFDPNFLFLWPNARVSILAPGYSEEFV---QTEEEITQINEMLEEESSAFFSTGR 561          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Zebrafish
Match: si:ch211-198n5.11 (si:ch211-198n5.11 [Source:ZFIN;Acc:ZDB-GENE-050411-52])

HSP 1 Score: 165.622 bits (418), Expect = 8.811e-44
Identity = 124/485 (25.57%), Postives = 228/485 (47.01%), Query Frame = 3
Query:  165 HTLAVKKKIDETRNKALLGGGVKRIDAQHSK--GKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGA--RIQEGV--ASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTF----LPQSN--RLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDV---PGFLPGTNQEFGGIIRHGAK--LLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVR 1568
            ++L  ++K  E + K + GGG   I A+H++   K+  RER+ +L D+ +++E   F     +  G+     P    +TG GKI+G      + D TV GG+      KK  +    AM    P + L DSGGA   +Q  +      G    +   +M++  IPQ++++ G C  G  Y P +++   +V     +F+ GP +VK+ T E+V+ E+LGGA+ H+ VSG        + +A    R   +     LP+ +  ++  P+  + +        L  + P     + ++  ++  + D S F E    Y   ++ GF R+ G  +GI+ N      G L   AS+KG+ FV+ CD  +IPL+   +    P       +      R  A+  ++ A A A+VPK+T++    +GG    M  +    +  + WP A V+++    + + +      E++++  E +++ ++ F ++ R
Sbjct:  100 NSLVCQQKYFEHKEKVMKGGGENAI-ARHTQRNQKVLVRERLRMLLDDEDYLELSPF-----AGLGLPYGDIPSAGCLTGIGKINGLWCMFSANDATVKGGTAYPITVKKQLRAQIVAMQNRLPFVYLVDSGGAFLPLQSEIFPDKNHGGRTFYNEAIMSAMKIPQVAVVCGSCTAGGAYVPTMSEEAVIVHRIGTIFLGGPPLVKAATGEEVSPEDLGGARLHSEVSGCVDHFAAVESEAYEYTRNIISTLNYELPEEDSVQVEEPLYSTEE--------LMGLAPRSYNYSLDIRLIVSRLTDGSRFQEFKARYGTTLLTGFARIDGHQIGIVANN-----GELTYEASLKGSHFVQLCDQRDIPLIFLQNTAPEPAHTTSQTKAESNTNRLKAQGSMMSAVACASVPKMTVVIGGCHGGDSYAMCGRAFDPNFLFLWPNARVSILAPGYSEEFV---QTEEEITQINEMLEEESSAFFSTGR 562          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Zebrafish
Match: acacb (acetyl-CoA carboxylase beta [Source:ZFIN;Acc:ZDB-GENE-060526-132])

HSP 1 Score: 82.4185 bits (202), Expect = 8.753e-16
Identity = 94/390 (24.10%), Postives = 170/390 (43.59%), Query Frame = 3
Query:  426 FIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDV--TQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIH---------GVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAA-------GCLDINAS-VKGARFVRFCDA----------FN---IPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKA--YGGAYDVMS-SKHLRGDINYAWPTAEVAVMGAKGAVQIIFR 1490
            ++  QD+T    S S+      C  +++    G     L D  G     GV +L G   I      A   I  IS++     G   Y   L      V++ S++ +TG   +  V   +V  +  +LGG +   + +GV H    +D + ++ + ++ +++P+SN+   PI+ + DP DR +  + T  P +    + +    H         G  D   F EIM T+A+ +++G  R+ G  +G+I  + +            LD  A  ++ A  V F D+          FN   +PL+ F +  GF  G    +  +++ G+ ++ A  E + P +  I   A   GG++ V+  + +L+    YA   +   V+ A+G V+I FR
Sbjct: 1648 YLTPQDYTRISSSNSVH-----CHHVEEG---GESRYILTDIIGKEEGIGVENLRGSGTIAGETSQAYKEIITISMVTCRAIGIGAYLVRLGQRVIQVEN-SHIILTGAGALNKVLGREVYTSNNQLGGVQIMHN-NGVTHSTVPDDFEGVLTILQWLSYMPKSNQSPVPIKPATDPVDREIDFVPTKAPYDPR--WLLCGRPHPTVKGAWQSGFFDHGSFLEIMATWAQTVVVGRARLGGIPLGVIAVETRTVELAIPADPANLDSEAKLLQQAGQVWFPDSAYKTAQAIEDFNREKLPLMVFANWRGFSGGMKDMYDQVLKFGSYIVDALREFSQPVLVYIPPNAELRGGSWVVIDPTINLQHMELYADRESRGGVLEAEGTVEIKFR 2025          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Xenopus
Match: PCCB (propionyl-CoA carboxylase subunit beta [Source:NCBI gene;Acc:613054])

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 371/480 (77.29%), Postives = 428/480 (89.17%), Query Frame = 3
Query:  144 VPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            +P   S   L+V ++I++ R +ALLGGG +RI+AQH +GKLTARERI LL D   F E+DMFVEH CSDFGM+   N++PGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA++VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV++SGV+PQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQE+LGGAKTHT++SGVAH AFEND+DAL+ LREFF FLP SN+  +P+R   DP DRLVP LDTVVP+E+T AY+MLD+IH ++DE EFFEIMP YAKNI++GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIP++TFVDVPGFLPGT QE+GGIIRHGAKLL+A+AEATVPKIT+ITRKAYGGAYDVMSSKHLRGD+NYAWPTAEVAVMGAKGAVQIIFRG  N Q   E EYV+KFANPFPA+VRG +
Sbjct:   26 LPRAYSVSHLSVPERIEKKRREALLGGGEQRIEAQHRRGKLTARERISLLLDPGSFAEYDMFVEHRCSDFGMEEDRNKYPGDSVVTGQGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAVMVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVLSSGVVPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEDLGGAKTHTALSGVAHHAFENDIDALLNLREFFNFLPLSNKDPAPVRECQDPSDRLVPGLDTVVPMETTKAYDMLDIIHSIIDEREFFEIMPNYAKNIVVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPIITFVDVPGFLPGTAQEYGGIIRHGAKLLFAFAEATVPKITVITRKAYGGAYDVMSSKHLRGDVNYAWPTAEVAVMGAKGAVQIIFRGKQN-QAEAEEEYVEKFANPFPAAVRGFV 504          

HSP 2 Score: 50.447 bits (119), Expect = 6.744e-6
Identity = 20/39 (51.28%), Postives = 28/39 (71.79%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWK 1666
            FP+  +  VDDII+P  TR +IC+DL++L  K + NPWK
Sbjct:  496 FPAAVRGFVDDIIQPSTTRMRICRDLEVLASKQVVNPWK 534          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Xenopus
Match: PCCB (propionyl-CoA carboxylase subunit beta [Source:NCBI gene;Acc:613054])

HSP 1 Score: 776.548 bits (2004), Expect = 0.000e+0
Identity = 371/501 (74.05%), Postives = 429/501 (85.63%), Query Frame = 3
Query:  129 FATNAVPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAG----------------CLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            +    +P   S   L+V ++I++ R +ALLGGG +RI+AQH +GKLTARERI LL D   F E+DMFVEH CSDFGM+   N++PGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA++VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV++SGV+PQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQE+LGGAKTHT++SGVAH AFEND+DAL+ LREFF FLP SN+  +P+R   DP DRLVP LDTVVP+E+T AY+MLD+IH ++DE EFFEIMP YAKNI++GF RM+GRTVGI+GNQPKVA+G                CLDIN+SVKGARFVRFCDAFNIP++TFVDVPGFLPGT QE+GGIIRHGAKLL+A+AEATVPKIT+ITRKAYGGAYDVMSSKHLRGD+NYAWPTAEVAVMGAKGAVQIIFRG  N Q   E EYV+KFANPFPA+VRG +
Sbjct:   21 WGPRVLPRAYSVSHLSVPERIEKKRREALLGGGEQRIEAQHRRGKLTARERISLLLDPGSFAEYDMFVEHRCSDFGMEEDRNKYPGDSVVTGQGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAVMVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVLSSGVVPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEDLGGAKTHTALSGVAHHAFENDIDALLNLREFFNFLPLSNKDPAPVRECQDPSDRLVPGLDTVVPMETTKAYDMLDIIHSIIDEREFFEIMPNYAKNIVVGFARMNGRTVGIVGNQPKVASGIVVKCIMPWLRGQAFSCLDINSSVKGARFVRFCDAFNIPIITFVDVPGFLPGTAQEYGGIIRHGAKLLFAFAEATVPKITVITRKAYGGAYDVMSSKHLRGDVNYAWPTAEVAVMGAKGAVQIIFRGKQN-QAEAEEEYVEKFANPFPAAVRGFV 520          

HSP 2 Score: 63.1586 bits (152), Expect = 7.524e-10
Identity = 26/46 (56.52%), Postives = 34/46 (73.91%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR +IC+DL++L  K + NPWKKH NIPL
Sbjct:  512 FPAAVRGFVDDIIQPSTTRMRICRDLEVLASKQVVNPWKKHANIPL 557          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Xenopus
Match: PCCB (propionyl-CoA carboxylase subunit beta [Source:NCBI gene;Acc:613054])

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 371/505 (73.47%), Postives = 429/505 (84.95%), Query Frame = 3
Query:  129 FATNAVPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQ--------------------DFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            +    +P   S   L+V ++I++ R +ALLGGG +RI+AQH +GKLTARERI LL D   F E+DMFVEH CSDFGM+   N++PGDSV+TG G+I+GR  ++FSQ                    DFTVFGGSLS AHA+KICK+MDQA++VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV++SGV+PQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQE+LGGAKTHT++SGVAH AFEND+DAL+ LREFF FLP SN+  +P+R   DP DRLVP LDTVVP+E+T AY+MLD+IH ++DE EFFEIMP YAKNI++GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIP++TFVDVPGFLPGT QE+GGIIRHGAKLL+A+AEATVPKIT+ITRKAYGGAYDVMSSKHLRGD+NYAWPTAEVAVMGAKGAVQIIFRG  N Q   E EYV+KFANPFPA+VRG +
Sbjct:   21 WGPRVLPRAYSVSHLSVPERIEKKRREALLGGGEQRIEAQHRRGKLTARERISLLLDPGSFAEYDMFVEHRCSDFGMEEDRNKYPGDSVVTGQGRINGRLVYVFSQVRDFMTFVLFIVRWDQVQGTDFTVFGGSLSGAHAQKICKIMDQAVMVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVLSSGVVPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEDLGGAKTHTALSGVAHHAFENDIDALLNLREFFNFLPLSNKDPAPVRECQDPSDRLVPGLDTVVPMETTKAYDMLDIIHSIIDEREFFEIMPNYAKNIVVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPIITFVDVPGFLPGTAQEYGGIIRHGAKLLFAFAEATVPKITVITRKAYGGAYDVMSSKHLRGDVNYAWPTAEVAVMGAKGAVQIIFRGKQN-QAEAEEEYVEKFANPFPAAVRGFV 524          

HSP 2 Score: 63.1586 bits (152), Expect = 7.057e-10
Identity = 26/46 (56.52%), Postives = 34/46 (73.91%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR +IC+DL++L  K + NPWKKH NIPL
Sbjct:  516 FPAAVRGFVDDIIQPSTTRMRICRDLEVLASKQVVNPWKKHANIPL 561          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Xenopus
Match: PCCB (propionyl-CoA carboxylase subunit beta [Source:NCBI gene;Acc:613054])

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 357/478 (74.69%), Postives = 410/478 (85.77%), Query Frame = 3
Query:  144 VPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            +P   S   L+V ++I++ R +ALLGGG +RI+AQH +GKLTARERI LL D   F E+DMFVEH CSDFGM+ +R                     ++DFTVFGGSLS AHA+KICK+MDQA++VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV++SGV+PQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQE+LGGAKTHT++SGVAH AFEND+DAL+ LREFF FLP SN+  +P+R   DP DRLVP LDTVVP+E+T AY+MLD+IH ++DE EFFEIMP YAKNI++GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIP++TFVDVPGFLPGT QE+GGIIRHGAKLL+A+AEATVPKIT+ITRKAYGGAYDVMSSKHLRGD+NYAWPTAEVAVMGAKGAVQIIFRG  N Q   E EYV+KFANPFPA+VRG +
Sbjct:   26 LPRAYSVSHLSVPERIEKKRREALLGGGEQRIEAQHRRGKLTARERISLLLDPGSFAEYDMFVEHRCSDFGMEEDR---------------------NKDFTVFGGSLSGAHAQKICKIMDQAVMVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVLSSGVVPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEDLGGAKTHTALSGVAHHAFENDIDALLNLREFFNFLPLSNKDPAPVRECQDPSDRLVPGLDTVVPMETTKAYDMLDIIHSIIDEREFFEIMPNYAKNIVVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPIITFVDVPGFLPGTAQEYGGIIRHGAKLLFAFAEATVPKITVITRKAYGGAYDVMSSKHLRGDVNYAWPTAEVAVMGAKGAVQIIFRGKQN-QAEAEEEYVEKFANPFPAAVRGFV 481          

HSP 2 Score: 63.1586 bits (152), Expect = 6.492e-10
Identity = 26/46 (56.52%), Postives = 34/46 (73.91%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR +IC+DL++L  K + NPWKKH NIPL
Sbjct:  473 FPAAVRGFVDDIIQPSTTRMRICRDLEVLASKQVVNPWKKHANIPL 518          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Xenopus
Match: PCCB (propionyl-CoA carboxylase subunit beta [Source:NCBI gene;Acc:613054])

HSP 1 Score: 741.11 bits (1912), Expect = 0.000e+0
Identity = 354/485 (72.99%), Postives = 411/485 (84.74%), Query Frame = 3
Query:  129 FATNAVPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            +    +P   S   L+V ++I++ R +ALLGGG +RI+AQH +GKLTARERI LL D   F E+DMFVEH CSDFGM+   N++PGDSV+TG G+I+GR  ++FSQ                   +MDQA++VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV++SGV+PQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQE+LGGAKTHT++SGVAH AFEND+DAL+ LREFF FLP SN+  +P+R   DP DRLVP LDTVVP+E+T AY+MLD+IH ++DE EFFEIMP YAKNI++GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIP++TFVDVPGFLPGT QE+GGIIRHGAKLL+A+AEATVPKIT+ITRKAYGGAYDVMSSKHLRGD+NYAWPTAEVAVMGAKGAVQIIFRG  N Q   E EYV+KFANPFPA+VRG +
Sbjct:   21 WGPRVLPRAYSVSHLSVPERIEKKRREALLGGGEQRIEAQHRRGKLTARERISLLLDPGSFAEYDMFVEHRCSDFGMEEDRNKYPGDSVVTGQGRINGRLVYVFSQ-------------------IMDQAVMVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVLSSGVVPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEDLGGAKTHTALSGVAHHAFENDIDALLNLREFFNFLPLSNKDPAPVRECQDPSDRLVPGLDTVVPMETTKAYDMLDIIHSIIDEREFFEIMPNYAKNIVVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPIITFVDVPGFLPGTAQEYGGIIRHGAKLLFAFAEATVPKITVITRKAYGGAYDVMSSKHLRGDVNYAWPTAEVAVMGAKGAVQIIFRGKQN-QAEAEEEYVEKFANPFPAAVRGFV 485          

HSP 2 Score: 63.1586 bits (152), Expect = 6.479e-10
Identity = 26/46 (56.52%), Postives = 34/46 (73.91%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR +IC+DL++L  K + NPWKKH NIPL
Sbjct:  477 FPAAVRGFVDDIIQPSTTRMRICRDLEVLASKQVVNPWKKHANIPL 522          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Mouse
Match: Pccb (propionyl Coenzyme A carboxylase, beta polypeptide [Source:MGI Symbol;Acc:MGI:1914154])

HSP 1 Score: 783.097 bits (2021), Expect = 0.000e+0
Identity = 374/474 (78.90%), Postives = 425/474 (89.66%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            S  ++VK++ID  R+ ALLGGG +RIDAQH +GKLTARERI LL D   F+E DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGP+VVKSVTNEDVTQE+LGGAKTHT+VSGVAH+AF+NDVDAL  LREFF FLP S++  +PIR  HDP DRLVP LDTVVPLES+ AYNMLD+IH V+DE EFFEIMP+YAKNI++GF RM+GRTVGI+GNQP VA+GCLDIN+SVKGARFVRFCDAFNIPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKIT+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  + + + +AEYV+KFANPFPA+VRG +
Sbjct:   32 SQPVSVKERIDNKRHAALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFMESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPEVVKSVTNEDVTQEQLGGAKTHTTVSGVAHRAFDNDVDALCNLREFFNFLPLSSQDPAPIRECHDPSDRLVPELDTVVPLESSKAYNMLDIIHAVIDEREFFEIMPSYAKNIVVGFARMNGRTVGIVGNQPNVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYDVMSSKHLLGDTNYAWPTAEIAVMGAKGAVEIIFKGHQDVE-AAQAEYVEKFANPFPAAVRGFV 504          

HSP 2 Score: 58.9214 bits (141), Expect = 1.179e-8
Identity = 24/46 (52.17%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR++IC DL++L  K +  PW+KH NIPL
Sbjct:  496 FPAAVRGFVDDIIQPSSTRARICCDLEVLASKKVHRPWRKHANIPL 541          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Mouse
Match: Pccb (propionyl Coenzyme A carboxylase, beta polypeptide [Source:MGI Symbol;Acc:MGI:1914154])

HSP 1 Score: 691.419 bits (1783), Expect = 0.000e+0
Identity = 338/474 (71.31%), Postives = 389/474 (82.07%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            S  ++VK++ID  R+ ALLGGG +RIDAQH +GKLTARERI LL D   F+E DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF                                      DTSYLFITGP+VVKSVTNEDVTQE+LGGAKTHT+VSGVAH+AF+NDVDAL  LREFF FLP S++  +PIR  HDP DRLVP LDTVVPLES+ AYNMLD+IH V+DE EFFEIMP+YAKNI++GF RM+GRTVGI+GNQP VA+GCLDIN+SVKGARFVRFCDAFNIPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKIT+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  + + + +AEYV+KFANPFPA+VRG +
Sbjct:   32 SQPVSVKERIDNKRHAALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFMESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFL-------------------------------------DTSYLFITGPEVVKSVTNEDVTQEQLGGAKTHTTVSGVAHRAFDNDVDALCNLREFFNFLPLSSQDPAPIRECHDPSDRLVPELDTVVPLESSKAYNMLDIIHAVIDEREFFEIMPSYAKNIVVGFARMNGRTVGIVGNQPNVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYDVMSSKHLLGDTNYAWPTAEIAVMGAKGAVEIIFKGHQDVE-AAQAEYVEKFANPFPAAVRGFV 467          

HSP 2 Score: 58.9214 bits (141), Expect = 1.219e-8
Identity = 24/46 (52.17%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR++IC DL++L  K +  PW+KH NIPL
Sbjct:  459 FPAAVRGFVDDIIQPSSTRARICCDLEVLASKKVHRPWRKHANIPL 504          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Mouse
Match: Pccb (propionyl Coenzyme A carboxylase, beta polypeptide [Source:MGI Symbol;Acc:MGI:1914154])

HSP 1 Score: 353.984 bits (907), Expect = 2.682e-119
Identity = 179/263 (68.06%), Postives = 202/263 (76.81%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDP 950
            S  ++VK++ID  R+ ALLGGG +RIDAQH                                       RFPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGP+VVKSVTNEDVTQE+LGGAKTHT+VSGVAH+AF+NDVDAL  LREFF FLP S++  +PIR  HDP
Sbjct:   32 SQPVSVKERIDNKRHAALLGGGQRRIDAQH--------------------------------------KRFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPEVVKSVTNEDVTQEQLGGAKTHTTVSGVAHRAFDNDVDALCNLREFFNFLPLSSQDPAPIRECHDP 256          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Mouse
Match: Mccc2 (methylcrotonoyl-Coenzyme A carboxylase 2 (beta) [Source:MGI Symbol;Acc:MGI:1925288])

HSP 1 Score: 214.542 bits (545), Expect = 9.973e-62
Identity = 148/444 (33.33%), Postives = 219/444 (49.32%), Query Frame = 3
Query:  174 AVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDE-NEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAG---YAEIF-QRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPA--LDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQII 1484
            A+  ++ E      LGG  K      S+GKL  R+RI  L D  + F+E+  F  +    +G +    P   +ITG G++ G    I + D TV GG+      KK  +  + A+    P I L DSGGA +     +      +  IF  + +M+S  I QI+++MG C  G  Y PA+ D   +V+    +F+ GP +VK+ T E+V+ E+LGGA  H   SGV      +D  AL   R+    L    ++   I  S +P   L PA  L  +V      ++++ +VI  +VD S F E    Y   ++ GF R+ G  VGIIGN      G L   ++ KGA FV+ C   NIPLL   ++ GF+ G + E  GI + GAK++ A A A VPKIT+I   +YG     M  +       Y WP A ++VMG + A  ++
Sbjct:   51 ALVSQLHERAQYVRLGGSEKARARHTSRGKLLPRDRIDNLIDPGSPFLEFSQFAGYQL--YGDE--EVPAGGIITGIGRVSGVECMIVANDATVKGGTYYPVTVKKHVRAQEIALQNRLPCIYLVDSGGANLPRQADTFPDRDHFGRIFYNQAIMSSKNITQIAVVMGSCTAGGAYVPAMADENIIVQKQGTIFLAGPPLVKAATGEEVSAEDLGGADLHCRKSGVTDHYALDDHHALHLTRKVVRSLNYQKKMDVTIEPSEEP---LFPADELYGIVGANLKRSFDVREVIARIVDGSRFNEFKALYGDTLVTGFARIFGYPVGIIGNN-----GVLFSESAKKGAHFVQLCCQRNIPLLFLQNITGFMVGRDYEAEGIAKDGAKMVAAVACAKVPKITVIIGGSYGAGNYGMCGRAYSPRFLYMWPNARISVMGGEQAATVL 482          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Mouse
Match: Pccb (propionyl Coenzyme A carboxylase, beta polypeptide [Source:MGI Symbol;Acc:MGI:1914154])

HSP 1 Score: 132.88 bits (333), Expect = 3.175e-36
Identity = 68/122 (55.74%), Postives = 84/122 (68.85%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGA 527
            S  ++VK++ID  R+ ALLGGG +RIDAQH +GKLTARERI LL D   F+E DMFVEH C+DFGM A++                     ++DFTVFGGSLS AHA+KICK+MDQA+ VGA
Sbjct:   32 SQPVSVKERIDNKRHAALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFMESDMFVEHRCADFGMAADK---------------------NKDFTVFGGSLSGAHAQKICKIMDQAITVGA 132          
BLAST of Propionyl-CoA carboxylase subunit beta vs. UniProt/SwissProt
Match: sp|P05166|PCCB_HUMAN (Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCB PE=1 SV=3)

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 373/474 (78.69%), Postives = 422/474 (89.03%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            S   +V ++I+  R  ALLGGG +RIDAQH +GKLTARERI LL D   FVE DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHT++SGVAH+AFENDVDAL  LR+FF +LP S++  +P+R  HDP DRLVP LDT+VPLEST AYNM+D+IH VVDE EFFEIMP YAKNII+GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPK+T+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  N + + +AEY++KFANPFPA+VRG +
Sbjct:   30 SQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE-AAQAEYIEKFANPFPAAVRGFV 502          

HSP 2 Score: 61.2326 bits (147), Expect = 1.720e-8
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR++IC DLD+L  K +  PW+KH NIPL
Sbjct:  494 FPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL 539          
BLAST of Propionyl-CoA carboxylase subunit beta vs. UniProt/SwissProt
Match: sp|Q99MN9|PCCB_MOUSE (Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2)

HSP 1 Score: 783.097 bits (2021), Expect = 0.000e+0
Identity = 374/474 (78.90%), Postives = 425/474 (89.66%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            S  ++VK++ID  R+ ALLGGG +RIDAQH +GKLTARERI LL D   F+E DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGP+VVKSVTNEDVTQE+LGGAKTHT+VSGVAH+AF+NDVDAL  LREFF FLP S++  +PIR  HDP DRLVP LDTVVPLES+ AYNMLD+IH V+DE EFFEIMP+YAKNI++GF RM+GRTVGI+GNQP VA+GCLDIN+SVKGARFVRFCDAFNIPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKIT+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  + + + +AEYV+KFANPFPA+VRG +
Sbjct:   32 SQPVSVKERIDNKRHAALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFMESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPEVVKSVTNEDVTQEQLGGAKTHTTVSGVAHRAFDNDVDALCNLREFFNFLPLSSQDPAPIRECHDPSDRLVPELDTVVPLESSKAYNMLDIIHAVIDEREFFEIMPSYAKNIVVGFARMNGRTVGIVGNQPNVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYDVMSSKHLLGDTNYAWPTAEIAVMGAKGAVEIIFKGHQDVE-AAQAEYVEKFANPFPAAVRGFV 504          

HSP 2 Score: 58.9214 bits (141), Expect = 8.248e-8
Identity = 24/46 (52.17%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR++IC DL++L  K +  PW+KH NIPL
Sbjct:  496 FPAAVRGFVDDIIQPSSTRARICCDLEVLASKKVHRPWRKHANIPL 541          
BLAST of Propionyl-CoA carboxylase subunit beta vs. UniProt/SwissProt
Match: sp|Q2TBR0|PCCB_BOVIN (Propionyl-CoA carboxylase beta chain, mitochondrial OS=Bos taurus OX=9913 GN=PCCB PE=2 SV=1)

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 371/474 (78.27%), Postives = 422/474 (89.03%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            +  ++V ++I+  R  ALLGGG +RIDAQH +GKLTARERI LL D   FVE DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGA+THT++SGVAH+AFENDVDAL  LREFF +LP SN+  +P+   HDP DRLVP LDT+VPLEST AYNM+D+IH VVDE EFFEIMP YAKNII+GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCD+FNIPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPK+T+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  N + + +AEY++KFANPFPA+VRG +
Sbjct:   30 TQPVSVNERIENKRQAALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQALTVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGARTHTTMSGVAHRAFENDVDALCNLREFFNYLPLSNQDPAPVLECHDPSDRLVPELDTIVPLESTKAYNMVDIIHAVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDSFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE-AAQAEYIEKFANPFPAAVRGFV 502          

HSP 2 Score: 60.8474 bits (146), Expect = 2.029e-8
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR++IC DLD+L  K +  PW+KH NIPL
Sbjct:  494 FPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL 539          
BLAST of Propionyl-CoA carboxylase subunit beta vs. UniProt/SwissProt
Match: sp|P79384|PCCB_PIG (Propionyl-CoA carboxylase beta chain, mitochondrial OS=Sus scrofa OX=9823 GN=PCCB PE=1 SV=1)

HSP 1 Score: 778.474 bits (2009), Expect = 0.000e+0
Identity = 370/474 (78.06%), Postives = 423/474 (89.24%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            +  ++V ++I+  R  ALLGGG +RID+QH +GKLTARERI LL D   F+E DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQAM VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGA+THT++SGVAH+AF+NDVDAL  LREFF +LP SN+  +PIR  HDP DRLVP LDTVVPLEST AY+M+D+I+ +VDE +FFEIMP YAKNII+GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKIT+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  N + + +AEY++KFANPFPA+VRG +
Sbjct:   30 TQPVSVNERIENKRQAALLGGGQRRIDSQHKRGKLTARERISLLLDPGSFIESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAMTVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVSASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGARTHTTMSGVAHRAFDNDVDALCNLREFFNYLPLSNQDPAPIRECHDPSDRLVPELDTVVPLESTRAYDMVDIIYSIVDERDFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE-AAQAEYIEKFANPFPAAVRGFV 502          

HSP 2 Score: 60.8474 bits (146), Expect = 2.011e-8
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR++IC DLD+L  K +  PW+KH NIPL
Sbjct:  494 FPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL 539          
BLAST of Propionyl-CoA carboxylase subunit beta vs. UniProt/SwissProt
Match: sp|P07633|PCCB_RAT (Propionyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pccb PE=2 SV=1)

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 370/474 (78.06%), Postives = 420/474 (88.61%), Query Frame = 3
Query:  162 SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            S  ++V ++I+  R+ ALLGGG +RIDAQH +GKLTARERI LL D   F+E DMFVEH C+DFGM A  N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQA+ VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGP+ VKSVTNEDVTQE+LGGAKTHT+VSGVAH+AF+NDVDAL  LREF  FLP SN+  + IR  HDP DRLVP LDTVVPLES+ AYNMLD+IH V+DE EFFEIMP YAKNI+IGF RM+GRTVGI+GNQP VA+GCLDIN+SVKGARFVRFCDAF+IPL+TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKIT+ITRKAYGGAYDVMSSKHL GD NYAWPTAE+AVMGAKGAV+IIF+G  + + + +AEYV+KFANPFPA+VRG +
Sbjct:   32 SQPVSVNERIENKRHAALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFLESDMFVEHRCADFGMAAEKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPEFVKSVTNEDVTQEQLGGAKTHTTVSGVAHRAFDNDVDALCNLREFLNFLPLSNQDPASIRECHDPSDRLVPELDTVVPLESSKAYNMLDIIHAVIDEREFFEIMPNYAKNIVIGFARMNGRTVGIVGNQPNVASGCLDINSSVKGARFVRFCDAFSIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYDVMSSKHLLGDTNYAWPTAEIAVMGAKGAVEIIFKGHEDVE-AAQAEYVEKFANPFPAAVRGFV 504          

HSP 2 Score: 58.5362 bits (140), Expect = 1.070e-7
Identity = 23/46 (50.00%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR++IC DL++L  K +  PW+KH N+PL
Sbjct:  496 FPAAVRGFVDDIIQPSSTRARICCDLEVLASKKVHRPWRKHANVPL 541          
BLAST of Propionyl-CoA carboxylase subunit beta vs. TrEMBL
Match: A0A2C9K7Z1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055804 PE=4 SV=1)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 394/470 (83.83%), Postives = 430/470 (91.49%), Query Frame = 3
Query:  168 TLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            TL VK++I+E R +ALLGGG KRI+AQH KGKLTARERIHLL DE  F+E+DMF+EHDCSDFGM+  ++PGDSV+TG G I+GR  FIFSQDFTVFGGSLS AHAKKICK+MDQAMLVGAPVIGLNDSGGARIQEGV SLAGYA+IFQRNV +SGVIPQIS+IMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAH+AFENDVDALM LREFF +LP SN   +PIR   DP DR+VP LDTVVPLES+AAY+MLDVI G++DE EFFEIMPTYAKNII+GF RM+GRTVGI+GNQPKVAAGCLDINASVK ARFVRFCDAFNIP++TFVDVPGFLPGTNQEFGGIIRHGAKLLYA+AEATVPKITIITRKAYGGAYDVMSSKHL+GDINYAWPTAEVAVMGAKGAV IIFRGS N Q   E EY++KFANPFPA+VRG +
Sbjct:   50 TLDVKRRIEEIRQQALLGGGEKRIEAQHKKGKLTARERIHLLVDEESFIEYDMFLEHDCSDFGMEKQKYPGDSVVTGRGLINGRTVFIFSQDFTVFGGSLSGAHAKKICKIMDQAMLVGAPVIGLNDSGGARIQEGVESLAGYADIFQRNVESSGVIPQISMIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHRAFENDVDALMNLREFFNYLPLSNVDEAPIRDCDDPWDRIVPGLDTVVPLESSAAYDMLDVITGIIDEQEFFEIMPTYAKNIIVGFARMNGRTVGIVGNQPKVAAGCLDINASVKAARFVRFCDAFNIPIITFVDVPGFLPGTNQEFGGIIRHGAKLLYAFAEATVPKITIITRKAYGGAYDVMSSKHLKGDINYAWPTAEVAVMGAKGAVSIIFRGSKN-QHENEVEYIEKFANPFPAAVRGFV 518          

HSP 2 Score: 62.003 bits (149), Expect = 2.425e-6
Identity = 27/46 (58.70%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDIIEPR TR +I +DL +L  K  +NPWKKH NIPL
Sbjct:  510 FPAAVRGFVDDIIEPRTTRMRINRDLGMLASKTRTNPWKKHANIPL 555          
BLAST of Propionyl-CoA carboxylase subunit beta vs. TrEMBL
Match: A0A433TB36 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_013423 PE=4 SV=1)

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 385/470 (81.91%), Postives = 429/470 (91.28%), Query Frame = 3
Query:  168 TLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            TL VK++I+ TR +ALLGGG +RID QH KGKLTARERI LL DE+ FVE+DMF+EH+C+DFGM+  ++PGDSV+TG G I+GR AF+FSQDFTVFGGSLS AHAKK+CK+MDQAMLVGAPVIGLNDSGGARIQEGV SLAGYA+IFQRNV +SGVIPQIS+IMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKS+TNEDVTQEELGGAKTHT VSGVAHKAFENDVDAL+ LREFF +LP +N+  SPIR   DP DRLVP LDTVVPLESTAAY+M DVI G++DE EFFEIMP+YAKN+I+GF RM+GRTVGI+GNQPKVAAGCLDINASVKGARFVRFCDAFNIP++TFVDVPGFLPGT+QE+GGIIRHGAKLLYA+AEATVPK+T+ITRK YGGAYDVMSSKHLRGDINYAWPTAEVAVMGAK AV IIFRGS N Q   EAEYV+KFANPFPA+VRG +
Sbjct:    7 TLDVKRRIETTRQQALLGGGQRRIDVQHKKGKLTARERIQLLLDEDSFVEYDMFLEHNCADFGMEKQKYPGDSVVTGRGTINGRTAFVFSQDFTVFGGSLSGAHAKKVCKIMDQAMLVGAPVIGLNDSGGARIQEGVESLAGYADIFQRNVDSSGVIPQISMIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSITNEDVTQEELGGAKTHTQVSGVAHKAFENDVDALLNLREFFNYLPLNNKEASPIRACDDPWDRLVPGLDTVVPLESTAAYDMHDVITGIIDEQEFFEIMPSYAKNLIVGFARMNGRTVGIVGNQPKVAAGCLDINASVKGARFVRFCDAFNIPIITFVDVPGFLPGTSQEYGGIIRHGAKLLYAFAEATVPKVTVITRKGYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKAAVSIIFRGSKNPQ-EHEAEYVEKFANPFPAAVRGFV 475          

HSP 2 Score: 62.7734 bits (151), Expect = 1.602e-6
Identity = 27/46 (58.70%), Postives = 34/46 (73.91%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDIIEPR TR +I +DL +L  K L+NPWKKH N+PL
Sbjct:  467 FPAAVRGFVDDIIEPRTTRMRINKDLSVLADKKLTNPWKKHSNMPL 512          
BLAST of Propionyl-CoA carboxylase subunit beta vs. TrEMBL
Match: V4AQQ7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_116228 PE=4 SV=1)

HSP 1 Score: 810.446 bits (2092), Expect = 0.000e+0
Identity = 388/497 (78.07%), Postives = 435/497 (87.53%), Query Frame = 3
Query:   87 YFRIYSPLLNLSRCFATNAVPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            +F+       L+R +A  A     + HTL VK++I++ R +ALLGGG KRI  QH KGKLTARERI LL D   FVE+DMF+EHDC+DF MQ  ++PGDSV+TG GKI+GR  F+FSQDFTVFGGSLS AHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGV SLAGYA+IFQRNV ASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHT++SGVAH AF NDVDAL+ LR+F  FLP SN+  SP RH  D P+RLVP L++VVPLE+T+AY++ DVI+GVVDE +FFEIMP YAKNI++GFGRM+G+TVGI+GNQPKVAAGCLDINASVKGARFVRFCDAFNIP++TFVDVPGFLPGTNQE+GGIIRHGAKLL+AYAEATVPKIT+ITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAV IIFRG G  Q  +E EY+DKFANPFPA+ RG +
Sbjct:   19 HFKTLQTRNTLARSYAAVA---GSTEHTLEVKRRIEDKRERALLGGGQKRIAKQHQKGKLTARERIQLLLDPQSFVEYDMFMEHDCTDFNMQKEKYPGDSVVTGRGKINGRLVFVFSQDFTVFGGSLSGAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVESLAGYADIFQRNVNASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTISGVAHNAFANDVDALLNLRDFVNFLPLSNKEPSPTRHCTDSPNRLVPGLNSVVPLETTSAYDIKDVINGVVDEDDFFEIMPNYAKNIVVGFGRMNGKTVGIVGNQPKVAAGCLDINASVKGARFVRFCDAFNIPIITFVDVPGFLPGTNQEYGGIIRHGAKLLFAYAEATVPKITVITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVSIIFRG-GQNQAEQELEYIDKFANPFPATNRGFV 511          

HSP 2 Score: 63.5438 bits (153), Expect = 8.827e-7
Identity = 26/46 (56.52%), Postives = 34/46 (73.91%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDIIEP  TR ++C+DLD+L  K+  NPWKKH N+PL
Sbjct:  503 FPATNRGFVDDIIEPESTRKRLCEDLDILAKKDRKNPWKKHANMPL 548          
BLAST of Propionyl-CoA carboxylase subunit beta vs. TrEMBL
Match: A0A0B7AZ38 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF147513 PE=4 SV=1)

HSP 1 Score: 809.675 bits (2090), Expect = 0.000e+0
Identity = 382/471 (81.10%), Postives = 429/471 (91.08%), Query Frame = 3
Query:  165 HTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
             TLAVK++I+ETR +ALLGGG++RI  QH KGKLTARER+ LL D+  F+E+DMF+EH+CSDFGM   ++PGDSV+TG G I+GR  F+FSQDFTVFGGSLS AHAKK+CK+MDQAMLVGAPVIGLNDSGGARIQEGV SLAGYA+IFQRNV +SGVIPQIS+IMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAH+AFENDVDALM LREFF +LP +N+  +PIR   DP DR+V  LDTVVPLESTAAY+M DVI G++DE EFFEIMPTYAKNII+GF RM+GRTVGI+GNQPKVAAGCLDINASVK ARFVRFCDAFNIP++TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKITIITRKAYGGAYDVMSSKHL+GD++YAWPTAEVAVMGAKGAV IIFRG+ N Q + EAEY++KFANPFPA+VRG +
Sbjct:   40 QTLAVKRRIEETRKQALLGGGLQRIAVQHKKGKLTARERVQLLVDDGSFIEYDMFLEHNCSDFGMDKQKYPGDSVVTGRGLINGRTVFVFSQDFTVFGGSLSGAHAKKVCKIMDQAMLVGAPVIGLNDSGGARIQEGVESLAGYADIFQRNVESSGVIPQISMIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHRAFENDVDALMNLREFFNYLPLNNKDQAPIRECDDPWDRIVTGLDTVVPLESTAAYDMHDVITGIIDEQEFFEIMPTYAKNIIVGFARMNGRTVGIVGNQPKVAAGCLDINASVKAARFVRFCDAFNIPIITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITIITRKAYGGAYDVMSSKHLKGDVSYAWPTAEVAVMGAKGAVSIIFRGN-NNQKNMEAEYIEKFANPFPAAVRGFV 509          

HSP 2 Score: 65.855 bits (159), Expect = 1.610e-7
Identity = 29/46 (63.04%), Postives = 35/46 (76.09%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDIIEPR TR +I QDL++L  K+ SNPWKKH NIPL
Sbjct:  501 FPAAVRGFVDDIIEPRATRMRINQDLNMLSSKSRSNPWKKHANIPL 546          
BLAST of Propionyl-CoA carboxylase subunit beta vs. TrEMBL
Match: A0A2I4C5J0 (propionyl-CoA carboxylase beta chain, mitochondrial isoform X2 OS=Austrofundulus limnaeus OX=52670 GN=pccb PE=4 SV=1)

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 394/511 (77.10%), Postives = 443/511 (86.69%), Query Frame = 3
Query:   81 INYFRIYSPLLNLSRCFATNAVPLQGS----------SHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQ--ANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            IN  R+    L   +  AT A PLQ S          SH L+VK++I++ R  AL+GGG KRIDAQH KGKLTARER+ LL D   FVE DMFVEH CSDFGM+  +N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQAM VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV+ASGV+PQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHT+VSGVAH+AFENDV+AL+ LREFF FLP SN+  +PIR  HDP DRLV +LDT+VPLEST AY+MLD+IH +VDE +FFEIMP YAKNI++GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIP++TFVDVPGFLPGT QE+GGIIRHGAKLL+A+AEATVPKITIITRKAYGGAYDVMSSKHLRGD+NYAWPTAEVAVMGAKGAVQIIFRG  N Q   EAEYV+KFANPFPA+VRG +
Sbjct:   15 INGLRVSFRSLAQVKLGATPASPLQTSLQRDCRWYSVSH-LSVKERIEKKRKAALVGGGQKRIDAQHKKGKLTARERVELLLDPESFVETDMFVEHRCSDFGMEQDSNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAMTVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVLASGVVPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTVSGVAHRAFENDVEALLNLREFFNFLPLSNQDPAPIRECHDPSDRLVKSLDTIVPLESTKAYDMLDIIHAIVDERDFFEIMPAYAKNIVVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPIITFVDVPGFLPGTAQEYGGIIRHGAKLLFAFAEATVPKITIITRKAYGGAYDVMSSKHLRGDVNYAWPTAEVAVMGAKGAVQIIFRGKEN-QAEAEAEYVEKFANPFPAAVRGFV 523          

HSP 2 Score: 64.3142 bits (155), Expect = 4.884e-7
Identity = 27/46 (58.70%), Postives = 32/46 (69.57%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDIIEP  TR KIC DL++L  K   NPWKKH N+PL
Sbjct:  515 FPAAVRGFVDDIIEPATTRKKICSDLEMLASKKQVNPWKKHANVPL 560          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Cavefish
Match: pccb (propionyl-CoA carboxylase subunit beta [Source:NCBI gene;Acc:103029063])

HSP 1 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 377/487 (77.41%), Postives = 431/487 (88.50%), Query Frame = 3
Query:  144 VPLQGSSHTL-------AVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            +PL+G + TL        V+++++  R KAL GGG KR +AQH++GKLTARER+ LL D + F E DMFVEH CSDFGM+A  N++PGDSV+TG+G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQAM VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNVMASGV+PQIS+IMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAH+AFEND+DAL+ LR+FF FLP SN+   P+   HDP DRLVP LDT+VP E+T AY+MLD++H +VDE +FFEIMP YAKNI++GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIP++TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKITIITRKAYGGAYDVMSSKHLRGD+NYAWPTAEVAVMGAKGAVQIIFRG  N Q   EAEYV+KFANPFPA+VRG +
Sbjct:   25 LPLRGRTLTLPGLRCASTVQQRVELKRRKALEGGGEKRTEAQHARGKLTARERVALLLDPDSFTELDMFVEHRCSDFGMEADHNKYPGDSVVTGHGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAMTVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVMASGVVPQISMIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHRAFENDIDALLSLRDFFNFLPLSNKDPPPVTECHDPSDRLVPGLDTLVPFETTKAYDMLDIVHSIVDERDFFEIMPNYAKNIVVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPIITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITIITRKAYGGAYDVMSSKHLRGDVNYAWPTAEVAVMGAKGAVQIIFRGKEN-QAEAEAEYVEKFANPFPAAVRGFV 510          

HSP 2 Score: 63.929 bits (154), Expect = 2.594e-10
Identity = 27/46 (58.70%), Postives = 34/46 (73.91%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR +IC+DLD+L  K  +NPWKKH NIPL
Sbjct:  502 FPAAVRGFVDDIIQPSTTRLRICRDLDVLASKKQTNPWKKHANIPL 547          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Cavefish
Match: pccb (propionyl-CoA carboxylase subunit beta [Source:NCBI gene;Acc:103029063])

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 313/487 (64.27%), Postives = 366/487 (75.15%), Query Frame = 3
Query:  144 VPLQGSSHTL-------AVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQA--NRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            +PL+G + TL        V+++++  R KAL GGG KR +AQH++GKLTARER+ LL D + F E DMFVEH CSDFGM+A  N++PGDSV+TG+G+I+GR  ++FSQ   +  G            V+ Q  ++  P  G                                             GAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAH+AFEND+DAL+ LR+FF FLP SN+   P+   HDP DRLVP LDT+VP E+T AY+MLD++H +VDE +FFEIMP YAKNI++GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIP++TFVDVPGFLPGT QE+GGIIRHGAKLLYA+AEATVPKITIITRKAYGGAYDVMSSKHLRGD+NYAWPTAEVAVMGAKGAVQIIFRG  N Q   EAEYV+KFANPFPA+VRG +
Sbjct:   25 LPLRGRTLTLPGLRCASTVQQRVELKRRKALEGGGEKRTEAQHARGKLTARERVALLLDPDSFTELDMFVEHRCSDFGMEADHNKYPGDSVVTGHGRINGRLVYVFSQRNVMASG------------VVPQISMIMGPCAG---------------------------------------------GAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHRAFENDIDALLSLRDFFNFLPLSNKDPPPVTECHDPSDRLVPGLDTLVPFETTKAYDMLDIVHSIVDERDFFEIMPNYAKNIVVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPIITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITIITRKAYGGAYDVMSSKHLRGDVNYAWPTAEVAVMGAKGAVQIIFRGKEN-QAEAEAEYVEKFANPFPAAVRGFV 453          

HSP 2 Score: 63.5438 bits (153), Expect = 2.605e-10
Identity = 27/46 (58.70%), Postives = 34/46 (73.91%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDII+P  TR +IC+DLD+L  K  +NPWKKH NIPL
Sbjct:  445 FPAAVRGFVDDIIQPSTTRLRICRDLDVLASKKQTNPWKKHANIPL 490          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Cavefish
Match: mccc2 (methylcrotonoyl-CoA carboxylase 2 [Source:NCBI gene;Acc:103023758])

HSP 1 Score: 209.149 bits (531), Expect = 6.384e-60
Identity = 155/503 (30.82%), Postives = 240/503 (47.71%), Query Frame = 3
Query:   78 SINYFRIYSPLLNL----------SRCFATNAVPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDE-NEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGA---RIQEGVASLAGYAEIF-QRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDR-LVPALDT--VVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYV 1532
            S+ + R  S LL L          S+    + V  +      A+ K++ E   K  LGGG +      S+GKL  RERI  L D  + F+E      ++   +G  +   P   +ITG G++ G    I + D TV GG+      KK  +  + A     P I L DSGGA   R  E       +  IF  +  ++S  I QI+++MG C  G  Y P++ D + +V+    +F+ GP +VK+ T E+V+ E+LGGA  H   SGV      +D+ AL   R+    L    +L   +    +PP+  L PA +   +V       +++ +VI  +VD S+F E    Y   ++ GF R+ G  VGIIGN      G L   ++ K   F+  C + NIPL+   ++ GF+ G   E GGI + GAK++ A A A VPKIT+I   +YG     M  +       Y WP A ++VMG + A  ++   + +++  +  E+ 
Sbjct:    9 SVPFIRSRSALLRLYHADKVATLGSQADVQSPVYQENYERMQALVKELKERSEKIKLGGGERARALHTSRGKLLPRERIDRLLDPGSPFLELSQLAAYEL--YG--SEEVPAGGIITGIGRVSGVECVIAANDATVKGGTYYPVTVKKHLRAQEIAQQNHLPCIYLVDSGGANLPRQAEVFPDRDHFGRIFFNQARLSSQGIAQIAVVMGSCTAGGAYVPSMADESIIVRKQGTIFLAGPPLVKAATGEEVSAEDLGGADLHCRHSGVTDHYALDDLHALHLARKAVRNLNYRKKLDVTV----EPPEAPLFPADEIYGIVGDNLKRNFDVKEVIARIVDGSKFDEFKALYGDTLVTGFARIFGYPVGIIGNN-----GVLFSESAKKATHFIELCCSRNIPLIFLQNITGFMVGKEYEAGGIAKDGAKMVTAVACANVPKITVIIGGSYGAGNYGMCGRAYSPRFLYMWPNARISVMGGEQAANVLATITKDQKARQGKEFT 498          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Cavefish
Match: mccc2 (methylcrotonoyl-CoA carboxylase 2 [Source:NCBI gene;Acc:103023758])

HSP 1 Score: 201.83 bits (512), Expect = 2.887e-57
Identity = 152/494 (30.77%), Postives = 235/494 (47.57%), Query Frame = 3
Query:   78 SINYFRIYSPLLNLSRCFATNAVPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQH-SKGKLTARERIHLLCDE-NEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGA---RIQEGVASLAGYAEIF-QRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDR-LVPALDT--VVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYV 1532
            S+ + R  S LL L        +  Q    +   +   DE+        G +R  A H S+GKL  RERI  L D  + F+E      ++   +G  +   P   +ITG G++ G    I + D TV GG+      KK  +  + A     P I L DSGGA   R  E       +  IF  +  ++S  I QI+++MG C  G  Y P++ D + +V+    +F+ GP +VK+ T E+V+ E+LGGA  H   SGV      +D+ AL   R+    L    +L   +    +PP+  L PA +   +V       +++ +VI  +VD S+F E    Y   ++ GF R+ G  VGIIGN      G L   ++ K   F+  C + NIPL+   ++ GF+ G   E GGI + GAK++ A A A VPKIT+I   +YG     M  +       Y WP A ++VMG + A  ++   + +++  +  E+ 
Sbjct:    9 SVPFIRSRSALLRLYHADKVATLGSQADVQSPVYQVGRDES--------GGERARALHTSRGKLLPRERIDRLLDPGSPFLELSQLAAYEL--YG--SEEVPAGGIITGIGRVSGVECVIAANDATVKGGTYYPVTVKKHLRAQEIAQQNHLPCIYLVDSGGANLPRQAEVFPDRDHFGRIFFNQARLSSQGIAQIAVVMGSCTAGGAYVPSMADESIIVRKQGTIFLAGPPLVKAATGEEVSAEDLGGADLHCRHSGVTDHYALDDLHALHLARKAVRNLNYRKKLDVTV----EPPEAPLFPADEIYGIVGDNLKRNFDVKEVIARIVDGSKFDEFKALYGDTLVTGFARIFGYPVGIIGNN-----GVLFSESAKKATHFIELCCSRNIPLIFLQNITGFMVGKEYEAGGIAKDGAKMVTAVACANVPKITVIIGGSYGAGNYGMCGRAYSPRFLYMWPNARISVMGGEQAANVLATITKDQKARQGKEFT 481          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Cavefish
Match: si:ch211-198n5.11 (si:ch211-198n5.11 [Source:ZFIN;Acc:ZDB-GENE-050411-52])

HSP 1 Score: 181.415 bits (459), Expect = 1.002e-49
Identity = 138/485 (28.45%), Postives = 223/485 (45.98%), Query Frame = 3
Query:   78 SINYFRIYSPLLNLS--RCFATNAVPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQHSKG--KLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARI--QEGV--ASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTF----LPQSN--RLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDV---PGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVM--GAKGAV 1475
            S  YF I    L     R F  N   LQ S       ++  E  +K L GGG   +  +H++G  K+ ARERI +L D+ +++E   F     +  G+     PG + +TG GKI G      + D TV GG+     AKK  +  + AM    P + L DS G  I  Q  +      G +  +   +MA+  IPQ+SL+ G C  G  Y+P + + T +V     +F+ GP +VK+ T E+V+ E LGGA  H+ VSGV       + +    +R   +     LP+ N   +  P+  + D        L  + PL+ + + ++  ++  ++D S F E    Y   ++ GF R+ G  VGI+ N      G L   A +KG+ F++ C+  + PL+   +    P       +     ++    ++ A A A+VPKIT++    +G     M  +    +  + WP A V+++  G  GAV
Sbjct:   25 SRKYFPIIDGTLQQEHRRVFEVN---LQNSQ---ICHQRYQEHWDKVLKGGGQNAV-TRHTQGNQKILARERIRMLLDDEDYLELSPF-----AGLGLPYGDIPGAACLTGVGKIKGLWCLFAANDATVKGGTCFPITAKKQIRAQEVAMQNRLPCVYLGDSAGVFIPLQADIFPDKNQGGSMFYNEAIMAAMNIPQVSLVCGSCTAGGAYTPTMAEETVIVDRIGAIFLGGPPLVKAATGEEVSSEVLGGAALHSEVSGVVDHFVSVESEGFECVRNIISTLNFSLPEENPTEVEEPLYSAED--------LLGLAPLDYSNSLDVRLILSRLIDGSRFQEFKARYGTTLLTGFARIEGHQVGIVANN-----GELTYEACLKGSHFIQLCNQRDTPLIFLQNTAPEPAPTLSKAESNSNRLKSQGSMMSAVACASVPKITVVIGGCHGADSYAMCGRAFEPNFLFLWPNARVSILAPGHAGAV 484          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007626.1 (pep scaffold:Pmarinus_7.0:GL476395:36593:140427:1 gene:ENSPMAG00000006864.1 transcript:ENSPMAT00000007626.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.223 bits (526), Expect = 7.860e-60
Identity = 148/458 (32.31%), Postives = 223/458 (48.69%), Query Frame = 3
Query:  135 TNAVPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDE-NEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAG---YAEIF--QRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPA--LDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQII 1484
            T+A   +   +  ++  ++ E   K   GGG K      S+GKL  RERI  L D  + F+E   F  ++   +G +    P   +ITG G++ G    + + D TV GG+      KK  +  + A     P I L DSGGA +            +  IF  Q N+ + G I QI+++MG C  G  Y P++ D + +V+    +F+ GP +VK+ T E VT E+LGGA  H S SGV      +D  AL   R+    L     L   +    +P   L P   L  +V      ++++ +VI  VVD S+F E    Y  +++ GF R+ G  VGIIGN      G L   ++ KG  F++ C   NIPL+   ++ GF+ G + E GGI + GAK++ A A A VPKIT+I   +YG     M  +       + WP A ++VMG + A  ++
Sbjct:   40 TSATYQENYENMQSLVTEMKERVEKVKQGGGEKARALHTSRGKLLPRERIDRLLDPGSPFLELSQFAGYEL--YGDE--NVPAGGIITGVGRVSGVECVVVANDATVKGGTYYPVTVKKHLRAQEVARENFLPCIYLVDSGGANLPRQADVFPDRDHFGRIFFNQANLSSEG-ISQIAVVMGSCTAGGAYIPSMADESIIVRKQGTIFLGGPPLVKAATGEVVTAEDLGGADLHCSKSGVTDHYALDDHHALHLARKVVRSLNYKKNLDVTLEEPQEP---LFPTDELYGIVGANLKRSFDIREVIARVVDGSKFDEFKAMYGDSLVTGFARIFGYPVGIIGNN-----GVLFSESAKKGTHFIQLCCKRNIPLIFLQNITGFMVGRDYEAGGIAKDGAKMVTAVACANVPKITLIVGGSYGAGNYGMCGRAYSPRFLFMWPNARISVMGGEQAATVL 484          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003643.1 (pep scaffold:Pmarinus_7.0:GL479165:7567:28556:1 gene:ENSPMAG00000003333.1 transcript:ENSPMAT00000003643.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.608e-8
Identity = 47/196 (23.98%), Postives = 83/196 (42.35%), Query Frame = 3
Query:  783 VTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTA-------AYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFG---RMHGRTVGIIGNQPKVA-------AGCLDINAS-VKGARFVRFCDAF-------------NIPLLTFVDVPGFLPGTNQ 1277
             +  +LGG +   + +GV+H   E+D   +  + ++ +++P+ +R   PI HS DP DR V  + T  P +            N      G  D   F EIM  +A+ +++G     R+ G  VG++  + +            LD  A  ++ A  V F D+              ++PL+ F +  GF  G  +
Sbjct:   13 TSNNQLGGIQIMYN-NGVSHTTAEDDFQGVYTILQWLSYMPKDSRSPVPILHSKDPIDREVDFMPTKAPYDPRWMLAGRPHPTNKETWQSGFFDHGSFMEIMRPWAQTVVVGRAKQRRLGGIPVGVVAVETRTVELAIPADPANLDSEAKIIQQAGQVWFPDSAYKTSQAIKDFSREHLPLMVFANWRGFSGGMKE 207          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Yeast
Match: ACC1 (Acetyl-CoA carboxylase, biotin containing enzyme; catalyzes carboxylation of cytosolic acetyl-CoA to form malonyl-CoA and regulates histone acetylation by regulating the availablity of acetyl-CoA; required for de novo biosynthesis of long-chain fatty acids; ACC1 has a paralog, HFA1, that arose from the whole genome duplication [Source:SGD;Acc:S000005299])

HSP 1 Score: 63.5438 bits (153), Expect = 6.343e-11
Identity = 78/361 (21.61%), Postives = 145/361 (40.17%), Query Frame = 3
Query:  531 VIGLNDSGGARIQEGVASLAG-----YAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQE-ELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLV---PALDTVVPL-------ESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDI---------------------NASVKGARFVR-FCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITII--TRKAYGGAYDVMSSKHLRGDIN-YAWPTAEVAVMGAKGAVQIIFR 1490
            +IG  D  G     G   +AG     Y +IF            I+L+     G   Y   L      V+    +    P + K +  E  T   +LGG +   + +GV+H    +D+  + ++ E+ +++P    +  PI  + D  DR V   P  D    +       E+ + +      +G+ D+  FFE +  +AK +++G  R+ G  +G+IG + +     +                       N++ K A+ +  F +   +P++   +  GF  G    F  ++++G+ ++ A  +   P I  I  T +  GG++ V+        +  YA   A   V+  +G V I FR
Sbjct: 1693 IIGSEDGLGVECLRGSGLIAGATSRAYHDIFT-----------ITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKMLGREVYTSNLQLGGTQIMYN-NGVSHLTAVDDLAGVEKIVEWMSYVPAKRNMPVPILETKDTWDRPVDFTPTNDETYDVRWMIEGRETESGFE-----YGLFDKGSFFETLSGWAKGVVVGRARLGGIPLGVIGVETRTVENLIPADPANPNSAETLIQEPGQVWHPNSAFKTAQAINDFNNGEQLPMMILANWRGFSGGQRDMFNEVLKYGSFIVDALVDYKQPIIIYIPPTGELRGGSWVVVDPTINADQMEMYADVNARAGVLEPQGMVGIKFR 2036          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Yeast
Match: HFA1 (Mitochondrial acetyl-coenzyme A carboxylase; catalyzes production of malonyl-CoA in mitochondrial fatty acid biosynthesis; relocalizes from mitochondrion to cytoplasm upon DNA replication stress; genetic and comparative analysis suggests that translation begins at a non-canonical (Ile) start codon at -372 relative to the annotated start codon [Source:SGD;Acc:S000004820])

HSP 1 Score: 61.2326 bits (147), Expect = 3.552e-10
Identity = 68/308 (22.08%), Postives = 132/308 (42.86%), Query Frame = 3
Query:  531 VIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDV--TQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLV---PALDTVVPLESTAAY-----NMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPK-----VAAGCLDINA---SVKGARFVRFCDA----------FN----IPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITII 1358
            ++G  +  G    +G   +AG      R++        I+ +     G   Y   L   T  V+D   + +TG   +  V   D+  +  ++GG +     +G+AH    ND+ A+ ++  + +++P    +  P+  + D  DR V   PA    VP E+         +  +   G+ D+  FFE +  +AK +I+G  R+ G  VG+I  + K     + A   ++++   SVK A  V + ++          FN    +PL+   +  GF  G    +  ++++G+ ++ A  +   P +  I
Sbjct: 1588 IVGFEEGLGVECLQGSGLIAGATSKAYRDIFT------ITAVTCRSVGIGSYLVRLGQRTIQVEDKP-IILTGASAINKVLGTDIYTSNLQIGGTQIMYK-NGIAHLTASNDMKAIEKIMTWLSYVPAKRDMSPPLLETMDRWDRDVDFKPA--KQVPYEARWLIEGKWDSNNNFQSGLFDKDSFFETLSGWAKGVIVGRARLGGIPVGVIAVETKTIEEIIPADPANLDSSEFSVKEAGQVWYPNSAFKTAQTINDFNYGEQLPLIILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYKQPILIYI 1885          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Nematostella
Match: EDO37931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SED5])

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 347/468 (74.15%), Postives = 409/468 (87.39%), Query Frame = 3
Query:  174 AVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            +V  +I++ R +A +GGG KRID QH KGKLTARER+HLL D   FVE+D +VEH+C++F MQ  +F GDSV+TG+G I+GR AF+FSQDFTVFGGSLS AHA+KICK+MD+A+LVGAPVIGLNDSGGARIQEGV SLAGYA+IFQRNV +SGV+PQISL+MGPCAGGAVYSPA+TDFTFMVKDTSYLFITGPDVV++VT E VTQ+ LGGAKTHT++SGVA  AFENDV+AL  +REFF +LP SN+  SPIR + DP DR++  LDT+VP +ST  Y++LDV++ ++D+ EFFE+ P YAKNIIIGFGRM+GRTVG++GNQP  AAGCLDINASVKGARFVRFCDAFNIP++TFVDVPGFLPGT+QE GGIIRHGAKLLYAYAEATVPKIT+ITRKAYGGAYDVMSSKHL+GD NYAWPTAEVAVMGA+GAV IIFRG  + +   E EYVD+FANPFPA+ RG +
Sbjct:   44 SVLAQIEKKRQEAQIGGGQKRIDTQHKKGKLTARERLHLLLDPGSFVEYDKYVEHNCTEFNMQNQKFTGDSVVTGHGTINGRLAFVFSQDFTVFGGSLSSAHARKICKIMDKALLVGAPVIGLNDSGGARIQEGVESLAGYADIFQRNVESSGVVPQISLVMGPCAGGAVYSPAITDFTFMVKDTSYLFITGPDVVETVTKEKVTQDYLGGAKTHTTISGVASGAFENDVEALSSIREFFDYLPLSNKTASPIRENEDPCDRIIDNLDTLVPFDSTKPYDILDVVYPILDDGEFFELQPDYAKNIIIGFGRMNGRTVGVVGNQPTEAAGCLDINASVKGARFVRFCDAFNIPIITFVDVPGFLPGTSQEHGGIIRHGAKLLYAYAEATVPKITVITRKAYGGAYDVMSSKHLKGDFNYAWPTAEVAVMGAQGAVSIIFRGRDDIKKC-ENEYVDRFANPFPAATRGFV 510          

HSP 2 Score: 71.633 bits (174), Expect = 3.586e-13
Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDIIEPR TR +IC DL++L+HK+  NPWKKHGNIPL
Sbjct:  502 FPAATRGFVDDIIEPRMTRLRICADLEVLEHKDRKNPWKKHGNIPL 547          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Nematostella
Match: EDO26492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBW1])

HSP 1 Score: 301.982 bits (772), Expect = 4.641e-99
Identity = 146/278 (52.52%), Postives = 194/278 (69.78%), Query Frame = 3
Query:  837 AHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQ-------LSKEAEYVDKFANPFPASVRGLLMILLNHGELDRKYVKIWIYCSTKI 1649
            AH    ND++ L +L+    +LPQSN+   P +  ++  D +   L T++P  +   Y+M DVI G++DE  F+EI   YA+NII+GF R+ GR+VG++ NQP   AG LD+N+S+K ARF RFCDAFNIPLL  VDVPGFLPGT+QE+ GII HGAKLLYA +EATVPK+T+ITRKAYGGAYDVM+SKH+  D N+AWP+AE+AVMGAKGA +IIF+    E        L KEAEY +KFANP+ A+ RG +  ++   +  RK +K +     K+
Sbjct:    1 AHITSANDIECLEDLKRLLRYLPQSNK-ELPRKLPYELNDEVREQLATIIPDNANKPYDMHDVIKGIIDEESFYEIHKNYAENIIVGFARIGGRSVGVVANQPMFLAGVLDVNSSIKAARFTRFCDAFNIPLLVLVDVPGFLPGTDQEWNGIIVHGAKLLYALSEATVPKVTVITRKAYGGAYDVMNSKHIGADFNFAWPSAEIAVMGAKGASEIIFKKEIAEATDHEAKLLEKEAEYAEKFANPYSAAQRGFIDEVILPQDTRRKLLKAFSMLEHKV 277          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Nematostella
Match: EDO42847 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0B5])

HSP 1 Score: 204.912 bits (520), Expect = 3.696e-59
Identity = 143/452 (31.64%), Postives = 219/452 (48.45%), Query Frame = 3
Query:  207 KALLGGGVKRIDAQHSKGKLTARERIHLLCDE-NEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAG---YAEIF--QRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDT--VVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDK 1538
            K  LGG  K  +    + K+  RERI  L D  + F+E      ++   +G +    P   +ITG G++ G    I + D TV GG+      KK  +  + A     P I L DSGGA +            +  IF  Q N+ + G I QI++++G C  G  Y PA+ D + +VK    +F+ GP +VK+ T E V+ E+LGGA  H   SGV     +ND+ AL   R+    L     +   I    DP   + P+ D   +V      +Y++ +VI  VVD S+F E    Y + ++ GF R+HG   GII N      G L   A++KG  F+  C    IPL+   ++ GF+ G   E GGI ++GAK++ A + A VPKIT+I   ++G     M  +       Y WP A ++VMG + A  ++   + +++  +  E+  K
Sbjct:   14 KIKLGGTEKARERHTQRNKMLPRERIANLLDPGSPFLELSQLAGYEL--YGEE--EVPAGGIITGIGRVSGVECMIVTNDPTVKGGTYYPITVKKHLRAQEIAQENRLPCIYLVDSGGANLPRQADVFPDKLHFGRIFFNQANMSSRG-IAQIAVVLGSCTAGGAYVPAMADESIIVKQQGTIFLGGPPLVKAATGEIVSAEDLGGADLHCRTSGVTDYYAQNDLHALYAARDCVRNLNYKKDVSVTIEKPVDP---VYPSDDIYGIVGDNLKKSYDIREVIARVVDGSKFDEFKAMYGETLVTGFARIHGYPCGIIANN-----GVLFSEAALKGTHFIELCCKRKIPLIFLQNITGFMVGKEYEAGGIAKNGAKMVTAVSCAKVPKITVIVGGSFGAGNYGMCGRAYSPRFMYMWPNARISVMGGEQAATVLATVARDQREREGKEFTQK 452          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Nematostella
Match: EDO46914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNT9])

HSP 1 Score: 121.324 bits (303), Expect = 2.139e-29
Identity = 116/439 (26.42%), Postives = 194/439 (44.19%), Query Frame = 3
Query:  261 KLTARERIHLLCDE-NEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGA--RIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNE---DVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLES--TAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPG-FLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIF---RGSGNEQLSKEAEYVDKF 1541
            KL  RERI  L D+ ++F+E+      D  ++G  A+      V++G G++ G    I + D TV  G+L     KK  +  + A     P+I L DSGGA   +Q  +    G    +   VM+S  +P + ++ G C  GA Y P + + T ++     +F+ GP +VK   +     +  +  G A   + VSG     F  D  + +E+            L +P     +PP   +   D +V L         +  +I  +VD S F E    Y   ++ GF  ++G  VG++ N      G +   +++KGA F+  C   ++PL+   +      P T    G +I+  AK++++ A A VPK TII   +YG     M  +       Y WP+A VA+   +   ++         + Q  KEA+ + K+
Sbjct:   55 KLLVRERISRLLDKGSDFLEFSPLAGLDL-EYGTIASA----GVVSGIGRVSGNLCVILANDATVKAGTLYPIGVKKQLRAQEIAEQNRLPLIFLVDSGGAFLPLQAEIFPETGGRTFYNEAVMSSCGVPVVCVVCGSCTAGAAYVPTMAEETVIIDKIGTIFLGGPPLVKVCFSSFLAALKGQGHGTAHVWSHVSGCTDH-FATDEKSSLEMTRQIVASLNRKELPAPSSSYIEPP---LYQSDDLVALSQFDKEILPIYQIISRIVDGSRFQEFKAKYGPELVCGFAHIYGNVVGVVANN-----GSVTSQSALKGAHFIGLCCQRDVPLVFLQNTTSPQRPLTADAAGQLIKDMAKMIHSVACAQVPKFTIIMGGSYGPESFAMCGRSFDPRFIYTWPSARVAMDSPENLTKMALIQGENQSDNQDEKEAKLLKKY 479          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Nematostella
Match: EDO25489 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWB9])

HSP 1 Score: 47.7506 bits (112), Expect = 1.579e-6
Identity = 35/127 (27.56%), Postives = 56/127 (44.09%), Query Frame = 3
Query:  261 KLTARERIHLLCDENEFVEWD-MFVEHDCSDF------------GMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAE 602
            ++ + E   +L D+N F E D      D  +F             M+  +   D+V T  GK  G+   I   DF   GGS+     +KI + +D ++    P + ++ SGGAR+ E   SL   A+
Sbjct:   35 RIGSAEYFQILFDDNVFKELDEKMTSKDPLNFEDTKKYSARLKDAMEKTKLK-DAVRTAVGKSKGKDLVIACMDFAFIGGSMGAVVGEKIARAIDYSIQNNTPFLMISKSGGARMMEAALSLMQLAK 160          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Medaka
Match: pccb (propionyl-CoA carboxylase subunit beta [Source:NCBI gene;Acc:101168086])

HSP 1 Score: 803.512 bits (2074), Expect = 0.000e+0
Identity = 392/510 (76.86%), Postives = 439/510 (86.08%), Query Frame = 3
Query:   81 INYFRIYSPLLNLSRCFATNAVPLQG---------SSHTLAVKKKIDETRNKALLGGGVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQ--ANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGLL 1577
            IN FR    LL   +C AT A   Q          S   L+VK++I++ R  AL+GGG KR+DAQH KGKLTARER+ LL D   FVE DMFVEH CSDFGM+   N+FPGDSV+TG G+I+GR  ++FSQDFTVFGGSLS AHA+KICK+MDQAM VGAPVIGLNDSGGARIQEGV SLAGYA+IF RNV+ASGV+PQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAH+AFENDV+AL+ LREFF FLP SN+   PIR  HDP DRLV ALDT+VP EST AY+ML++IH +VDE +FFEIMP+YAKNI++GF RM+GRTVGI+GNQPKVA+GCLDIN+SVKGARFVRFCDAFNIP++TFVDVPGFLPGT QE+GGIIRHGAKLL+A+AEATVPKITIITRKAYGGAYDVMSSKHLRGD+NYAWPTAEVAVMGAKGAVQIIFRG  N Q   EAEYV+KFANPFPA+VRG +
Sbjct:   15 INSFRGSFRLLAQVKCGATPASGPQSHVPRACRWYSVSHLSVKERIEKKRKAALIGGGQKRVDAQHKKGKLTARERVALLLDPESFVETDMFVEHRCSDFGMEQDTNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAMTVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVLASGVVPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHRAFENDVEALLNLREFFNFLPLSNQDAPPIRECHDPSDRLVKALDTIVPFESTKAYDMLEIIHAIVDERDFFEIMPSYAKNIVVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPIITFVDVPGFLPGTAQEYGGIIRHGAKLLFAFAEATVPKITIITRKAYGGAYDVMSSKHLRGDVNYAWPTAEVAVMGAKGAVQIIFRGKEN-QAEAEAEYVEKFANPFPAAVRGFV 523          

HSP 2 Score: 64.3142 bits (155), Expect = 1.838e-10
Identity = 28/46 (60.87%), Postives = 32/46 (69.57%), Query Frame = 2
Query: 1550 FPSFCQRIVDDIIEPRRTRSKICQDLDLLQHKNLSNPWKKHGNIPL 1687
            FP+  +  VDDIIEP  TR KIC DL++L  K   NPWKKH NIPL
Sbjct:  515 FPAAVRGFVDDIIEPSSTRKKICSDLEVLASKKQVNPWKKHANIPL 560          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Medaka
Match: mccc2 (methylcrotonoyl-CoA carboxylase 2 [Source:NCBI gene;Acc:101162686])

HSP 1 Score: 207.608 bits (527), Expect = 1.537e-59
Identity = 147/462 (31.82%), Postives = 223/462 (48.27%), Query Frame = 3
Query:  177 VKKKIDETRN---KALLGGGVKRIDAQHSKGKLTARERIHLLCDE-NEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAG---YAEIFQRNV-MASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPA--LDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYV 1532
            +K  +DE ++   K  LGGG K      S+GKL  RERI  L D    F+E+  F  ++   +G +    P   +ITG G++ G    + + D TV GG+      KK  +  + A     P I L DSGGA +            +  IF     ++S  I QI+++MG C  G  Y PA+ D + +V+    +F+ GP +VK+ T E+V+ E+LGGA  H   SGV      +D  AL   R+    L     +   +  +  P   L PA  L  +V       +++ +VI  +VD S+F E    Y   +I GF R+ G  VGIIGN      G L   ++ KG  F+  C   NIPL+   ++ GF+ G   E GGI + GAK++ A A A VPKIT+I   +YG     M  +       Y WP + ++VMG + A  ++   + +++  +  E+ 
Sbjct:   15 MKALVDELKSRTEKIKLGGGEKARRLHTSRGKLLPRERIDRLLDPGTPFLEFSQFAAYEL--YGKE--EVPAGGIITGIGRVSGVECVVVANDATVKGGTYYPVTVKKHLRAQEIAQQNHLPCIYLVDSGGANLPRQADVFPDRDHFGRIFYNQARLSSEAIAQIAVVMGSCTAGGAYVPAMADESIIVRKQGTIFLGGPPLVKAATGEEVSAEDLGGADLHCKKSGVTDHYALDDNHALHLARKAVRSLNYKKDVQVTVEPTEAP---LYPADELYGIVGDNLKRNFDVREVIARIVDGSKFDEFKAFYGDTLITGFSRIFGYPVGIIGNN-----GVLFSESAKKGTHFIELCCQRNIPLVFLQNITGFMVGREYEAGGIAKDGAKMVTAVACANVPKITVIIGGSYGAGNYGMCGRAYSPRFLYMWPNSRISVMGGEQAATVLATITKDQRAREGKEFT 464          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Medaka
Match: mccc2 (methylcrotonoyl-CoA carboxylase 2 [Source:NCBI gene;Acc:101162686])

HSP 1 Score: 207.608 bits (527), Expect = 2.585e-59
Identity = 147/462 (31.82%), Postives = 223/462 (48.27%), Query Frame = 3
Query:  177 VKKKIDETRN---KALLGGGVKRIDAQHSKGKLTARERIHLLCDE-NEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARIQEGVASLAG---YAEIFQRNV-MASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPA--LDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYV 1532
            +K  +DE ++   K  LGGG K      S+GKL  RERI  L D    F+E+  F  ++   +G +    P   +ITG G++ G    + + D TV GG+      KK  +  + A     P I L DSGGA +            +  IF     ++S  I QI+++MG C  G  Y PA+ D + +V+    +F+ GP +VK+ T E+V+ E+LGGA  H   SGV      +D  AL   R+    L     +   +  +  P   L PA  L  +V       +++ +VI  +VD S+F E    Y   +I GF R+ G  VGIIGN      G L   ++ KG  F+  C   NIPL+   ++ GF+ G   E GGI + GAK++ A A A VPKIT+I   +YG     M  +       Y WP + ++VMG + A  ++   + +++  +  E+ 
Sbjct:   50 MKALVDELKSRTEKIKLGGGEKARRLHTSRGKLLPRERIDRLLDPGTPFLEFSQFAAYEL--YGKE--EVPAGGIITGIGRVSGVECVVVANDATVKGGTYYPVTVKKHLRAQEIAQQNHLPCIYLVDSGGANLPRQADVFPDRDHFGRIFYNQARLSSEAIAQIAVVMGSCTAGGAYVPAMADESIIVRKQGTIFLGGPPLVKAATGEEVSAEDLGGADLHCKKSGVTDHYALDDNHALHLARKAVRSLNYKKDVQVTVEPTEAP---LYPADELYGIVGDNLKRNFDVREVIARIVDGSKFDEFKAFYGDTLITGFSRIFGYPVGIIGNN-----GVLFSESAKKGTHFIELCCQRNIPLVFLQNITGFMVGREYEAGGIAKDGAKMVTAVACANVPKITVIIGGSYGAGNYGMCGRAYSPRFLYMWPNSRISVMGGEQAATVLATITKDQRAREGKEFT 499          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Medaka
Match: si:ch211-198n5.11 (methylcrotonoyl-CoA carboxylase beta chain, mitochondrial [Source:NCBI gene;Acc:101163479])

HSP 1 Score: 153.68 bits (387), Expect = 9.459e-40
Identity = 107/380 (28.16%), Postives = 173/380 (45.53%), Query Frame = 3
Query:  351 FGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGA--RIQEGV--ASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSG-VAHKAFEND--VDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDV--PGFLPGTNQEF---GGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAV 1454
             G+     P    +TG G+I G      + D TV GG+      KK  +  + A+    P + L DSGGA   +Q  +      G    +   +M++  IPQ++++ G C  G  Y P + +   MV     +F+ GP +VK+ T E+VT EELGGA+ H  VSG V H A+E     D    +   F F        S  R + + P      L  + P     + +   ++  + D S F E    Y   +I GF ++HG  VGI+ N      G L   A++KG+ F++ CD  ++PL+   +    G L  + ++       ++    ++ A A A+VPKIT++   ++G     M  +    +  + WP A V+V
Sbjct:  114 LGLPYGDIPSAGCLTGIGRISGLWCVFIANDATVKGGTAYPITVKKQLRAQEIAIQNRLPCVYLVDSGGAFLPLQSEIFPDKNQGGRTFYNEAIMSAMKIPQVAVVCGSCTAGGAYIPTMAEEAVMVHRIGTIFLGGPPLVKAATGEEVTPEELGGARLHAEVSGCVDHFAWEEKEAFDYTKNIISTFNFQLPHEEEDSTRRKAAEEPLYASEELMGLAPRSYNYSLDAKMIVSRLTDGSRFQEFKALYGTTLISGFAKIHGHLVGIVANN-----GVLSYEAALKGSHFIQLCDQRDVPLIFLQNTAPSGALTLSTKQAEMNSNCLKAQGSMMAAVACASVPKITVVVGGSHGADSYAMCGRAFEPNFLFLWPNARVSV 488          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Medaka
Match: acaca (acetyl-CoA carboxylase [Source:NCBI gene;Acc:101155873])

HSP 1 Score: 68.9366 bits (167), Expect = 1.181e-11
Identity = 77/345 (22.32%), Postives = 145/345 (42.03%), Query Frame = 3
Query:  573 GVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDV--TQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNML----------DVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAA-------GCLDINASV--------------KGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKA--YGGAYDV----MSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFR 1490
            GV +L G   I   + +A   I  ++L+     G   Y   L   T  V++ S++ +TG   +  V   +V  +  +LGG +   + +GV H    +D + +  L ++ +++P+      PI  + DP DR +  + T  P +      ML              G  D   F EIM  +A+++++G  R+ G   G++  + +            LD  A +              K A+ ++  +   +PL+ F +  GF  G    +  +++ GA ++    E   P +  I  +A   GG++ V    ++ +H+     YA   +   V+  +G V+I FR
Sbjct: 1538 GVENLRGSGMIAGESSLAYEEIITMNLVTCRAIGIGAYLVRLGQRTIQVEN-SHIILTGAGALNKVLGREVYTSNNQLGGVQIMHN-NGVTHCTVCDDFEGVFTLLQWLSYMPKCKSSPVPILSAKDPIDRPIEFVPTKTPYDPRW---MLAGRPSQTPKGSWQSGFFDHGSFMEIMQPWAQSVVVGRARLGGIPTGVVAVETRSVELSIPADPANLDSEAKLIQQAGQVWFPDSAFKTAQAIKDLNREGLPLMVFSNWRGFSGGMKDMYDQVLKFGAYIVDGLREYKQPVLVYIPPQAELRGGSWVVIDPTINPRHME---MYADKDSRGGVLEPEGTVEIKFR 1874          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Planmine SMEST
Match: SMESG000035087.1 (SMESG000035087.1)

HSP 1 Score: 225.328 bits (573), Expect = 4.962e-66
Identity = 147/444 (33.11%), Postives = 222/444 (50.00%), Query Frame = 3
Query:  213 LLGGGVKRIDAQHSKGKLTARERIHLLCD-ENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGGARI--QEGV-ASLAGYAEIF--QRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTNQEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAE 1526
            + GGG K      S+GK+  R+RI+ L D  + F+E+  F  +   D  +     P   +ITG G+++G    + + D TV GGS      KK  +  D A     P I L DSGGA +  Q  V      +  IF  Q N+ A   IPQI++++G C  G  Y PA+ D + +VK+   +F+ GP +VK+ T E ++ E+LGGA  H   SGV      ND DA+   R     L +  R+   +    +PP      L  +V   S   +NM ++I  +VD S+  E  P Y + +I GF R+ G  VGI+ N      G L   +++KG  F++ C    IPL+    + GF+ G + E GGI ++GAKL+ A A A VPKIT+I   +YG     M  +       Y WP A ++VMG + A  ++ +   ++++    E
Sbjct:   68 IQGGGEKACQRHVSRGKMLPRDRINTLLDFGSPFLEFSQFAGYQMYDNEI----VPAGGLITGIGRVNGVECMVIANDPTVKGGSYYPITVKKHIRAQDIARENNLPCIYLVDSGGANLPRQSNVFPDRDHFGRIFFNQANLSAD-RIPQIAVVLGSCTAGGAYVPAMADQSVIVKNQGTIFLAGPPLVKAATGESISSEDLGGADLHCRKSGVTDHYAMNDNDAIHITRSIILNLNRKKRMSVTVEKP-EPPRYSPDELYGIVEANSKRLFNMYEIIARIVDGSKIQEFKPLYGETLICGFSRIWGYPVGILANN-----GVLFSESALKGTHFIQLCCQRKIPLIFLQHITGFMVGRDAEAGGIAKNGAKLVTAVATANVPKITVIVGNSYGAGNYGMCGRAFGPRFLYMWPNARISVMGGEQAANVLVQIQKDQRIRDGKE 500          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Planmine SMEST
Match: SMESG000023291.1 (SMESG000023291.1)

HSP 1 Score: 157.918 bits (398), Expect = 1.055e-41
Identity = 121/467 (25.91%), Postives = 212/467 (45.40%), Query Frame = 3
Query:   93 RIYSPLLNLSRCFATNAVPLQGSSHTLAVKKKIDETRNKALLGGGVKRIDAQHSK--GKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRFPGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVGAPVIGLNDSGG------ARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPALDTVVPLESTAAYN----MLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDV--PGFLPGTNQEF---GGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTA 1442
            + +S LLN       N    +  S  L+ K KI ++   +   GG +R   +H +   KL   +R++LL D  +++E        C  +G      P    +T  GKI+ R   + + D TV  G++     +K  +    +M +  P+I L DS G      ARI         Y   +   ++ S  IP ISL+ G C  G  Y P ++    M+ ++S++F+ GP +VK+ T E+++ +ELGGA  H+ +SG     F+ +   L  +R+  + LP  + L    +     P  L   LD ++     A  +    M+ ++  ++D S F E    Y  N+I G+GR+ G +VGI+        G L  N  +KG+ F++ C    I +++ V        P  + E    G +++  + ++ + A      IT++   A G  Y  +  + ++ D  +AWP +
Sbjct:   14 KSFSTLLNGFNINNENFSKCKEISFNLSNKIKIIKS---SFSEGGGERARYKHVQHNNKLLVSDRLNLLFDNGKYLEIGF-----CVGYGQSYGNIPKSGCVTAIGKINNRFCLVTASDATVKAGAIYPIQLRKQIRFQSLSMHLHLPIIFLVDSSGGFLPLQARIFPDKDHGGKY--FYNEALIQSKGIPVISLVCGSCTAGGAYIPTMSSENGMILNSSHIFLGGPPLVKAATGENMSADELGGADLHSRISGCTDYIFQTETAGLACIRDIISSLPHQS-LSMETKEGSVDPLYLSDELDGLLLNYGKAGDDSHSVMMQILSRILDGSRFNEYKSKYGTNLIAGYGRISGFSVGIL-----ACHGLLTENDCLKGSNFIQLCGNRKISIISLVHTVEESSFPRISSEVDIDGSVVKAKSLMMRSMATRNCKMITVVIGDAVGLDYICLGGRSMKPDFLFAWPNS 464          
BLAST of Propionyl-CoA carboxylase subunit beta vs. Planmine SMEST
Match: SMESG000023291.1 (SMESG000023291.1)

HSP 1 Score: 125.561 bits (314), Expect = 2.919e-31
Identity = 86/319 (26.96%), Postives = 147/319 (46.08%), Query Frame = 3
Query:  528 PVIGLNDSGG------ARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTSVSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDP---PDRLVPALDTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTVGIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDV--PGFLPGTNQEF---GGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDINYAWPTA 1442
            P+I L DS G      ARI         Y   +   ++ S  IP ISL+ G C  G  Y P ++    M+ ++S++F+ GP +VK+ T E+++ +ELGGA  H+ +SG     F+ +   L  +R+  + LP  +        S DP    D L   L         +   M+ ++  ++D S F E    Y  N+I G+GR+ G +VGI+        G L  N  +KG+ F++ C    I +++ V        P  + E    G +++  + ++ + A      IT++   A G  Y  +  + ++ D  +AWP +
Sbjct:    6 PIIFLVDSSGGFLPLQARIFPDKDHGGKY--FYNEALIQSKGIPVISLVCGSCTAGGAYIPTMSSENGMILNSSHIFLGGPPLVKAATGENMSADELGGADLHSRISGCTDYIFQTETAGLACIRDIISSLPHQSLSMETKEGSVDPLYLSDELDGLLLNYGKAGDDSHSVMMQILSRILDGSRFNEYKSKYGTNLIAGYGRISGFSVGIL-----ACHGLLTENDCLKGSNFIQLCGNRKISIISLVHTVEESSFPRISSEVDIDGSVVKAKSLMMRSMATRNCKMITVVIGDAVGLDYICLGGRSMKPDFLFAWPNS 317          
The following BLAST results are available for this feature:
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCCB0.000e+078.69propionyl-CoA carboxylase subunit beta [Source:HGN... [more]
PCCB3.581e-978.69propionyl-CoA carboxylase subunit beta [Source:HGN... [more]
PCCB4.049e-975.51propionyl-CoA carboxylase subunit beta [Source:HGN... [more]
PCCB3.745e-975.71propionyl-CoA carboxylase subunit beta [Source:HGN... [more]
PCCB4.141e-973.86propionyl-CoA carboxylase subunit beta [Source:HGN... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pccb-16.710e-1276.45Propionyl Coenzyme A Carboxylase Beta subunit [So... [more]
pccb-16.892e-1276.45Propionyl Coenzyme A Carboxylase Beta subunit [So... [more]
pccb-16.892e-1276.45Propionyl Coenzyme A Carboxylase Beta subunit [So... [more]
F02A9.105.230e-6531.52Probable methylcrotonoyl-CoA carboxylase beta chai... [more]
pod-23.486e-1223.96pep chromosome:WBcel235:II:1143908:1152665:1 gene:... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mccc28.125e-6632.21gene:FBgn0042083 transcript:FBtr0086126[more]
ACC1.463e-1023.88gene:FBgn0033246 transcript:FBtr0339124[more]
ACC1.463e-1023.88gene:FBgn0033246 transcript:FBtr0339125[more]
ACC1.463e-1023.88gene:FBgn0033246 transcript:FBtr0088872[more]
ACC1.463e-1023.88gene:FBgn0033246 transcript:FBtr0113053[more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pccb6.376e-1075.64propionyl-CoA carboxylase subunit beta [Source:ZFI... [more]
mccc21.338e-6032.54methylcrotonoyl-CoA carboxylase 2 (beta) [Source:Z... [more]
si:ch211-198n5.117.970e-4425.57si:ch211-198n5.11 [Source:ZFIN;Acc:ZDB-GENE-050411... [more]
si:ch211-198n5.118.811e-4425.57si:ch211-198n5.11 [Source:ZFIN;Acc:ZDB-GENE-050411... [more]
acacb8.753e-1624.10acetyl-CoA carboxylase beta [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCCB6.744e-677.29propionyl-CoA carboxylase subunit beta [Source:NCB... [more]
PCCB7.524e-1074.05propionyl-CoA carboxylase subunit beta [Source:NCB... [more]
PCCB7.057e-1073.47propionyl-CoA carboxylase subunit beta [Source:NCB... [more]
PCCB6.492e-1074.69propionyl-CoA carboxylase subunit beta [Source:NCB... [more]
PCCB6.479e-1072.99propionyl-CoA carboxylase subunit beta [Source:NCB... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pccb1.179e-878.90propionyl Coenzyme A carboxylase, beta polypeptide... [more]
Pccb1.219e-871.31propionyl Coenzyme A carboxylase, beta polypeptide... [more]
Pccb2.682e-11968.06propionyl Coenzyme A carboxylase, beta polypeptide... [more]
Mccc29.973e-6233.33methylcrotonoyl-Coenzyme A carboxylase 2 (beta) [S... [more]
Pccb3.175e-3655.74propionyl Coenzyme A carboxylase, beta polypeptide... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P05166|PCCB_HUMAN1.720e-878.69Propionyl-CoA carboxylase beta chain, mitochondria... [more]
sp|Q99MN9|PCCB_MOUSE8.248e-878.90Propionyl-CoA carboxylase beta chain, mitochondria... [more]
sp|Q2TBR0|PCCB_BOVIN2.029e-878.27Propionyl-CoA carboxylase beta chain, mitochondria... [more]
sp|P79384|PCCB_PIG2.011e-878.06Propionyl-CoA carboxylase beta chain, mitochondria... [more]
sp|P07633|PCCB_RAT1.070e-778.06Propionyl-CoA carboxylase beta chain, mitochondria... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K7Z12.425e-683.83Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A433TB361.602e-681.91Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
V4AQQ78.827e-778.07Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A0B7AZ381.610e-781.10Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A2I4C5J04.884e-777.10propionyl-CoA carboxylase beta chain, mitochondria... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pccb2.594e-1077.41propionyl-CoA carboxylase subunit beta [Source:NCB... [more]
pccb2.605e-1064.27propionyl-CoA carboxylase subunit beta [Source:NCB... [more]
mccc26.384e-6030.82methylcrotonoyl-CoA carboxylase 2 [Source:NCBI gen... [more]
mccc22.887e-5730.77methylcrotonoyl-CoA carboxylase 2 [Source:NCBI gen... [more]
si:ch211-198n5.111.002e-4928.45si:ch211-198n5.11 [Source:ZFIN;Acc:ZDB-GENE-050411... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007626.17.860e-6032.31pep scaffold:Pmarinus_7.0:GL476395:36593:140427:1 ... [more]
ENSPMAT00000003643.11.608e-823.98pep scaffold:Pmarinus_7.0:GL479165:7567:28556:1 ge... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ACC16.343e-1121.61Acetyl-CoA carboxylase, biotin containing enzyme; ... [more]
HFA13.552e-1022.08Mitochondrial acetyl-coenzyme A carboxylase; catal... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO379313.586e-1374.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO264924.641e-9952.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428473.696e-5931.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469142.139e-2926.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO254891.579e-627.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pccb1.838e-1076.86propionyl-CoA carboxylase subunit beta [Source:NCB... [more]
mccc21.537e-5931.82methylcrotonoyl-CoA carboxylase 2 [Source:NCBI gen... [more]
mccc22.585e-5931.82methylcrotonoyl-CoA carboxylase 2 [Source:NCBI gen... [more]
si:ch211-198n5.119.459e-4028.16methylcrotonoyl-CoA carboxylase beta chain, mitoch... [more]
acaca1.181e-1122.32acetyl-CoA carboxylase [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of Propionyl-CoA carboxylase subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000035087.14.962e-6633.11SMESG000035087.1[more]
SMESG000023291.11.055e-4125.91SMESG000023291.1[more]
SMESG000023291.12.919e-3126.96SMESG000023291.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001449 ID=SMED30001449|Name=Propionyl-CoA carboxylase subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=1722bp
AATTAATGTTATAATCTACGTGACGTTAGGCACTCATCATTATTAAAGAA
ATTTTGAAGCTTAACATAATTTAGATGTCTATAAATTATTTTCGTATTTA
TTCGCCGCTTTTGAATTTATCAAGATGTTTTGCTACTAATGCTGTTCCTT
TACAAGGTTCTTCTCATACCTTAGCAGTTAAAAAGAAAATAGATGAAACA
CGTAATAAAGCATTGTTAGGCGGTGGTGTTAAACGAATCGATGCTCAACA
TAGTAAAGGAAAGCTCACTGCACGTGAAAGAATACATTTATTATGTGACG
AAAATGAATTTGTAGAATGGGACATGTTTGTTGAACATGATTGTTCAGAT
TTTGGAATGCAAGCAAATAGATTTCCTGGAGATAGTGTCATAACTGGTTA
TGGTAAAATACATGGTCGACCAGCTTTTATTTTCAGTCAAGATTTTACAG
TTTTTGGTGGTAGTCTTAGTATGGCTCATGCCAAAAAAATTTGCAAAGTT
ATGGATCAAGCAATGCTTGTAGGAGCTCCTGTTATTGGACTCAATGACTC
TGGCGGAGCCAGAATTCAAGAAGGTGTTGCTTCTTTGGCTGGATATGCCG
AAATCTTTCAACGTAACGTTATGGCTTCTGGGGTTATACCCCAAATTTCA
TTGATAATGGGGCCATGCGCCGGAGGAGCTGTGTATTCTCCTGCTTTAAC
TGATTTTACGTTTATGGTTAAAGATACAAGCTATCTATTCATCACTGGCC
CAGATGTTGTAAAATCTGTAACAAATGAAGATGTGACTCAAGAAGAATTG
GGAGGAGCTAAAACGCACACATCAGTATCTGGAGTTGCTCACAAAGCTTT
TGAAAATGATGTCGATGCTCTTATGGAATTACGGGAATTTTTCACTTTTC
TTCCTCAAAGTAATCGGTTACATTCTCCAATACGACACAGTCATGATCCA
CCCGATCGATTGGTTCCTGCATTGGATACAGTTGTTCCCTTAGAATCTAC
AGCTGCATATAATATGCTCGATGTTATACATGGAGTTGTAGATGAAAGTG
AATTTTTCGAGATTATGCCTACTTATGCTAAAAATATTATTATTGGTTTT
GGCCGCATGCACGGACGCACTGTTGGGATAATTGGAAATCAACCCAAAGT
TGCTGCTGGATGTTTAGATATAAATGCTTCTGTCAAAGGTGCTAGATTTG
TGCGATTTTGTGATGCTTTCAATATTCCGTTGCTTACATTTGTTGATGTT
CCCGGGTTTTTACCGGGAACTAACCAAGAGTTTGGTGGCATTATTCGTCA
TGGAGCTAAGTTGCTGTATGCATATGCAGAAGCTACAGTACCAAAAATTA
CTATTATTACTCGCAAGGCTTATGGTGGGGCCTATGATGTTATGAGCTCC
AAACATTTACGTGGGGACATTAATTATGCATGGCCAACTGCAGAAGTCGC
TGTTATGGGTGCTAAAGGAGCGGTTCAAATTATCTTCAGAGGTTCTGGCA
ATGAACAACTTAGCAAGGAAGCAGAATATGTTGATAAATTTGCAAATCCT
TTCCCAGCTTCTGTCAGAGGATTGTTGATGATATTATTGAACCACGGAGA
ACTCGATCGAAAATATGTCAAGATCTGGATTTATTGCAGCACAAAAATCT
TTCGAATCCTTGGAAAAAGCATGGCAATATTCCACTGTGAATGATGATAA
ACTAGTTCATTTTATTATAAAC
back to top

protein sequence of SMED30001449-orf-1

>SMED30001449-orf-1 ID=SMED30001449-orf-1|Name=SMED30001449-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=540bp
MSINYFRIYSPLLNLSRCFATNAVPLQGSSHTLAVKKKIDETRNKALLGG
GVKRIDAQHSKGKLTARERIHLLCDENEFVEWDMFVEHDCSDFGMQANRF
PGDSVITGYGKIHGRPAFIFSQDFTVFGGSLSMAHAKKICKVMDQAMLVG
APVIGLNDSGGARIQEGVASLAGYAEIFQRNVMASGVIPQISLIMGPCAG
GAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTS
VSGVAHKAFENDVDALMELREFFTFLPQSNRLHSPIRHSHDPPDRLVPAL
DTVVPLESTAAYNMLDVIHGVVDESEFFEIMPTYAKNIIIGFGRMHGRTV
GIIGNQPKVAAGCLDINASVKGARFVRFCDAFNIPLLTFVDVPGFLPGTN
QEFGGIIRHGAKLLYAYAEATVPKITIITRKAYGGAYDVMSSKHLRGDIN
YAWPTAEVAVMGAKGAVQIIFRGSGNEQLSKEAEYVDKFANPFPASVRGL
LMILLNHGELDRKYVKIWIYCSTKIFRILGKSMAIFHCE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
PLANA:0007547anterior pole progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR000022Carboxyl_trans
IPR029045ClpP/crotonase-like_dom_sf
IPR011763COA_CT_C
IPR011762COA_CT_N
Vocabulary: molecular function
TermDefinition
GO:0016874ligase activity
GO:0000166nucleotide binding
GO:0004658propionyl-CoA carboxylase activity
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005759mitochondrial matrix