RNA-binding protein 25

Overview
NameRNA-binding protein 25
Smed IDSMED30001446
Length (bp)2564
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA-binding protein 25 (SMED30001446) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA-binding protein 25 (SMED30001446) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA-binding protein 25 (SMED30001446) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA-binding protein 25 (SMED30001446) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001446

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30001446SMESG000074806.1 dd_Smed_v4_3955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001446SMESG000074806.1 dd_Smed_v4_3955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001446SMESG000074806.1 dd_Smed_v4_3955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001446SMESG000074806.1 dd_Smed_v4_3955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001446SMESG000074806.1 dd_Smed_v6_3955_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30001446SMESG000074806.1 dd_Smed_v6_3955_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA-binding protein 25 vs. Ensembl Human
Match: RBM25 (RNA binding motif protein 25 [Source:HGNC Symbol;Acc:HGNC:23244])

HSP 1 Score: 149.058 bits (375), Expect = 3.029e-36
Identity = 70/131 (53.44%), Postives = 96/131 (73.28%), Query Frame = 3
Query: 2070 ENESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            E++ N  +G  N   T EK   +  +K +I+ IPT+K ELF+Y ++W ++D   +E  ++PWINKKIIEYIGEEE TL  F+C +V+ H +P  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGLVK
Sbjct:  719 EDDKNATKGTVN---TEEK---RKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK 843          

HSP 2 Score: 117.087 bits (292), Expect = 3.418e-26
Identity = 54/98 (55.10%), Postives = 70/98 (71.43%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKT 800
            N  P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+  K K +
Sbjct:   82 NCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKAS 179          

HSP 3 Score: 73.9442 bits (180), Expect = 9.050e-13
Identity = 60/132 (45.45%), Postives = 94/132 (71.21%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQ 1715
            D YE    +KLE+KLR+KEA+YQ+RL+ WE+RE+++ +EY  E ERE+ ++ ++++EAK+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL E +PD +  + +MEQ
Sbjct:  439 DAYER---RKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHPDPDAELQRMEQ 567          
BLAST of RNA-binding protein 25 vs. Ensembl Human
Match: RBM25 (RNA binding motif protein 25 [Source:HGNC Symbol;Acc:HGNC:23244])

HSP 1 Score: 149.058 bits (375), Expect = 3.029e-36
Identity = 70/131 (53.44%), Postives = 96/131 (73.28%), Query Frame = 3
Query: 2070 ENESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            E++ N  +G  N   T EK   +  +K +I+ IPT+K ELF+Y ++W ++D   +E  ++PWINKKIIEYIGEEE TL  F+C +V+ H +P  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGLVK
Sbjct:  719 EDDKNATKGTVN---TEEK---RKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK 843          

HSP 2 Score: 117.087 bits (292), Expect = 3.418e-26
Identity = 54/98 (55.10%), Postives = 70/98 (71.43%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKT 800
            N  P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+  K K +
Sbjct:   82 NCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKAS 179          

HSP 3 Score: 73.9442 bits (180), Expect = 9.050e-13
Identity = 60/132 (45.45%), Postives = 94/132 (71.21%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQ 1715
            D YE    +KLE+KLR+KEA+YQ+RL+ WE+RE+++ +EY  E ERE+ ++ ++++EAK+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL E +PD +  + +MEQ
Sbjct:  439 DAYER---RKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHPDPDAELQRMEQ 567          
BLAST of RNA-binding protein 25 vs. Ensembl Human
Match: RBM25 (RNA binding motif protein 25 [Source:HGNC Symbol;Acc:HGNC:23244])

HSP 1 Score: 114.39 bits (285), Expect = 8.287e-28
Identity = 52/91 (57.14%), Postives = 67/91 (73.63%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEY 779
            N  P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+
Sbjct:   82 NCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEW 172          
BLAST of RNA-binding protein 25 vs. Ensembl Human
Match: RBM25 (RNA binding motif protein 25 [Source:HGNC Symbol;Acc:HGNC:23244])

HSP 1 Score: 114.775 bits (286), Expect = 1.918e-27
Identity = 52/91 (57.14%), Postives = 67/91 (73.63%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEY 779
            N  P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+
Sbjct:   82 NCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEW 172          
BLAST of RNA-binding protein 25 vs. Ensembl Human
Match: RBM25 (RNA binding motif protein 25 [Source:HGNC Symbol;Acc:HGNC:23244])

HSP 1 Score: 114.39 bits (285), Expect = 2.948e-27
Identity = 52/91 (57.14%), Postives = 67/91 (73.63%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEY 779
            N  P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+
Sbjct:   82 NCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEW 172          
BLAST of RNA-binding protein 25 vs. Ensembl Celegans
Match: rbm-25 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:H2L2D0])

HSP 1 Score: 118.242 bits (295), Expect = 1.121e-27
Identity = 45/106 (42.45%), Postives = 78/106 (73.58%), Query Frame = 3
Query: 2142 MMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLV 2459
            + K+II  IP +K+ELF + IEWD +D  ++   ++PW+ KK+ +++GEE+ +   FICDQ+ +  TP +IL D++++++E+AE FV+KMWRLLIY  + +++G+ 
Sbjct:  394 LTKQIIKTIPATKDELFVHRIEWDQLDGKWMNDRIRPWVAKKVTQFLGEEDKSFCDFICDQIEKQATPQEILKDVAVIIDEDAEQFVIKMWRLLIYEGQARRLGIT 499          

HSP 2 Score: 78.9518 bits (193), Expect = 5.713e-15
Identity = 46/118 (38.98%), Postives = 74/118 (62.71%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKE 1673
            D  E   FK++   + DK+ +Y  RL+ WE RE++ +K Y  EE +EK +K  L +E K+L++F E+YDDE  D KYY +S+  +R    + E   D KDR +E ++IE  +R++++E
Sbjct:  100 DAREKRAFKQM---MLDKKQAYLARLKRWESRERQMSKRYEREERKEKDRKKTLQKEGKRLKLFLEDYDDEKDDPKYYTSSQFFQRKRDYEREREADQKDRMQEQQEIEELKRQIMEE 214          
BLAST of RNA-binding protein 25 vs. Ensembl Celegans
Match: rbm-25 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:H2L2D0])

HSP 1 Score: 117.472 bits (293), Expect = 8.224e-27
Identity = 45/106 (42.45%), Postives = 78/106 (73.58%), Query Frame = 3
Query: 2142 MMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLV 2459
            + K+II  IP +K+ELF + IEWD +D  ++   ++PW+ KK+ +++GEE+ +   FICDQ+ +  TP +IL D++++++E+AE FV+KMWRLLIY  + +++G+ 
Sbjct:  600 LTKQIIKTIPATKDELFVHRIEWDQLDGKWMNDRIRPWVAKKVTQFLGEEDKSFCDFICDQIEKQATPQEILKDVAVIIDEDAEQFVIKMWRLLIYEGQARRLGIT 705          

HSP 2 Score: 88.9669 bits (219), Expect = 5.699e-18
Identity = 38/89 (42.70%), Postives = 60/89 (67.42%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLK 773
            ++SPV   F+ NIS+K  D  ++ IL++CG + +WKR++G++GKLQ FG C + + E TLR +R+L+   + DK L VK D K  + L+
Sbjct:   45 DSSPV---FVGNISDKCSDEFIRKILNECGNVASWKRIKGSNGKLQGFGFCHFTDLEGTLRALRILHEFHLGDKKLTVKPDEKVRDDLR 130          

HSP 3 Score: 81.2629 bits (199), Expect = 1.839e-15
Identity = 46/118 (38.98%), Postives = 74/118 (62.71%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKE 1673
            D  E   FK++   + DK+ +Y  RL+ WE RE++ +K Y  EE +EK +K  L +E K+L++F E+YDDE  D KYY +S+  +R    + E   D KDR +E ++IE  +R++++E
Sbjct:  306 DAREKRAFKQM---MLDKKQAYLARLKRWESRERQMSKRYEREERKEKDRKKTLQKEGKRLKLFLEDYDDEKDDPKYYTSSQFFQRKRDYEREREADQKDRMQEQQEIEELKRQIMEE 420          
BLAST of RNA-binding protein 25 vs. Ensembl Celegans
Match: rbm-25 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:H2L2D0])

HSP 1 Score: 117.472 bits (293), Expect = 8.277e-27
Identity = 45/106 (42.45%), Postives = 78/106 (73.58%), Query Frame = 3
Query: 2142 MMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLV 2459
            + K+II  IP +K+ELF + IEWD +D  ++   ++PW+ KK+ +++GEE+ +   FICDQ+ +  TP +IL D++++++E+AE FV+KMWRLLIY  + +++G+ 
Sbjct:  602 LTKQIIKTIPATKDELFVHRIEWDQLDGKWMNDRIRPWVAKKVTQFLGEEDKSFCDFICDQIEKQATPQEILKDVAVIIDEDAEQFVIKMWRLLIYEGQARRLGIT 707          

HSP 2 Score: 89.3521 bits (220), Expect = 5.428e-18
Identity = 38/89 (42.70%), Postives = 60/89 (67.42%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLK 773
            ++SPV   F+ NIS+K  D  ++ IL++CG + +WKR++G++GKLQ FG C + + E TLR +R+L+   + DK L VK D K  + L+
Sbjct:   45 DSSPV---FVGNISDKCSDEFIRKILNECGNVASWKRIKGSNGKLQGFGFCHFTDLEGTLRALRILHEFHLGDKKLTVKPDEKVRDDLR 130          

HSP 3 Score: 81.2629 bits (199), Expect = 1.796e-15
Identity = 46/118 (38.98%), Postives = 74/118 (62.71%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKE 1673
            D  E   FK++   + DK+ +Y  RL+ WE RE++ +K Y  EE +EK +K  L +E K+L++F E+YDDE  D KYY +S+  +R    + E   D KDR +E ++IE  +R++++E
Sbjct:  306 DAREKRAFKQM---MLDKKQAYLARLKRWESRERQMSKRYEREERKEKDRKKTLQKEGKRLKLFLEDYDDEKDDPKYYTSSQFFQRKRDYEREREADQKDRMQEQQEIEELKRQIMEE 420          
BLAST of RNA-binding protein 25 vs. Ensembl Celegans
Match: rbm-25 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:H2L2D0])

HSP 1 Score: 117.472 bits (293), Expect = 8.277e-27
Identity = 45/106 (42.45%), Postives = 78/106 (73.58%), Query Frame = 3
Query: 2142 MMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLV 2459
            + K+II  IP +K+ELF + IEWD +D  ++   ++PW+ KK+ +++GEE+ +   FICDQ+ +  TP +IL D++++++E+AE FV+KMWRLLIY  + +++G+ 
Sbjct:  602 LTKQIIKTIPATKDELFVHRIEWDQLDGKWMNDRIRPWVAKKVTQFLGEEDKSFCDFICDQIEKQATPQEILKDVAVIIDEDAEQFVIKMWRLLIYEGQARRLGIT 707          

HSP 2 Score: 89.3521 bits (220), Expect = 5.428e-18
Identity = 38/89 (42.70%), Postives = 60/89 (67.42%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLK 773
            ++SPV   F+ NIS+K  D  ++ IL++CG + +WKR++G++GKLQ FG C + + E TLR +R+L+   + DK L VK D K  + L+
Sbjct:   45 DSSPV---FVGNISDKCSDEFIRKILNECGNVASWKRIKGSNGKLQGFGFCHFTDLEGTLRALRILHEFHLGDKKLTVKPDEKVRDDLR 130          

HSP 3 Score: 81.2629 bits (199), Expect = 1.796e-15
Identity = 46/118 (38.98%), Postives = 74/118 (62.71%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKE 1673
            D  E   FK++   + DK+ +Y  RL+ WE RE++ +K Y  EE +EK +K  L +E K+L++F E+YDDE  D KYY +S+  +R    + E   D KDR +E ++IE  +R++++E
Sbjct:  306 DAREKRAFKQM---MLDKKQAYLARLKRWESRERQMSKRYEREERKEKDRKKTLQKEGKRLKLFLEDYDDEKDDPKYYTSSQFFQRKRDYEREREADQKDRMQEQQEIEELKRQIMEE 420          
BLAST of RNA-binding protein 25 vs. Ensembl Celegans
Match: rbm-25 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:H2L2D0])

HSP 1 Score: 117.472 bits (293), Expect = 8.277e-27
Identity = 45/106 (42.45%), Postives = 78/106 (73.58%), Query Frame = 3
Query: 2142 MMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLV 2459
            + K+II  IP +K+ELF + IEWD +D  ++   ++PW+ KK+ +++GEE+ +   FICDQ+ +  TP +IL D++++++E+AE FV+KMWRLLIY  + +++G+ 
Sbjct:  602 LTKQIIKTIPATKDELFVHRIEWDQLDGKWMNDRIRPWVAKKVTQFLGEEDKSFCDFICDQIEKQATPQEILKDVAVIIDEDAEQFVIKMWRLLIYEGQARRLGIT 707          

HSP 2 Score: 89.3521 bits (220), Expect = 5.428e-18
Identity = 38/89 (42.70%), Postives = 60/89 (67.42%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLK 773
            ++SPV   F+ NIS+K  D  ++ IL++CG + +WKR++G++GKLQ FG C + + E TLR +R+L+   + DK L VK D K  + L+
Sbjct:   45 DSSPV---FVGNISDKCSDEFIRKILNECGNVASWKRIKGSNGKLQGFGFCHFTDLEGTLRALRILHEFHLGDKKLTVKPDEKVRDDLR 130          

HSP 3 Score: 81.2629 bits (199), Expect = 1.796e-15
Identity = 46/118 (38.98%), Postives = 74/118 (62.71%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKE 1673
            D  E   FK++   + DK+ +Y  RL+ WE RE++ +K Y  EE +EK +K  L +E K+L++F E+YDDE  D KYY +S+  +R    + E   D KDR +E ++IE  +R++++E
Sbjct:  306 DAREKRAFKQM---MLDKKQAYLARLKRWESRERQMSKRYEREERKEKDRKKTLQKEGKRLKLFLEDYDDEKDDPKYYTSSQFFQRKRDYEREREADQKDRMQEQQEIEELKRQIMEE 420          
BLAST of RNA-binding protein 25 vs. Ensembl Fly
Match: CG4119 (gene:FBgn0028474 transcript:FBtr0340463)

HSP 1 Score: 140.584 bits (353), Expect = 1.043e-33
Identity = 64/105 (60.95%), Postives = 79/105 (75.24%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLV 2459
            +K IID IPT KEELF+Y ++ + ID   +E  ++PWINKKIIEYIGE EPTL  FIC +VL    P  ILDD+ MVL+EEAE+FV+KMWRLLIY ++ KK GL 
Sbjct:  892 IKSIIDRIPTQKEELFNYKLDRNEIDSGLMERKIRPWINKKIIEYIGEPEPTLVDFICSKVLAGSPPQSILDDVQMVLDEEAEVFVVKMWRLLIYELDAKKSGLA 996          

HSP 2 Score: 91.2781 bits (225), Expect = 2.074e-18
Identity = 54/182 (29.67%), Postives = 96/182 (52.75%), Query Frame = 3
Query:  483 PPAIYPAINNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKTIDEKYENLSEEEKQEKINQIDMKRNNEDKVCLSEVKKILEDIGLEY-------KLNEIGNSEANEETKKPEKILTK 1007
            PP   P     P++ +F+ NISE++P+  +K IL+ CG ++NWKRV         FG CE++ P A +R +RLL+ +++  K L+ KVD K   L+++Y  +  K  D             + N +D K   ED+  ++++ + LE+   E+       + +  G++  N++T++ E I  K
Sbjct:   49 PPEPQPQFRG-PIITVFVGNISERVPEALLKRILNACGVVINWKRV-------STFGFCEFDGPIAAMRAVRLLSEMEIDGKKLVAKVDAKNKVLIEDYKEQECKNGD-------------RSNPVDEK--TEDEFAIAQMHEFLEEHKHEFEGFDSSSRADLYGSANRNKKTRREEDIKMK 207          

HSP 3 Score: 64.3142 bits (155), Expect = 4.250e-10
Identity = 36/81 (44.44%), Postives = 51/81 (62.96%), Query Frame = 3
Query: 1380 SYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDR 1622
            +YQ RL  WE+REKR+AKE      +E  ++ +   +AK+L+ F E+YDDE  D+ YY   EL++R A R  E   D+KDR
Sbjct:  455 AYQTRLTDWEVREKRKAKENEKYRLKELLRQEERETDAKRLKEFVEDYDDERDDSLYYRGRELQQRLAERVREADADSKDR 535          
BLAST of RNA-binding protein 25 vs. Ensembl Fly
Match: CG4119 (gene:FBgn0028474 transcript:FBtr0070799)

HSP 1 Score: 140.584 bits (353), Expect = 1.043e-33
Identity = 64/105 (60.95%), Postives = 79/105 (75.24%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLV 2459
            +K IID IPT KEELF+Y ++ + ID   +E  ++PWINKKIIEYIGE EPTL  FIC +VL    P  ILDD+ MVL+EEAE+FV+KMWRLLIY ++ KK GL 
Sbjct:  892 IKSIIDRIPTQKEELFNYKLDRNEIDSGLMERKIRPWINKKIIEYIGEPEPTLVDFICSKVLAGSPPQSILDDVQMVLDEEAEVFVVKMWRLLIYELDAKKSGLA 996          

HSP 2 Score: 91.2781 bits (225), Expect = 2.074e-18
Identity = 54/182 (29.67%), Postives = 96/182 (52.75%), Query Frame = 3
Query:  483 PPAIYPAINNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKTIDEKYENLSEEEKQEKINQIDMKRNNEDKVCLSEVKKILEDIGLEY-------KLNEIGNSEANEETKKPEKILTK 1007
            PP   P     P++ +F+ NISE++P+  +K IL+ CG ++NWKRV         FG CE++ P A +R +RLL+ +++  K L+ KVD K   L+++Y  +  K  D             + N +D K   ED+  ++++ + LE+   E+       + +  G++  N++T++ E I  K
Sbjct:   49 PPEPQPQFRG-PIITVFVGNISERVPEALLKRILNACGVVINWKRV-------STFGFCEFDGPIAAMRAVRLLSEMEIDGKKLVAKVDAKNKVLIEDYKEQECKNGD-------------RSNPVDEK--TEDEFAIAQMHEFLEEHKHEFEGFDSSSRADLYGSANRNKKTRREEDIKMK 207          

HSP 3 Score: 64.3142 bits (155), Expect = 4.250e-10
Identity = 36/81 (44.44%), Postives = 51/81 (62.96%), Query Frame = 3
Query: 1380 SYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDR 1622
            +YQ RL  WE+REKR+AKE      +E  ++ +   +AK+L+ F E+YDDE  D+ YY   EL++R A R  E   D+KDR
Sbjct:  455 AYQTRLTDWEVREKRKAKENEKYRLKELLRQEERETDAKRLKEFVEDYDDERDDSLYYRGRELQQRLAERVREADADSKDR 535          
BLAST of RNA-binding protein 25 vs. Ensembl Zebrafish
Match: rbm25b (RNA binding motif protein 25b [Source:ZFIN;Acc:ZDB-GENE-030131-5547])

HSP 1 Score: 147.517 bits (371), Expect = 6.636e-36
Identity = 62/106 (58.49%), Postives = 84/106 (79.25%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            +K +I+ IPT+K ELF+Y ++W ++D   +E  ++PWINKKI+EYIGEEE TL  F+C +V+ H TP  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGL K
Sbjct:  725 IKSLIEKIPTAKPELFNYPLDWSVVDTALMEKRIRPWINKKIVEYIGEEEATLVDFVCSKVMAHSTPQGILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLGK 830          

HSP 2 Score: 118.627 bits (296), Expect = 7.709e-27
Identity = 55/98 (56.12%), Postives = 71/98 (72.45%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKT 800
            ++ P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L+V +K LLVKVD KT   L E+  K K T
Sbjct:   82 SSGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHELQVGEKKLLVKVDAKTKAQLDEWKAKKKST 179          

HSP 3 Score: 80.4925 bits (197), Expect = 5.889e-15
Identity = 56/123 (45.53%), Postives = 90/123 (73.17%), Query Frame = 3
Query: 1347 KLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQ 1715
            KLE+KLR+KEA+YQ+RL+ WELRE+++A++Y  E ERE+ ++ ++++E K+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL E +PD +  + +ME+
Sbjct:  389 KLERKLREKEAAYQERLKNWELRERKKARDYSKEIEREEERRREMAKEGKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEIELDERDRKREKEELEEIRQRLLAEGHPDPDAELRRMEE 511          
BLAST of RNA-binding protein 25 vs. Ensembl Zebrafish
Match: rbm25a (RNA binding motif protein 25a [Source:ZFIN;Acc:ZDB-GENE-090312-142])

HSP 1 Score: 115.546 bits (288), Expect = 2.098e-30
Identity = 51/73 (69.86%), Postives = 63/73 (86.30%), Query Frame = 3
Query: 2244 MKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            ++PWINKKIIEYIGEEE TL  F+C +V+ H TP+ ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGLVK
Sbjct:    8 IRPWINKKIIEYIGEEEATLVDFVCSKVMAHSTPEGILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK 80          
BLAST of RNA-binding protein 25 vs. Ensembl Zebrafish
Match: rbm25a (RNA binding motif protein 25a [Source:ZFIN;Acc:ZDB-GENE-090312-142])

HSP 1 Score: 122.479 bits (306), Expect = 3.290e-29
Identity = 56/106 (52.83%), Postives = 77/106 (72.64%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            +K +I+ IPT K+ELF+Y ++W+M+D   ++  ++PWINKKIIEYIGEEE TL  F+C +V    +        + VL+EEAE+F++KMWRLLIY  E KKIGLVK
Sbjct:  320 IKSLIEKIPTVKQELFNYPLDWNMVDTTLMDRRIRPWINKKIIEYIGEEEATLVDFVCSKVCVCAS--------ASVLDEEAEVFIVKMWRLLIYETEAKKIGLVK 417          

HSP 2 Score: 90.1225 bits (222), Expect = 1.586e-18
Identity = 54/133 (40.60%), Postives = 93/133 (69.92%), Query Frame = 3
Query: 1347 KLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQSMQEHLKKRL 1745
            KLE+KLR+KE +YQ+RL+ WE+RE++++++Y  E ERE  ++ ++++EAK+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E +++E  R+RLL E +PD +  + ++E+  ++  K  L
Sbjct:   36 KLERKLREKEVAYQERLKNWEIRERKKSRDYSKETEREDERQREMTKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMELDERDRKREKDELEEIRQRLLAEGHPDPDAELQRIEEEAEKRQKAPL 168          
BLAST of RNA-binding protein 25 vs. Ensembl Zebrafish
Match: rbm25b (RNA binding motif protein 25b [Source:ZFIN;Acc:ZDB-GENE-030131-5547])

HSP 1 Score: 119.398 bits (298), Expect = 3.737e-27
Identity = 55/98 (56.12%), Postives = 71/98 (72.45%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKT 800
            ++ P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L+V +K LLVKVD KT   L E+  K K T
Sbjct:   82 SSGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHELQVGEKKLLVKVDAKTKAQLDEWKAKKKST 179          

HSP 2 Score: 80.8777 bits (198), Expect = 3.766e-15
Identity = 56/123 (45.53%), Postives = 90/123 (73.17%), Query Frame = 3
Query: 1347 KLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQ 1715
            KLE+KLR+KEA+YQ+RL+ WELRE+++A++Y  E ERE+ ++ ++++E K+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL E +PD +  + +ME+
Sbjct:  389 KLERKLREKEAAYQERLKNWELRERKKARDYSKEIEREEERRREMAKEGKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEIELDERDRKREKEELEEIRQRLLAEGHPDPDAELRRMEE 511          
BLAST of RNA-binding protein 25 vs. Ensembl Zebrafish
Match: rbm25a (RNA binding motif protein 25a [Source:ZFIN;Acc:ZDB-GENE-090312-142])

HSP 1 Score: 109.768 bits (273), Expect = 3.872e-27
Identity = 50/84 (59.52%), Postives = 65/84 (77.38%), Query Frame = 3
Query:  528 LFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEY 779
            +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ DK LLVKVD KT   L+ +
Sbjct:   87 VFVGNISEKASDMLVRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHELQLGDKKLLVKVDAKTKAQLETW 170          
BLAST of RNA-binding protein 25 vs. Ensembl Xenopus
Match: rbm25 (RNA binding motif protein 25 [Source:NCBI gene;Acc:407928])

HSP 1 Score: 149.058 bits (375), Expect = 8.768e-37
Identity = 63/106 (59.43%), Postives = 85/106 (80.19%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            +K +I+ IPT+K ELF+Y ++W ++D   +E  ++PWINKKIIEYIGEEE TL  F+C +V+ H +P  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGLVK
Sbjct:  532 IKSLIEKIPTAKPELFAYPLDWSIVDTTLMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK 637          

HSP 2 Score: 116.701 bits (291), Expect = 2.396e-26
Identity = 52/91 (57.14%), Postives = 68/91 (74.73%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEY 779
            N+ P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+
Sbjct:   48 NSGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEW 138          
BLAST of RNA-binding protein 25 vs. Ensembl Xenopus
Match: rbm25 (RNA binding motif protein 25 [Source:NCBI gene;Acc:407928])

HSP 1 Score: 149.828 bits (377), Expect = 1.152e-36
Identity = 63/106 (59.43%), Postives = 85/106 (80.19%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            +K +I+ IPT+K ELF+Y ++W ++D   +E  ++PWINKKIIEYIGEEE TL  F+C +V+ H +P  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGLVK
Sbjct:  664 IKSLIEKIPTAKPELFAYPLDWSIVDTTLMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK 769          

HSP 2 Score: 118.242 bits (295), Expect = 1.224e-26
Identity = 52/91 (57.14%), Postives = 68/91 (74.73%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEY 779
            N+ P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+
Sbjct:   39 NSGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEW 129          

HSP 3 Score: 78.5666 bits (192), Expect = 3.112e-14
Identity = 54/113 (47.79%), Postives = 84/113 (74.34%), Query Frame = 3
Query: 1347 KLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPD 1685
            KLE+KLR+KEA+YQ+RL+ WE+RE+++A+EY  + ERE+ ++ + ++EAK+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL E +PD
Sbjct:  371 KLERKLREKEAAYQERLKNWEIRERKKAREYEKDAEREEERRRETAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHPD 483          
BLAST of RNA-binding protein 25 vs. Ensembl Xenopus
Match: rbm25 (RNA binding motif protein 25 [Source:NCBI gene;Acc:407928])

HSP 1 Score: 149.058 bits (375), Expect = 1.182e-36
Identity = 63/106 (59.43%), Postives = 85/106 (80.19%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            +K +I+ IPT+K ELF+Y ++W ++D   +E  ++PWINKKIIEYIGEEE TL  F+C +V+ H +P  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGLVK
Sbjct:  571 IKSLIEKIPTAKPELFAYPLDWSIVDTTLMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK 676          

HSP 2 Score: 116.701 bits (291), Expect = 2.868e-26
Identity = 52/91 (57.14%), Postives = 68/91 (74.73%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEY 779
            N+ P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+
Sbjct:   80 NSGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEW 170          
BLAST of RNA-binding protein 25 vs. Ensembl Mouse
Match: Rbm25 (RNA binding motif protein 25 [Source:MGI Symbol;Acc:MGI:1914289])

HSP 1 Score: 149.058 bits (375), Expect = 2.216e-36
Identity = 70/131 (53.44%), Postives = 96/131 (73.28%), Query Frame = 3
Query: 2070 ENESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            E++ N  +G  N   T EK   +  +K +I+ IPT+K ELF+Y ++W ++D   +E  ++PWINKKIIEYIGEEE TL  F+C +V+ H +P  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGLVK
Sbjct:  714 EDDKNATKGTVN---TEEK---RKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK 838          

HSP 2 Score: 117.857 bits (294), Expect = 1.483e-26
Identity = 55/112 (49.11%), Postives = 78/112 (69.64%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKTIDEKYENLSEEEKQ 842
            N  P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+  K K   + + E ++ ++++
Sbjct:   82 NCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKANGNARPETVTNDDEE 193          

HSP 3 Score: 73.9442 bits (180), Expect = 5.733e-13
Identity = 60/132 (45.45%), Postives = 94/132 (71.21%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQ 1715
            D YE    +KLE+KLR+KEA+YQ+RL+ WE+RE+++ +EY  E ERE+ ++ ++++EAK+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL E +PD +  + +MEQ
Sbjct:  434 DAYER---RKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHPDPDAELQRMEQ 562          
BLAST of RNA-binding protein 25 vs. Ensembl Mouse
Match: Rbm25 (RNA binding motif protein 25 [Source:MGI Symbol;Acc:MGI:1914289])

HSP 1 Score: 114.39 bits (285), Expect = 1.433e-28
Identity = 55/112 (49.11%), Postives = 78/112 (69.64%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKTIDEKYENLSEEEKQ 842
            N  P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+  K K   + + E ++ ++++
Sbjct:   82 NCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKANGNARPETVTNDDEE 193          
BLAST of RNA-binding protein 25 vs. Ensembl Mouse
Match: Rbm25 (RNA binding motif protein 25 [Source:MGI Symbol;Acc:MGI:1914289])

HSP 1 Score: 119.013 bits (297), Expect = 2.635e-27
Identity = 55/107 (51.40%), Postives = 74/107 (69.16%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKTIDEKYENLS 827
            N  P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+  K K   + + E ++
Sbjct:   82 NCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKANGNARPETVT 188          

HSP 2 Score: 72.7886 bits (177), Expect = 1.212e-12
Identity = 60/132 (45.45%), Postives = 94/132 (71.21%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQ 1715
            D YE    +KLE+KLR+KEA+YQ+RL+ WE+RE+++ +EY  E ERE+ ++ ++++EAK+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL E +PD +  + +MEQ
Sbjct:  434 DAYER---RKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHPDPDAELQRMEQ 562          
BLAST of RNA-binding protein 25 vs. Ensembl Mouse
Match: Rbm25 (RNA binding motif protein 25 [Source:MGI Symbol;Acc:MGI:1914289])

HSP 1 Score: 97.8265 bits (242), Expect = 5.993e-23
Identity = 42/74 (56.76%), Postives = 56/74 (75.68%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADK 728
            N  P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K
Sbjct:  101 NCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEK 174          
BLAST of RNA-binding protein 25 vs. UniProt/SwissProt
Match: sp|P49756|RBM25_HUMAN (RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3)

HSP 1 Score: 149.058 bits (375), Expect = 1.454e-35
Identity = 70/131 (53.44%), Postives = 96/131 (73.28%), Query Frame = 3
Query: 2070 ENESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            E++ N  +G  N   T EK   +  +K +I+ IPT+K ELF+Y ++W ++D   +E  ++PWINKKIIEYIGEEE TL  F+C +V+ H +P  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGLVK
Sbjct:  719 EDDKNATKGTVN---TEEK---RKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK 843          

HSP 2 Score: 117.087 bits (292), Expect = 1.641e-25
Identity = 54/98 (55.10%), Postives = 70/98 (71.43%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKT 800
            N  P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+  K K +
Sbjct:   82 NCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKAS 179          

HSP 3 Score: 73.9442 bits (180), Expect = 4.346e-12
Identity = 60/132 (45.45%), Postives = 94/132 (71.21%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQ 1715
            D YE    +KLE+KLR+KEA+YQ+RL+ WE+RE+++ +EY  E ERE+ ++ ++++EAK+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL E +PD +  + +MEQ
Sbjct:  439 DAYER---RKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHPDPDAELQRMEQ 567          
BLAST of RNA-binding protein 25 vs. UniProt/SwissProt
Match: sp|B2RY56|RBM25_MOUSE (RNA-binding protein 25 OS=Mus musculus OX=10090 GN=Rbm25 PE=1 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 1.550e-35
Identity = 70/131 (53.44%), Postives = 96/131 (73.28%), Query Frame = 3
Query: 2070 ENESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            E++ N  +G  N   T EK   +  +K +I+ IPT+K ELF+Y ++W ++D   +E  ++PWINKKIIEYIGEEE TL  F+C +V+ H +P  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGLVK
Sbjct:  714 EDDKNATKGTVN---TEEK---RKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK 838          

HSP 2 Score: 117.857 bits (294), Expect = 1.037e-25
Identity = 55/112 (49.11%), Postives = 78/112 (69.64%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKTIDEKYENLSEEEKQ 842
            N  P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ +K LLVKVD KT   L E+  K K   + + E ++ ++++
Sbjct:   82 NCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKANGNARPETVTNDDEE 193          

HSP 3 Score: 73.9442 bits (180), Expect = 4.010e-12
Identity = 60/132 (45.45%), Postives = 94/132 (71.21%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQ 1715
            D YE    +KLE+KLR+KEA+YQ+RL+ WE+RE+++ +EY  E ERE+ ++ ++++EAK+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL E +PD +  + +MEQ
Sbjct:  434 DAYER---RKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHPDPDAELQRMEQ 562          
BLAST of RNA-binding protein 25 vs. UniProt/SwissProt
Match: sp|Q8WZK0|US107_SCHPO (U1 snRNP-associated protein usp107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=usp107 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.763e-12
Identity = 35/114 (30.70%), Postives = 65/114 (57.02%), Query Frame = 3
Query: 2082 NPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLL 2423
            +PN     P       ++   ++ +I+ IP   E L++  I+W  + E+ ++  M+ ++ KKIIEYIG +E +L  F  D + +HK  +Q++ ++ + L E+A  FV K++R L
Sbjct:  572 SPNPQKPKPAMEENDAEKTKRLRSLIEKIPVEAESLWALPIDWSKVTEDLLKEEMQAFVTKKIIEYIGIQEDSLITFTIDHIRQHKGAEQLVSELDLALAEDAPEFVSKVYRYL 685          
BLAST of RNA-binding protein 25 vs. TrEMBL
Match: A0A183K8W0 (PWI domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS11441 PE=4 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 2.931e-73
Identity = 161/403 (39.95%), Postives = 228/403 (56.58%), Query Frame = 3
Query: 1362 LRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQSMQEHLKKRLTDNS--------------VDATLASVKTEKENV--------------PNEMIKSEKRETIP-------LEDNISTHDLLNNNIXXXXXXXXXXXXXXXSDQKP---GEIQQNSKCQVDNNPADPETSNHGNHEQXXXXXXXXXXXXENESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGL 2456
            LR+KE SYQKRL+ WE+RE+++A EY  E + E+ ++ +L  EA++L+ FFE+YDD + D KYY  S L +R   R+ EE+ D +DR KEIEQ+E  RR+L++E +P+ E +I +MEQ MQEHL++ L  N               V   L S + E +N+                  + SE     P       L+D  +T     + +            +   D+KP   G           N+ ++P  SN G+  Q             N+SN    N  P+S     ++K ++K+II+ IPT K ELF+Y I+WDM+D +FV   +KPW++KKI+ YIGE E TLS FICDQ+L H  P++IL DI+MVL+EEAE+FV+KMWRLLIYVI EKK GL
Sbjct:  243 LREKEESYQKRLKQWEIRERKKANEYEHERDHERKRQRELQIEAQRLKEFFEDYDDNVEDPKYYRGSALHQRLKDREIEEAADERDRQKEIEQLETARRKLIEEGDPNAESIIFQMEQKMQEHLRRCLLVNGDMSIESSDNQCPEPVSENLPSAEDESKNLECVVKSLETNNLSPACNGVTSEFEPAAPEETSVSLLKDGSNTFLFSMSAVEPVVRKTASAFADEEQDEKPKKHGLSWLPPSALKANSISNP--SNGGDSNQ-------------NDSN----NLPPVSALSTEEKKAIIKRIIEGIPTHKRELFAYPIDWDMVDADFVNSRIKPWVDKKIVSYIGEAEATLSSFICDQLLHHNPPERILADIAMVLDEEAEVFVVKMWRLLIYVIAEKKAGL 626          
BLAST of RNA-binding protein 25 vs. TrEMBL
Match: A0A183MHA8 (PWI domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS15433 PE=4 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 1.250e-67
Identity = 161/430 (37.44%), Postives = 228/430 (53.02%), Query Frame = 3
Query: 1362 LRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQSMQEHLKKRLTDNS--------------VDATLASVKTEKENV--------------PNEMIKSEKRETIP-------LEDNISTHDLLNNNIXXXXXXXXXXXXXXXSDQKP---GEIQQNSKCQVDNNPADPETSNHGNHEQXXXXXXXXXXXXENESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISM---------------------------VLEEEAEIFVMKMWRLLIYVIEEKKIGL 2456
            LR+KE SYQKRL+ WE+RE+++A EY  E + E+ ++ +L  EA++L+ FFE+YDD + D KYY  S L +R   R+ EE+ D +DR KEIEQ+E  RR+L++E +P+ E +I +MEQ MQEHL++ L  N               V   L S + E +N+                  + SE     P       L+D  +T     + +            +   D+KP   G           N+ ++P  SN G+  Q             N+SN    N  P+S     ++K ++K+II+ IPT K ELF+Y I+WDM+D +FV   +KPW++KKI+ YIGE E TLS FICDQ+L H  P++IL DI+M                           VL+EEAE+FV+KMWRLLIYVI EKK GL
Sbjct:  243 LREKEESYQKRLKQWEIRERKKASEYEHERDHERKRQRELQIEAQRLKEFFEDYDDNVEDPKYYRGSALHQRLKDREIEEAADERDRQKEIEQLETARRKLIEEGDPNAESIIFQMEQKMQEHLRRCLLVNGDMSIESSDNQCPEPVSENLPSAEDESKNLECVVKSLETNNLSPACNGVTSEFEPAAPEETSVSLLKDGSNTFLFSMSAVEPVVRKTASAFADEEQDEKPKKHGLSWLPPSALKANSISNP--SNGGDSNQ-------------NDSN----NLPPVSALSTEEKKAIIKRIIEGIPTHKRELFAYPIDWDMVDADFVNSRIKPWVDKKIVSYIGEAEATLSSFICDQLLHHNPPERILADIAMVSITQKLVIISKTFNVACRTFISEVFIVLDEEAEVFVVKMWRLLIYVIAEKKAGL 653          
BLAST of RNA-binding protein 25 vs. TrEMBL
Match: A0A183P682 (PWI domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS9868 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 8.645e-54
Identity = 125/337 (37.09%), Postives = 197/337 (58.46%), Query Frame = 3
Query: 1371 KEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQSMQEHLKKRLTDNSVDATLASVKTEKENVPNEMIKSEKRETIPLEDNISTHDLLNNNIXXXXXXXXXXXXXXXSDQKPGEIQQNSKCQVDNNPADPETSNHGNHEQXXXXXXXXXXXXENESNPNEGNTN---PLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISM 2372
            + +S  +RL+ WE+RE+++A EY  E + E+ ++ +L  EA++L+ FFE+YDD + D KYY  S L +R   R+ EE+ D +DR KEIEQ+E  RR+L++E +P+ E +I +MEQ MQEHL++ L  N  D ++ S   +     +E + S + E+  LE  + +  L  NN+               S+ +P   ++ S   + +       SN            +    P N  + N+ ++N   P+S     ++K ++K+II+ IPT K ELF+Y I+WDM+D +FV   +KPW++KKI+ YIGE E TLS FICDQ+L H  P++IL DI+M
Sbjct:   28 QGSSVGRRLKQWEIRERKKANEYEHERDHERKRQRELQIEAQRLKEFFEDYDDSVEDPKYYRGSALHQRLKDREIEEAADERDRQKEIEQLETARRKLIEEGDPNAESIIFQMEQKMQEHLRRCLLVNG-DMSIESSDNQCPEPVSENLPSAEDESKNLECVVKS--LETNNL-------SPACNGVTSEFEPAAPEETSVSLLKDG------SNTFLFSMSAALKANSISNPSNGGDSNQNDSNNLPPVSALSTEEKKAIIKRIIEGIPTHKRELFAYPIDWDMVDADFVNSRIKPWVDKKIVSYIGEAEATLSSFICDQLLHHNPPERILADIAM 348          
BLAST of RNA-binding protein 25 vs. TrEMBL
Match: A0A087TX14 (RNA-binding protein 25 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_10774 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 1.294e-52
Identity = 146/397 (36.78%), Postives = 221/397 (55.67%), Query Frame = 3
Query: 1344 KKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVI--LKMEQSMQEHLKKRLTDNSVDATLASVK-TEKENVPNEMIKSEKRETIPLEDN----ISTHDLLNNNIXXXXXXXXXXXXXXXSDQKPGEIQQ----NSKCQVDNNPADPETSNHGNHEQXXXXXXXXXXXXENESNPNEGNTNPLS--------TPEKV------DRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLV 2459
            KK E+K+R+KEA YQ RL+ W  RE+R+AKEY  E+ + + +K D ++EA++L+ F E+YDDE  D KY+  S L RR   R+ E   D  DR +E E+++  R++L++E +PD E  +  L +E+S       RL +     T  S +  E +  P +M    K    P+E+     IS   +L ++I          V     + K           S  Q +++P+   T+NH + ++ +   D      E   +  +    PL         TP  V      +++  +K +I+ IPT K ELF+Y ++W ++D   +E  ++PWINKKI+EYIGEEEPTL +FIC +++       ILDD+SMVL+EEAE+FV+KMWRLLIY IE KK+GLV
Sbjct:  413 KKQERKIREKEALYQDRLRNWVARERRKAKEYEKEKIKAEEQKKDEAKEARRLKEFLEDYDDEKDDPKYFKGSALVRRMKEREKEIEEDMLDRQREKEELDELRKKLVEEGHPDPEAEVERLLLEES-------RLMEPPKPETPESDQEPEIQPSPVKMRPISKAAMSPVEEKEDRVISKRPVLEDDISQSSFSGFSDVITQQEEVKLMGFTSLRLGASPTQHNSSPSVLATNNHTSSKRKVTVDDVFNVNDEETESRKKRKLIPLDDTQDDGPKTPNSVSQMTNEEKRKHIKNLIEKIPTEKSELFAYNLDWKVVDSVLMEKRIRPWINKKIVEYIGEEEPTLVEFICSKIMAGSAAQSILDDVSMVLDEEAEVFVVKMWRLLIYEIEAKKLGLV 802          

HSP 2 Score: 119.398 bits (298), Expect = 9.429e-24
Identity = 50/94 (53.19%), Postives = 69/94 (73.40%), Query Frame = 3
Query:  498 PAINNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEY 779
            P +   P V +F+ NI+++ PD  ++ IL +CG +LNWKRVQGA+GKLQAFG CEY +PE+ LR +RLL+  ++ +K L+VKVD KT E L EY
Sbjct:   52 PELPKGPPVTVFVGNITDRAPDTLVRQILQRCGIVLNWKRVQGANGKLQAFGFCEYGDPESALRAMRLLHDYELGEKKLVVKVDAKTKEKLDEY 145          
BLAST of RNA-binding protein 25 vs. TrEMBL
Match: V4A5M0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_217154 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 5.316e-52
Identity = 142/398 (35.68%), Postives = 216/398 (54.27%), Query Frame = 3
Query: 1377 ASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQSMQEHLKKRL--------------------TDNSV---------DATLASVKTEKENVPNEMIKSEKRETIPLEDNISTHDLLNNNIXXXXXXXXXXXXXXXSDQKPGEIQQNSKCQVDNNPADPETSNHGNHEQXXXXXXXXXXXXENESNPNEGNTNPLST-----PEKV--DRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            A+Y++RL  WE RE+++A+E   E ERE+ +K D   EA++L+ F E+YDD   D K++  S L RR   R+ E+  DA+DR +E E+ E  +RRL+ E +PD E  + ++E+  +EHLK RL                    +D  V         DA  AS        P+ +   E      L+++I + D       +         K   S  K G    N+     N+PA+    +  + ++  L   D     E+ S   +    PL       P  V  +++  +K +ID+IPT+KEELF++ ++W ++D+  ++  +KPWINKKI+EYIGEEEPTL+ FIC +V+   TP  I +D++MVL+EEAE+FV+KMWRLL+Y  E KK+GLVK
Sbjct:  403 AAYKERLTNWEGRERKKARENDKEREREEERKTDEIREARRLKEFLEDYDDLRDDPKFFKGSALSRRMKEREKEKEADARDRQREKEEFEEIKRRLMDEGHPDPEAELARIEKEREEHLKPRLQIEEVVISPASSPERKDSSDSDKGVMKKTMKPIPDAIPASTSNPVNLAPSPLSDDEDNTMYSLDNDIVSEDSQQPTYSNNKQEKSESSKHSFSGMKLGSGTSNT-----NSPAE---VSAPSSKRKKLTVGDVFNQDEDSSESKKRKLVPLDYDEEKKPGNVAEEKRNKIKILIDSIPTAKEELFAFSLDWTIVDQALMDKRIKPWINKKIVEYIGEEEPTLTDFICQKVIARSTPASIQNDVAMVLDEEAEVFVVKMWRLLVYETEAKKLGLVK 792          

HSP 2 Score: 132.494 bits (332), Expect = 7.222e-28
Identity = 67/142 (47.18%), Postives = 85/142 (59.86%), Query Frame = 3
Query:  441 FAPNPVVPIYTNV----PPPAIYPAINN--------------------SPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVK 794
            +AP  +VP+   +     P  I P +N+                     PV  +F+ NIS+K PD  +K +L +CG +L+WKRVQGASGKLQAFG CEYE+PEATLRCIRLLN   + DK L+VKVD KT  LL +Y  K K
Sbjct:   20 YAPMGMVPMGMRMMAAPSPTMIRPVVNSQKQPKKLVPQEIPKDSKDEKPPVTTVFVGNISDKAPDVMIKQMLQRCGNVLSWKRVQGASGKLQAFGFCEYEDPEATLRCIRLLNDWYIPDKKLVVKVDAKTKTLLDDYRSKKK 161          
BLAST of RNA-binding protein 25 vs. Ensembl Cavefish
Match: rbm25b (RNA binding motif protein 25b [Source:ZFIN;Acc:ZDB-GENE-030131-5547])

HSP 1 Score: 147.517 bits (371), Expect = 4.727e-36
Identity = 62/106 (58.49%), Postives = 84/106 (79.25%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            +K +I+ IPT+K ELF+Y ++W ++D   +E  ++PWINKKI+EYIGEEE TL  F+C +V+ H TP  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGL K
Sbjct:  710 IKSLIEKIPTAKPELFNYPLDWSVVDTTLMEKRIRPWINKKIVEYIGEEEATLVDFVCSKVMAHSTPQGILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLGK 815          

HSP 2 Score: 110.153 bits (274), Expect = 2.427e-24
Identity = 66/154 (42.86%), Postives = 86/154 (55.84%), Query Frame = 3
Query:  375 FAKICLNFYDNFCILLH*FEDMFAPNPVVPIYTNVP-------PPAIYPAI-------NNSPVVALFISNISEKIPDPEMKTILD--KCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMK 788
            FA    +      I +H    +  P P V + T+VP       P    PA        N+ P   +F+ NISEK  D  ++ +L   KCG +L+WKRVQGASGKLQ FG CEY+ PE+TLR +RLL+ L+V +K LLVKVD KT   L E+  K
Sbjct:   26 FAGFPPSMPPTPMIPVH--MGIMTPTPTVLVPTSVPVVSKVAAPRKEAPASRAKENDENSGPTTTVFVGNISEKASDMLIRQLLSSQKCGLVLSWKRVQGASGKLQ-FGFCEYKEPESTLRALRLLHELQVGEKKLLVKVDAKTKAQLDEWKAK 176          

HSP 3 Score: 75.485 bits (184), Expect = 1.443e-13
Identity = 56/123 (45.53%), Postives = 88/123 (71.54%), Query Frame = 3
Query: 1347 KLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQ 1715
            KLE+KLR+KEA+YQ+RL+ WELRE+++A++Y  E ERE  ++ + ++E K+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL E +PD +  + +ME+
Sbjct:  390 KLERKLREKEAAYQERLKNWELRERKKARDYAKEAEREDERRRETAKEGKRLKEFLEDYDDDRDDPKYY-GSALQKRLRDREKEIELDERDRKREKEELEEIRQRLLAEGHPDPDAELRRMEE 511          
BLAST of RNA-binding protein 25 vs. Ensembl Cavefish
Match: rbm25b (RNA binding motif protein 25b [Source:ZFIN;Acc:ZDB-GENE-030131-5547])

HSP 1 Score: 146.362 bits (368), Expect = 9.851e-36
Identity = 62/106 (58.49%), Postives = 84/106 (79.25%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            +K +I+ IPT+K ELF+Y ++W ++D   +E  ++PWINKKI+EYIGEEE TL  F+C +V+ H TP  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGL K
Sbjct:  703 IKSLIEKIPTAKPELFNYPLDWSVVDTTLMEKRIRPWINKKIVEYIGEEEATLVDFVCSKVMAHSTPQGILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLGK 808          

HSP 2 Score: 119.398 bits (298), Expect = 3.721e-27
Identity = 62/128 (48.44%), Postives = 80/128 (62.50%), Query Frame = 3
Query:  438 MFAPNPVVPIYTNVP-------PPAIYPAI-------NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEY 779
            +  P P V + T+VP       P    PA        N+ P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L+V +K LLVKVD KT   L E+
Sbjct:   46 IMTPTPTVLVPTSVPVVSKVAAPRKEAPASRAKENDENSGPTTTVFVGNISEKASDMLIRQLLSKCGLVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHELQVGEKKLLVKVDAKTKAQLDEW 173          

HSP 3 Score: 60.4622 bits (145), Expect = 6.533e-9
Identity = 46/111 (41.44%), Postives = 75/111 (67.57%), Query Frame = 3
Query: 1383 YQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQ 1715
            Y +RL+ WELRE+++A++Y  E ERE  ++ + ++E K+L+ F E+YDD+  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL E +PD +  + +ME+
Sbjct:  390 YLQRLKNWELRERKKARDYAKEAEREDERRRETAKEGKRLKEFLEDYDDDRDDPKYYKGSALQKRLRDREKEIELDERDRKREKEELEEIRQRLLAEGHPDPDAELRRMEE 500          
BLAST of RNA-binding protein 25 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004295.1 (pep scaffold:Pmarinus_7.0:GL477124:56243:73234:1 gene:ENSPMAG00000003899.1 transcript:ENSPMAT00000004295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.992 bits (393), Expect = 1.986e-39
Identity = 67/106 (63.21%), Postives = 85/106 (80.19%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            +K +I+ IPT+K ELF+Y ++W M+D   +E  +KPWINKKIIEYIGEEEPTL +FIC ++L H  P  ILDD+SMVL++EAE+FV+KMWRLLIY  E KK GLVK
Sbjct:  743 IKSLIEKIPTAKPELFAYTLDWTMVDSTLMERRVKPWINKKIIEYIGEEEPTLVEFICTKILAHSAPQSILDDVSMVLDDEAEVFVVKMWRLLIYETEAKKFGLVK 848          

HSP 2 Score: 109.768 bits (273), Expect = 7.638e-25
Identity = 48/93 (51.61%), Postives = 64/93 (68.82%), Query Frame = 3
Query:  510 NSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMK 788
            N P   +F+ NI++K  D  ++ +L KCG ++ WKRVQGASGK QAFG CEY  P ++LR IRLL+  ++ DK LLVKVD KT   L+E+  K
Sbjct:   87 NGPTTTVFVGNITDKASDVLIRQMLAKCGTVVTWKRVQGASGKQQAFGFCEYSEPASSLRAIRLLHDFQLGDKKLLVKVDAKTKAQLEEWKAK 179          
BLAST of RNA-binding protein 25 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009751.1 (pep scaffold:Pmarinus_7.0:GL485909:19:7776:-1 gene:ENSPMAG00000008808.1 transcript:ENSPMAT00000009751.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 3.353e-21
Identity = 40/69 (57.97%), Postives = 52/69 (75.36%), Query Frame = 3
Query:  573 KTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEY 779
            + ++ KCG +LNWKRVQG SGKLQAFG CEY  P ++LR +RLL+ L++ D+ LLVKVD KT  LL  +
Sbjct:    1 RRLVQKCGTVLNWKRVQGPSGKLQAFGFCEYREPGSSLRALRLLHDLELGDRHLLVKVDAKTKALLDAW 69          

HSP 2 Score: 92.4337 bits (228), Expect = 4.459e-20
Identity = 56/135 (41.48%), Postives = 94/135 (69.63%), Query Frame = 3
Query: 1305 AEKELDEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKM 1709
            + +E DE +  V K+LEK+L +KEASYQ+RL+ W  REK++ K Y  + ++E+ ++ D+++EAK+L++FFEEYDD+  D KY+M + L +R   R+ E  +D +DR +E E+++  R R ++E  PD +  IL++
Sbjct:  287 SHEEEDEEDFYVRKRLEKRLWEKEASYQERLKNWVAREKKRCKLYEKDAKKERNRRRDMTKEAKRLRVFFEEYDDDRDDPKYFMGNALAKRLWEREKELESDERDRWREREELQELRLRFIREGRPDPDGDILRV 421          
BLAST of RNA-binding protein 25 vs. Ensembl Nematostella
Match: EDO32076 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW43])

HSP 1 Score: 115.931 bits (289), Expect = 3.918e-31
Identity = 54/77 (70.13%), Postives = 65/77 (84.42%), Query Frame = 3
Query: 2232 VEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            +E  ++PWINKKI+EYIGEEEPTL++FIC +VL    P  ILDD+SMVL+EEAE+FV+KMWRLLIY  E KKIGLVK
Sbjct:    1 MERRIRPWINKKIVEYIGEEEPTLTEFICSKVLSGSPPKSILDDVSMVLDEEAEVFVVKMWRLLIYETEAKKIGLVK 77          
BLAST of RNA-binding protein 25 vs. Ensembl Nematostella
Match: EDO25939 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDB3])

HSP 1 Score: 83.5741 bits (205), Expect = 9.559e-19
Identity = 35/54 (64.81%), Postives = 46/54 (85.19%), Query Frame = 3
Query:  588 KCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVD 749
            KCG +++WKRVQGA+GKLQAFG CEY +PEA+LR IRLL+ L+V DKSL++ + 
Sbjct:    1 KCGIVVSWKRVQGANGKLQAFGFCEYSDPEASLRAIRLLHNLQVGDKSLVLSIS 54          
BLAST of RNA-binding protein 25 vs. Ensembl Medaka
Match: rbm25a (RNA binding motif protein 25a [Source:ZFIN;Acc:ZDB-GENE-090312-142])

HSP 1 Score: 153.68 bits (387), Expect = 1.956e-40
Identity = 65/106 (61.32%), Postives = 86/106 (81.13%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            +K +I+ IPT++ ELFSY ++W M+D   ++  ++PWINKKIIEYIGEEEPTL  F+C +V+ H TP  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGLVK
Sbjct:  252 IKSLIEKIPTARPELFSYPLDWAMVDSILMDRRIRPWINKKIIEYIGEEEPTLVDFVCSKVMAHSTPQGILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK 357          

HSP 2 Score: 51.6026 bits (122), Expect = 2.211e-6
Identity = 31/69 (44.93%), Postives = 45/69 (65.22%), Query Frame = 3
Query: 1479 LSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPD 1685
            + +EAK+L+ F E+YDDE  D KYY  S  ++R   R+ E   D +DR +E E++E  R+RLL E +PD
Sbjct:    1 MMKEAKRLKEFLEDYDDERDDLKYYRGSAFQKRLRDREKEIEMDERDRKREKEELEEIRQRLLAEGHPD 69          
BLAST of RNA-binding protein 25 vs. Ensembl Medaka
Match: rbm25b (RNA-binding protein 25-like [Source:NCBI gene;Acc:101165683])

HSP 1 Score: 149.828 bits (377), Expect = 7.468e-37
Identity = 63/108 (58.33%), Postives = 84/108 (77.78%), Query Frame = 3
Query: 2145 MKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVKCN 2468
            +K +I+ IPT+K ELF+Y ++W M+D   +E  ++PWINKKIIEYIGEEE TL  F+C +V+ H TP  ILDD++MVL+EEAE+F++KMWRLLIY  E KKIGL   +
Sbjct:  704 IKSLIEKIPTAKPELFTYPLDWSMVDTTLMERRVRPWINKKIIEYIGEEEATLVDFVCSKVMAHSTPQGILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLTTSS 811          

HSP 2 Score: 120.939 bits (302), Expect = 1.227e-27
Identity = 55/96 (57.29%), Postives = 71/96 (73.96%), Query Frame = 3
Query:  507 NNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVK 794
            N+ P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQAFG CEY+ PE+TLR +RLL+ L++ DK+LLVKVD KT   L E+  K K
Sbjct:   72 NSGPTTTVFVGNISEKASDMLIRQLLAKCGIVLSWKRVQGASGKLQAFGFCEYKEPESTLRALRLLHDLQIGDKNLLVKVDAKTKAQLDEWKAKKK 167          

HSP 3 Score: 94.3597 bits (233), Expect = 2.175e-19
Identity = 59/122 (48.36%), Postives = 87/122 (71.31%), Query Frame = 3
Query: 1320 DEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPD 1685
            DE EA   +KLE+KLRDKEA+YQ+RL+ WELRE+++A++Y  + ERE  ++ +  +E K+L+ F E+YDDE  D KYY  S L++R   R+ E   D +DR +E E++E  R+RLL+E +PD
Sbjct:  366 DEEEAYERRKLERKLRDKEAAYQERLKNWELRERKKARDYAKDTEREDERRRETLKEGKRLKEFLEDYDDERDDPKYYRGSALQKRLRDREKEIEVDERDRKREKEELEEIRQRLLEEGHPD 487          
BLAST of RNA-binding protein 25 vs. Ensembl Medaka
Match: ENSORLT00000037745.1 (pep primary_assembly:ASM223467v1:22:1892808:1894478:1 gene:ENSORLG00000024690.1 transcript:ENSORLT00000037745.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 1.866e-18
Identity = 52/91 (57.14%), Postives = 66/91 (72.53%), Query Frame = 3
Query:  516 PVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMK 788
            P   +F+ NISEK  D  ++ +L KCG +L+WKRVQGASGKLQ FG CEY+ PE+TLR +RLL+ L + DK LLVKVD KT   L+E+  K
Sbjct:   34 PTTTVFVGNISEKASDMLVRQLLAKCGIVLSWKRVQGASGKLQ-FGFCEYKEPESTLRALRLLHELLLGDKKLLVKVDAKTKAQLEEWKAK 123          
BLAST of RNA-binding protein 25 vs. Planmine SMEST
Match: SMESG000074806.1 (SMESG000074806.1)

HSP 1 Score: 1139.79 bits (2947), Expect = 0.000e+0
Identity = 676/679 (99.56%), Postives = 677/679 (99.71%), Query Frame = 3
Query:  438 MFAPNPVVPIYTNVPPPAIYPAINNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKTIDEKYENLSEEEKQEKINQIDMKRNNEDKVCLSEVKKILEDIGLEYKLNEIGNSEANEETKKPEKILTKEENNAKKSISKEIESIRNKRRNSDTEDDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGNRSKPDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAEKELDEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQSMQEHLKKRLTDNSVDATLASVKTEKENVPNEMIKSEKRETIPLEDNISTHDLLNNNIXXXXXXXXXXXXXXXSDQKPGEIQQNSKCQVDNNPADPETSNHGNHEQXXXXXXXXXXXXENESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVKCNFS 2474
            MFAPNPVVPIYTNVPPPAIYPAINNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKTIDEKYENLSEEEKQEKINQIDMKRNNEDKVCLSEVKKILEDIGLEYKLNEIGN+EANEETKKPEKILTKEENNAKKSISKEIESIRNKRRNSDTEDDAHRSKKLKKSDRDRRSKDKHESSRRHRSRSRSRPGNRSKPDDKRKRHSKSPPKKQRSNSKDSHKSSKVKKPAEKELDEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEES DAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQSMQEHLKKRLTDNSVDATLASVKTEKENVPNEMIKSEKRETIPLEDNISTHDLLNNNIVDKPVVVEGVVKECVSDQKPGEIQ NSKCQVDNNPADPETSNHGNHEQLLLPCDDKKPLPENESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVKCNFS
Sbjct:    1 MFAPNPVVPIYTNVPPPAIYPAINNSPVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKTIDEKYENLSEEEKQEKINQIDMKRNNEDKVCLSEVKKILEDIGLEYKLNEIGNTEANEETKKPEKILTKEENNAKKSISKEIESIRNKRRNSDTEDDAHRSKKLKKSDRDRRSKDKHESSRRHRSRSRSRPGNRSKPDDKRKRHSKSPPKKQRSNSKDSHKSSKVKKPAEKELDEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESADAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQSMQEHLKKRLTDNSVDATLASVKTEKENVPNEMIKSEKRETIPLEDNISTHDLLNNNIVDKPVVVEGVVKECVSDQKPGEIQHNSKCQVDNNPADPETSNHGNHEQLLLPCDDKKPLPENESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVKCNFS 679          
BLAST of RNA-binding protein 25 vs. Planmine SMEST
Match: SMESG000074815.1 (SMESG000074815.1)

HSP 1 Score: 191.43 bits (485), Expect = 7.020e-51
Identity = 94/144 (65.28%), Postives = 120/144 (83.33%), Query Frame = 3
Query: 1314 ELDEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQSMQEHLKKRL 1745
            E DEYE  +FK+LEKKLRDKEA+YQKRLQ WE REK++ K+Y  E+ER   K+N+++EEA+KLQIFFE+YDDE  D+KYY  +ELERR   R+ EE  D +DR KE+EQIE+TR++LLKE+NP+VE +IL+MEQSMQEHL+KRL
Sbjct:  345 EYDEYETTMFKQLEKKLRDKEAAYQKRLQTWEAREKKRLKDYETEKERNICKENEIAEEARKLQIFFEDYDDEKWDSKYYRGTELERRLTARRAEELADERDRMKEVEQIESTRQKLLKEHNPNVEAIILRMEQSMQEHLQKRL 488          

HSP 2 Score: 188.348 bits (477), Expect = 7.074e-50
Identity = 87/130 (66.92%), Postives = 106/130 (81.54%), Query Frame = 3
Query: 2073 NESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            N  + + G + P       +RK+++KKIID IPT K +LF+Y IEWD IDE+FVE  +KPW++KKI+ YIGEEEP+LSKFICDQVL+HKTPDQIL DI+MVLEEEA++FVMKMWRLLIYVIEEKK GL K
Sbjct:  603 NHKSAHSGTSIP-----HTERKLLVKKIIDGIPTIKADLFAYPIEWDTIDESFVETRIKPWVDKKIVAYIGEEEPSLSKFICDQVLDHKTPDQILADIAMVLEEEADVFVMKMWRLLIYVIEEKKAGLDK 727          

HSP 3 Score: 174.481 bits (441), Expect = 3.812e-45
Identity = 87/172 (50.58%), Postives = 121/172 (70.35%), Query Frame = 3
Query:  477 VPPPAIYPAINNS-----------PVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKTI-DEKYENL--SEEEKQEKINQIDMKRNNEDKVCLSEVKKILEDIGLEYKLNE 950
            +P P +   ++N+           P+  +FI NISEKI D  MK +L KCG +L+WKRVQGASGKLQAFG CEY+NPEATLRCIRLLN   ++DK+L+VKVDPKTDELL +Y  K +K I D + E++  +EEEK+E+IN I  +  +ED+  L+++KKI+++ G +   N+
Sbjct:   35 IPKPQLPTTVSNAETNQKFSSFERPITTVFIGNISEKISDSLMKDVLAKCGNVLSWKRVQGASGKLQAFGFCEYDNPEATLRCIRLLNDFAISDKTLVVKVDPKTDELLTDYKGKKQKAIEDREAEDVTRTEEEKKERINLIYAREADEDRNALTQIKKIIKEAGSDLTTND 206          
BLAST of RNA-binding protein 25 vs. Planmine SMEST
Match: SMESG000074815.1 (SMESG000074815.1)

HSP 1 Score: 191.43 bits (485), Expect = 7.934e-51
Identity = 94/144 (65.28%), Postives = 120/144 (83.33%), Query Frame = 3
Query: 1314 ELDEYEAAVFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSEEAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIEQIENTRRRLLKENNPDVEEVILKMEQSMQEHLKKRL 1745
            E DEYE  +FK+LEKKLRDKEA+YQKRLQ WE REK++ K+Y  E+ER   K+N+++EEA+KLQIFFE+YDDE  D+KYY  +ELERR   R+ EE  D +DR KE+EQIE+TR++LLKE+NP+VE +IL+MEQSMQEHL+KRL
Sbjct:  345 EYDEYETTMFKQLEKKLRDKEAAYQKRLQTWEAREKKRLKDYETEKERNICKENEIAEEARKLQIFFEDYDDEKWDSKYYRGTELERRLTARRAEELADERDRMKEVEQIESTRQKLLKEHNPNVEAIILRMEQSMQEHLQKRL 488          

HSP 2 Score: 188.348 bits (477), Expect = 7.208e-50
Identity = 87/130 (66.92%), Postives = 106/130 (81.54%), Query Frame = 3
Query: 2073 NESNPNEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVEMSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEEAEIFVMKMWRLLIYVIEEKKIGLVK 2462
            N  + + G + P       +RK+++KKIID IPT K +LF+Y IEWD IDE+FVE  +KPW++KKI+ YIGEEEP+LSKFICDQVL+HKTPDQIL DI+MVLEEEA++FVMKMWRLLIYVIEEKK GL K
Sbjct:  603 NHKSAHSGTSIP-----HTERKLLVKKIIDGIPTIKADLFAYPIEWDTIDESFVETRIKPWVDKKIVAYIGEEEPSLSKFICDQVLDHKTPDQILADIAMVLEEEADVFVMKMWRLLIYVIEEKKAGLDK 727          

HSP 3 Score: 174.481 bits (441), Expect = 3.919e-45
Identity = 87/172 (50.58%), Postives = 121/172 (70.35%), Query Frame = 3
Query:  477 VPPPAIYPAINNS-----------PVVALFISNISEKIPDPEMKTILDKCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLLVKVDPKTDELLKEYLMKVKKTI-DEKYENL--SEEEKQEKINQIDMKRNNEDKVCLSEVKKILEDIGLEYKLNE 950
            +P P +   ++N+           P+  +FI NISEKI D  MK +L KCG +L+WKRVQGASGKLQAFG CEY+NPEATLRCIRLLN   ++DK+L+VKVDPKTDELL +Y  K +K I D + E++  +EEEK+E+IN I  +  +ED+  L+++KKI+++ G +   N+
Sbjct:   35 IPKPQLPTTVSNAETNQKFSSFERPITTVFIGNISEKISDSLMKDVLAKCGNVLSWKRVQGASGKLQAFGFCEYDNPEATLRCIRLLNDFAISDKTLVVKVDPKTDELLTDYKGKKQKAIEDREAEDVTRTEEEKKERINLIYAREADEDRNALTQIKKIIKEAGSDLTTND 206          
The following BLAST results are available for this feature:
BLAST of RNA-binding protein 25 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBM253.029e-3653.44RNA binding motif protein 25 [Source:HGNC Symbol;A... [more]
RBM253.029e-3653.44RNA binding motif protein 25 [Source:HGNC Symbol;A... [more]
RBM258.287e-2857.14RNA binding motif protein 25 [Source:HGNC Symbol;A... [more]
RBM251.918e-2757.14RNA binding motif protein 25 [Source:HGNC Symbol;A... [more]
RBM252.948e-2757.14RNA binding motif protein 25 [Source:HGNC Symbol;A... [more]
back to top
BLAST of RNA-binding protein 25 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm-251.121e-2742.45RNA Binding Motif protein homolog [Source:UniProt... [more]
rbm-258.224e-2742.45RNA Binding Motif protein homolog [Source:UniProt... [more]
rbm-258.277e-2742.45RNA Binding Motif protein homolog [Source:UniProt... [more]
rbm-258.277e-2742.45RNA Binding Motif protein homolog [Source:UniProt... [more]
rbm-258.277e-2742.45RNA Binding Motif protein homolog [Source:UniProt... [more]
back to top
BLAST of RNA-binding protein 25 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG41191.043e-3360.95gene:FBgn0028474 transcript:FBtr0340463[more]
CG41191.043e-3360.95gene:FBgn0028474 transcript:FBtr0070799[more]
back to top
BLAST of RNA-binding protein 25 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm25b6.636e-3658.49RNA binding motif protein 25b [Source:ZFIN;Acc:ZDB... [more]
rbm25a2.098e-3069.86RNA binding motif protein 25a [Source:ZFIN;Acc:ZDB... [more]
rbm25a3.290e-2952.83RNA binding motif protein 25a [Source:ZFIN;Acc:ZDB... [more]
rbm25b3.737e-2756.12RNA binding motif protein 25b [Source:ZFIN;Acc:ZDB... [more]
rbm25a3.872e-2759.52RNA binding motif protein 25a [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of RNA-binding protein 25 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rbm258.768e-3759.43RNA binding motif protein 25 [Source:NCBI gene;Acc... [more]
rbm251.152e-3659.43RNA binding motif protein 25 [Source:NCBI gene;Acc... [more]
rbm251.182e-3659.43RNA binding motif protein 25 [Source:NCBI gene;Acc... [more]
back to top
BLAST of RNA-binding protein 25 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rbm252.216e-3653.44RNA binding motif protein 25 [Source:MGI Symbol;Ac... [more]
Rbm251.433e-2849.11RNA binding motif protein 25 [Source:MGI Symbol;Ac... [more]
Rbm252.635e-2751.40RNA binding motif protein 25 [Source:MGI Symbol;Ac... [more]
Rbm255.993e-2356.76RNA binding motif protein 25 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of RNA-binding protein 25 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|P49756|RBM25_HUMAN1.454e-3553.44RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=... [more]
sp|B2RY56|RBM25_MOUSE1.550e-3553.44RNA-binding protein 25 OS=Mus musculus OX=10090 GN... [more]
sp|Q8WZK0|US107_SCHPO3.763e-1230.70U1 snRNP-associated protein usp107 OS=Schizosaccha... [more]
back to top
BLAST of RNA-binding protein 25 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183K8W02.931e-7339.95PWI domain-containing protein OS=Schistosoma curas... [more]
A0A183MHA81.250e-6737.44PWI domain-containing protein OS=Schistosoma margr... [more]
A0A183P6828.645e-5437.09PWI domain-containing protein OS=Schistosoma matth... [more]
A0A087TX141.294e-5236.78RNA-binding protein 25 (Fragment) OS=Stegodyphus m... [more]
V4A5M05.316e-5235.68Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of RNA-binding protein 25 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rbm25b4.727e-3658.49RNA binding motif protein 25b [Source:ZFIN;Acc:ZDB... [more]
rbm25b9.851e-3658.49RNA binding motif protein 25b [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of RNA-binding protein 25 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004295.11.986e-3963.21pep scaffold:Pmarinus_7.0:GL477124:56243:73234:1 g... [more]
ENSPMAT00000009751.13.353e-2157.97pep scaffold:Pmarinus_7.0:GL485909:19:7776:-1 gene... [more]
back to top
BLAST of RNA-binding protein 25 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RNA-binding protein 25 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO320763.918e-3170.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259399.559e-1964.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA-binding protein 25 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rbm25a1.956e-4061.32RNA binding motif protein 25a [Source:ZFIN;Acc:ZDB... [more]
rbm25b7.468e-3758.33RNA-binding protein 25-like [Source:NCBI gene;Acc:... [more]
ENSORLT00000037745.11.866e-1857.14pep primary_assembly:ASM223467v1:22:1892808:189447... [more]
back to top
BLAST of RNA-binding protein 25 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000074806.10.000e+099.56SMESG000074806.1[more]
SMESG000074815.17.020e-5165.28SMESG000074815.1[more]
SMESG000074815.17.934e-5165.28SMESG000074815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001446 ID=SMED30001446|Name=RNA-binding protein 25|organism=Schmidtea mediterranea sexual|type=transcript|length=2564bp
CCTACTTTAAAAAGTTAAATATTGTAAGTTGTAAATTTAAAATGTAATTT
GAAAGATTTGTTTTTTGTGATATCATTAATTTTATACGTTTTATAATTAA
TTTATTTTTAAATAAATTTTTAAATTTAATTTTAATTCTAAGTTGTTTTT
TATTCAATTCTTATTGAATCTTAAAATATCATTAATTGTTTTGATAAAAA
TTGTCAACAGTAGAAAGTTTGGTGAACTTGCAAGGTGTCACACTTGAATT
AATTTAGTTATTAAGAAAAGAACAATATTAAAGTTTTGGTATTATAGCAT
ATCTTCCTCAGTTTGAAGAAAATATTTGCAATATAGTTTAACACTTAAAT
AAGCTATTTTATCAAAAACAAATATTTGCCAAAATTTGTTTGAATTTTTA
TGATAATTTTTGTATCTTATTGCATTAATTTGAAGATATGTTCGCTCCTA
ACCCAGTGGTTCCAATTTACACAAATGTTCCCCCGCCAGCTATTTATCCA
GCTATTAACAATTCCCCCGTAGTTGCATTGTTTATCAGTAACATATCTGA
AAAAATTCCAGATCCAGAAATGAAAACTATTTTAGATAAATGCGGAGAAA
TATTGAACTGGAAGCGAGTTCAAGGAGCATCTGGTAAGTTACAAGCTTTC
GGTCTTTGTGAATATGAAAATCCAGAAGCTACATTGCGTTGTATTAGACT
ATTAAATGGATTGAAAGTTGCTGATAAATCCTTGTTGGTGAAAGTTGATC
CGAAAACAGATGAACTATTGAAAGAATATTTGATGAAAGTTAAGAAGACA
ATCGATGAAAAATATGAAAATTTATCAGAAGAAGAAAAGCAAGAAAAAAT
TAATCAAATCGACATGAAAAGAAACAACGAAGATAAAGTTTGTTTGAGTG
AAGTTAAAAAAATTCTCGAAGACATTGGATTAGAATACAAATTAAATGAG
ATTGGAAACTCCGAAGCAAATGAAGAGACGAAAAAACCTGAAAAAATTCT
TACGAAAGAAGAAAATAATGCCAAAAAGTCGATATCAAAGGAGATCGAAT
CGATTAGGAATAAACGCAGAAATAGCGACACAGAAGATGACGCTCACCGT
TCAAAAAAATTGAAGAAAAGCGATAGAGATAGACGTAGCAAAGACAAACA
TGAATCGTCCCGTCGGCATCGGAGTAGATCGCGATCAAGACCAGGCAATC
GCTCTAAGCCTGACGACAAGCGAAAAAGACATTCGAAAAGTCCCCCCAAA
AAGCAACGTTCCAATTCTAAAGACTCGCATAAAAGCTCAAAAGTCAAGAA
ACCTGCCGAAAAAGAACTAGATGAATACGAAGCAGCTGTTTTCAAGAAAC
TAGAGAAGAAATTAAGAGATAAAGAAGCGTCTTATCAAAAAAGACTTCAG
GCTTGGGAGTTAAGAGAAAAGAGACAGGCAAAAGAATATTTAATCGAGGA
AGAACGAGAAAAAACCAAGAAAAATGATCTTTCCGAAGAAGCAAAAAAAT
TGCAAATATTCTTTGAAGAATATGACGATGAAATTTCGGATGCTAAATAC
TACATGAATTCTGAACTCGAACGGCGATGGGCTGTACGGCAAACCGAGGA
ATCGACTGACGCAAAAGATAGATCGAAAGAAATAGAACAAATTGAAAATA
CTCGGCGTCGTTTACTGAAAGAAAATAATCCCGATGTAGAGGAAGTCATT
TTAAAAATGGAGCAATCGATGCAAGAACACTTGAAAAAACGACTGACTGA
CAACAGTGTTGACGCAACTTTAGCTTCAGTGAAAACCGAAAAAGAAAATG
TGCCCAATGAAATGATCAAATCAGAAAAGCGAGAGACAATTCCATTGGAG
GACAACATAAGCACGCATGACCTGTTAAACAATAATATTGTAGATAAACC
GGTTGTTGTTGAAGGAGTGGTAAAGGAGTGTGTCAGTGACCAGAAACCTG
GAGAAATTCAGCAAAATTCCAAATGCCAAGTCGATAACAATCCAGCTGAC
CCTGAGACCAGTAACCATGGAAACCATGAGCAATTATTGTTGCCTTGCGA
TGATAAAAAGCCGCTGCCAGAAAATGAAAGCAATCCAAACGAGGGCAACA
CAAATCCACTGAGCACTCCCGAAAAAGTCGATAGAAAAGTTATGATGAAA
AAAATAATCGATGCGATACCCACATCGAAAGAGGAACTATTTTCCTATAT
AATCGAATGGGATATGATTGATGAGAATTTTGTCGAAATGAGTATGAAGC
CTTGGATCAATAAAAAGATCATCGAATATATCGGCGAGGAAGAACCGACA
TTGTCGAAATTTATCTGCGATCAAGTATTGGAGCATAAAACTCCCGATCA
AATACTTGATGATATTTCAATGGTGCTGGAGGAGGAGGCGGAAATATTTG
TCATGAAAATGTGGCGTTTGCTGATCTATGTTATTGAGGAGAAAAAAATC
GGCTTGGTAAAATGTAATTTCTCGTGAATTTTATACCGAAAGATTGAAGA
ATGCTCACAAGTCAAATGATTATTTCATGTTGTATAAAATAAATTAATTA
GTGAGATCGGAAGA
back to top

protein sequence of SMED30001446-orf-1

>SMED30001446-orf-1 ID=SMED30001446-orf-1|Name=SMED30001446-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=680bp
MFAPNPVVPIYTNVPPPAIYPAINNSPVVALFISNISEKIPDPEMKTILD
KCGEILNWKRVQGASGKLQAFGLCEYENPEATLRCIRLLNGLKVADKSLL
VKVDPKTDELLKEYLMKVKKTIDEKYENLSEEEKQEKINQIDMKRNNEDK
VCLSEVKKILEDIGLEYKLNEIGNSEANEETKKPEKILTKEENNAKKSIS
KEIESIRNKRRNSDTEDDAHRSKKLKKSDRDRRSKDKHESSRRHRSRSRS
RPGNRSKPDDKRKRHSKSPPKKQRSNSKDSHKSSKVKKPAEKELDEYEAA
VFKKLEKKLRDKEASYQKRLQAWELREKRQAKEYLIEEEREKTKKNDLSE
EAKKLQIFFEEYDDEISDAKYYMNSELERRWAVRQTEESTDAKDRSKEIE
QIENTRRRLLKENNPDVEEVILKMEQSMQEHLKKRLTDNSVDATLASVKT
EKENVPNEMIKSEKRETIPLEDNISTHDLLNNNIVDKPVVVEGVVKECVS
DQKPGEIQQNSKCQVDNNPADPETSNHGNHEQLLLPCDDKKPLPENESNP
NEGNTNPLSTPEKVDRKVMMKKIIDAIPTSKEELFSYIIEWDMIDENFVE
MSMKPWINKKIIEYIGEEEPTLSKFICDQVLEHKTPDQILDDISMVLEEE
AEIFVMKMWRLLIYVIEEKKIGLVKCNFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR034268RBM25_RRM
IPR035979RBD_domain_sf
IPR036483PWI_dom_sf
IPR012677Nucleotide-bd_a/b_plait_sf
IPR000504RRM_dom
IPR002483PWI_dom
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 331..351
NoneNo IPR availableCOILSCoilCoilcoord: 115..139
NoneNo IPR availableCOILSCoilCoilcoord: 392..412
NoneNo IPR availableGENE3DG3DSA:1.20.1390.10coord: 560..675
e-value: 2.4E-41
score: 142.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 226..251
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 176..225
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 176..295
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 272..295
NoneNo IPR availablePANTHERPTHR18806RBM25 PROTEINcoord: 24..675
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 30..102
e-value: 2.8E-7
score: 40.2
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 31..99
e-value: 2.8E-7
score: 30.2
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 29..106
score: 10.633
IPR002483PWI domainSMARTSM00311pwi_2coord: 595..668
e-value: 6.0E-25
score: 98.9
IPR002483PWI domainPFAMPF01480PWIcoord: 603..667
e-value: 1.3E-14
score: 54.2
IPR002483PWI domainPROSITEPS51025PWIcoord: 582..679
score: 30.569
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 26..149
e-value: 6.2E-10
score: 41.3
IPR034268RBM25, RNA recognition motifCDDcd12446RRM_RBM25coord: 31..111
e-value: 1.39015E-32
score: 118.481
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 7..105
IPR036483PWI domain superfamilySUPERFAMILYSSF101233PWI domaincoord: 602..665