Transporter

Overview
NameTransporter
Smed IDSMED30001440
Length (bp)3337
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transporter (SMED30001440) t-SNE clustered cells

Violin plots show distribution of expression levels for Transporter (SMED30001440) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transporter (SMED30001440) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transporter (SMED30001440) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001440

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001440h1SMcG0010466 SmedASXL_072603SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30001440h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30001440h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001440h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001440h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001440h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001440h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001440h1SMcG0010466 Contig34618uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001440h1SMcG0010466 Contig34618newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001440h1SMcG0010466 Contig29206newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001440h1SMcG0010466 Contig29206uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001440h1SMcG0010466 Contig29169uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001440h1SMcG0010466 Contig29169newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transporter vs. Ensembl Human
Match: SLC6A5 (solute carrier family 6 member 5 [Source:HGNC Symbol;Acc:HGNC:11051])

HSP 1 Score: 195.282 bits (495), Expect = 1.712e-69
Identity = 105/236 (44.49%), Postives = 144/236 (61.02%), Query Frame = 3
Query:  270 GDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN--------------------------DNTTCFDGSNNT--IHLLAIENK--ISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            GD+   RG W  K+DFI + + +AVGLGNVWRFPYL ++NGGGAFLIPY +ML   GLPIFFLE ++GQF+S GP+S W   P  +G G  M+II+  + +YYNVI+ + +FYLF+SF S LPW +C N WN                          ++T C     N   ++  +  NK  +S +E+Y++ +VL++S GIE  G   W L LCL L+W+IV A L KG+ + GK
Sbjct:  185 GDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGK 420          

HSP 2 Score: 90.1225 bits (222), Expect = 1.712e-69
Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGAG GI Y++TP++ +L+D  VW DAATQIFFSLS   GGLI ++SYNKF NNC R
Sbjct:  435 ILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYR 500          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 200.29 bits (508), Expect = 3.062e-69
Identity = 110/247 (44.53%), Postives = 153/247 (61.94%), Query Frame = 3
Query:  195 LLTKESLNLPTE-TIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN--DNTTCFDGSN------------NTIHLLAIE-NKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            L+ + SL +     + SE      T  DQ L+RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FF+E + GQF+S G +  W ISP+FKGVGYGM++++ Y+ +YYNV++    +Y FSS T  LPW+ C N WN  D     D SN            N  HLL     + S +E+Y+  YVL++S  I +FG     LL CL +SW++V   L++GV S GK
Sbjct:   73 LMAQHSLAMAQNGAVPSEA-----TKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGK 314          

HSP 2 Score: 84.3445 bits (207), Expect = 3.062e-69
Identity = 39/67 (58.21%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GI YYLTPQ+ ++ +  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  328 TILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYR 394          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 199.904 bits (507), Expect = 4.164e-69
Identity = 105/225 (46.67%), Postives = 145/225 (64.44%), Query Frame = 3
Query:  258 KITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN--DNTTCFDGSN------------NTIHLLAIE-NKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            + T  DQ L+RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FF+E + GQF+S G +  W ISP+FKGVGYGM++++ Y+ +YYNV++    +Y FSS T  LPW+ C N WN  D     D SN            N  HLL     + S +E+Y+  YVL++S  I +FG     LL CL +SW++V   L++GV S GK
Sbjct:   36 EATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGK 260          

HSP 2 Score: 84.3445 bits (207), Expect = 4.164e-69
Identity = 39/67 (58.21%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GI YYLTPQ+ ++ +  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  274 TILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYR 340          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 199.904 bits (507), Expect = 4.417e-69
Identity = 105/225 (46.67%), Postives = 145/225 (64.44%), Query Frame = 3
Query:  258 KITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN--DNTTCFDGSN------------NTIHLLAIE-NKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            + T  DQ L+RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FF+E + GQF+S G +  W ISP+FKGVGYGM++++ Y+ +YYNV++    +Y FSS T  LPW+ C N WN  D     D SN            N  HLL     + S +E+Y+  YVL++S  I +FG     LL CL +SW++V   L++GV S GK
Sbjct:   17 EATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGK 241          

HSP 2 Score: 84.3445 bits (207), Expect = 4.417e-69
Identity = 39/67 (58.21%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GI YYLTPQ+ ++ +  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  255 TILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYR 321          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 199.134 bits (505), Expect = 6.000e-69
Identity = 105/225 (46.67%), Postives = 145/225 (64.44%), Query Frame = 3
Query:  258 KITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN--DNTTCFDGSN------------NTIHLLAIE-NKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            + T  DQ L+RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FF+E + GQF+S G +  W ISP+FKGVGYGM++++ Y+ +YYNV++    +Y FSS T  LPW+ C N WN  D     D SN            N  HLL     + S +E+Y+  YVL++S  I +FG     LL CL +SW++V   L++GV S GK
Sbjct:   17 EATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGK 241          

HSP 2 Score: 84.3445 bits (207), Expect = 6.000e-69
Identity = 39/67 (58.21%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GI YYLTPQ+ ++ +  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  255 TILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYR 321          
BLAST of Transporter vs. Ensembl Celegans
Match: snf-3 (Sodium- and chloride-dependent betaine transporter [Source:UniProtKB/Swiss-Prot;Acc:G5EBN9])

HSP 1 Score: 181.03 bits (458), Expect = 1.126e-58
Identity = 93/237 (39.24%), Postives = 139/237 (58.65%), Query Frame = 3
Query:  201 TKESLNLPTETIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISAT--------EQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            T E + LPT+   ++ +  + +   ++ +RG+W GK DF+ + +++AVGLGNVWRFPYL YKNGGG+FL+ Y +      +PIF +E  +GQ+   G +  W++ PLF+GVG G V+I +    Y+ VIVA  +FY+ SS     PW TC NYWND  TC  G  N   L  I+  +++         EQ++EK VL  +  I +FG   W+L   +  +W+IV   L KG++   K
Sbjct:    3 TSEHVPLPTDE--AKAKELEQSQHSEEPDRGQWTGKFDFLMSMVAYAVGLGNVWRFPYLCYKNGGGSFLVVYMIFFCLAAVPIFLMEVTVGQYLQKGAMEMWLMCPLFRGVGIGNVVIAFMCIAYFCVIVAWAMFYMISSIAWVFPWETCNNYWND-ATCVTGKENFTELARIKALVASAGGHTQTSVEQFWEKRVLHDTGDISEFGGIQWELFFIMAAAWLIVYFALWKGITQARK 236          

HSP 2 Score: 67.0106 bits (162), Expect = 1.126e-58
Identity = 32/66 (48.48%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   L GAG GI +YL P   RL D  VW DA TQ+F+S     G LI + S+NKF +NC +
Sbjct:  251 ILLIRGLTLEGAGTGIYFYLKPNATRLLDTAVWKDAGTQVFYSYGVGFGALIALGSHNKFNHNCFK 316          
BLAST of Transporter vs. Ensembl Celegans
Match: mod-5 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7])

HSP 1 Score: 154.451 bits (389), Expect = 1.168e-54
Identity = 103/293 (35.15%), Postives = 154/293 (52.56%), Query Frame = 3
Query:   87 FEMNLNKKGNSPEKIPDQQIVIDSRPLKHITLSDRILL------------TKESLNLPTETIGSEGEVYKITYGD-------QKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWI-ISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFT----SKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSK--GIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
             +  L+    S    P+ + V  S  +K  T S+ + L            T  S++ P E I + G +     G          + R +W  K++F+   + +AV LGN+WRFP + YK+GGGAFLIPY +MLM  GLP+F++E  +GQF   G +S W  + PLF+G+GYG+  I  ++ ++YN I+A  V++   S +    S++PW++CGN WN    C D  N TI         + +E+YY   VLEV K  G +D G     + +CLL  +I+V   L KG  S GK
Sbjct:   15 LQAELSSGAASMLSAPESRRVSRSMSVKAPTASEYMPLSVADKPLTLTVSTSHSID-PNEPIAALGGLTPTKEGRVAALRRRSSMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVLGQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWN-TPRCSDDLNVTISRNGTP-LTTPSEEYYLYKVLEVQKSTGFDDLGGVKTSMAVCLLAVFIMVYFALWKGPQSSGK 304          

HSP 2 Score: 80.1073 bits (196), Expect = 1.168e-54
Identity = 38/67 (56.72%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            S+LL R   LPGA  G+ YY+TP F +L DP VW+ AATQIFFSL    G L+ ++SYN F NNC R
Sbjct:  318 SILLIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYR 384          
BLAST of Transporter vs. Ensembl Celegans
Match: snf-6 (Sodium-dependent acetylcholine transporter [Source:UniProtKB/Swiss-Prot;Acc:O76689])

HSP 1 Score: 162.155 bits (409), Expect = 6.380e-52
Identity = 88/229 (38.43%), Postives = 129/229 (56.33%), Query Frame = 3
Query:  270 GDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN---------------DNTTCFDGSNNTIHLLAIENKISATE--------QYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            GD+   RG W  K D++   I F  G+G+ W+FP+LV+++GG AFL+PY  ML    LP+FF+E  +GQFSS   IS W + PLFKG+G+  V I+ +  +++N+I A  +FYL +SF+  +PWS C N W+               + T   +GS    H  + E  +            +Y++  VL +SKG++DFG  +W L LC+L  WI V   L +GV S GK
Sbjct:   58 GDENRIRGNWSNKSDYLLAVIGFTAGVGSFWKFPFLVFQHGGAAFLVPYLCMLCLASLPMFFMEMVLGQFSSSAAISVWKVVPLFKGIGFAQVTISGFFAVFFNIISAWTLFYLINSFSFSIPWSNCANSWSGENCTLGTRIQCKEMNGTLLVNGSCIVEHASSNETTVIPLHDLGSIPSLKYFQNDVLMLSKGVDDFGTLNWYLGLCVLACWIAVFLCLFQGVKSSGK 286          

HSP 2 Score: 63.1586 bits (152), Expect = 6.380e-52
Identity = 27/53 (50.94%), Postives = 39/53 (73.58%), Query Frame = 1
Query:  904 GAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNN 1062
            G+   + Y+LTP++  L D +VW +AA Q F+S+SCCSGGL  +ASY++F NN
Sbjct:  311 GSLAAVFYFLTPKWEILMDLHVWGEAAVQAFYSVSCCSGGLFTIASYSRFHNN 363          
BLAST of Transporter vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 155.992 bits (393), Expect = 1.189e-51
Identity = 84/222 (37.84%), Postives = 130/222 (58.56%), Query Frame = 3
Query:  288 RGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCW-IISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN-----------DNTTCFDGSNNTIHLLAIENKISATEQYYEKYVL----------EVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            R +W GK+DF+ + + FAV LGN+WRFPYL +KNGGG FLIPY +M++  G+P+F++E  +GQ+   G I+ W  I PLFKG+GY +++  +Y+  +YNVI+A  + YL++SF+  LPW++C N +N           D T     +N ++       KISA E+Y+ K  L           V + + D G   W + L L + ++I    + KG+ + GK
Sbjct:   40 REQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLIPYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWASCNNSYNSPACYEPHWSEDGTAMCRSANQSVS----AEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVVYLICYFSMWKGIHTSGK 257          

HSP 2 Score: 68.5514 bits (166), Expect = 1.189e-51
Identity = 37/76 (48.68%), Postives = 44/76 (57.89%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR*YLYNLFNCF 1101
            +L  R   LPG   GI+YYL P F  L  P+VW DAATQ+FFSL    G L+  +SYN F NN    Y+  LF  F
Sbjct:  272 ILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFGVLMAYSSYNDFHNNV---YVDALFTSF 344          
BLAST of Transporter vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 142.51 bits (358), Expect = 2.755e-47
Identity = 90/239 (37.66%), Postives = 128/239 (53.56%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFT-SKLPWSTCGNYWNDNTTCFD------GSNNTI------------HLLAIENK-------------------ISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            ER +W    DFI +CI +A+GLGNVWRFPYL Y+NGGGAFLIPYC+ L+  G P+F LE + GQ  S+G +  + I P+FKGVG    ++ ++L +YY V+++    YL++SFT S +PW  C + WN      +       SN TI            H+   + +                   +S  ++++   VL +S G+E+ G   W L L LLL WII    + KGV   GK
Sbjct:    9 EREQWSSWADFIMSCIGYAIGLGNVWRFPYLCYQNGGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLGMFKICPIFKGVGIAAAVMAFWLNIYYIVVLSWAATYLYNSFTMSDVPWKNCDHAWNTPNCRSEYVKIPCDSNRTIAEFFNVKVLTHDHIHEYKKQFFVGEKMNWTVCSAADLSVVSPVKEFWNHRVLGISSGLENPGGIRWDLALFLLLVWIICYLCIFKGVKWTGK 247          

HSP 2 Score: 67.3958 bits (163), Expect = 2.755e-47
Identity = 31/65 (47.69%), Postives = 40/65 (61.54%), Query Frame = 1
Query:  877 LLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            LL R   L GAG G+++YL P F +L +  VW DA TQ+FFS     G L+ + SYNKF NN  +
Sbjct:  263 LLIRGLTLEGAGVGLEFYLKPDFSKLLESKVWVDAVTQVFFSYGLGLGALVALGSYNKFNNNVYK 327          
BLAST of Transporter vs. Ensembl Fly
Match: GlyT (gene:FBgn0034911 transcript:FBtr0301162)

HSP 1 Score: 178.333 bits (451), Expect = 2.043e-61
Identity = 96/231 (41.56%), Postives = 138/231 (59.74%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCW-IISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCF--------DGSNNTIHLLAIENKISA-----------------TEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            + + ERG W G+ DF+ + + ++VGLGNVWRFPYL Y NGGGAFLIP+ +ML+  GLP+ F+E + GQ+++LGP++ +    PLF+G+G GM++++  + LYYN+I+A  +FY+F+SF   LPW  C   W+    CF        + +N T +L    N  SA                  E+Y+  +VL +SKGIE+ G     L  CL L+W IV   L KGV S GK
Sbjct:   52 ESEHERGTWTGRFDFLLSLLGYSVGLGNVWRFPYLCYNNGGGAFLIPFTIMLVIAGLPLMFMELSFGQYAALGPVAVYRRFCPLFRGLGTGMILVSAIVMLYYNLIIAWTIFYMFASFAPVLPWQNCEPAWSTK-YCFSYAQADQCEATNGTYYLRTCHNATSAAENNITTLALGALKRPPAEEYFNNFVLGLSKGIEETGSIKLSLAACLFLAWTIVFLCLCKGVQSSGK 281          

HSP 2 Score: 78.9518 bits (193), Expect = 2.043e-61
Identity = 36/66 (54.55%), Postives = 46/66 (69.70%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +L  R   LPGA  GI +YLTP + +L++  VW DAA QIFF+LS   GGLI ++SYNKF NNC +
Sbjct:  296 ILFVRGVTLPGASTGILFYLTPDWKQLANAQVWGDAAVQIFFALSPAWGGLITLSSYNKFSNNCYK 361          
BLAST of Transporter vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0072362)

HSP 1 Score: 166.392 bits (420), Expect = 4.493e-59
Identity = 94/203 (46.31%), Postives = 125/203 (61.58%), Query Frame = 3
Query:  288 RGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCW-IISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSK--GIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            R  WG K +F+   I FAV LGNVWRFPY+ Y+NGGGAFL+PYCL L+  GLP+F++E A+GQF   G +S W  I P  KGVGY + +I  Y+ +YYN I+   V+YLF+SFTSKLPW++C N WN        S N   L       S  ++++E+ VLE  K  G++  G     L LC+   +++V   L KGV S GK
Sbjct:   74 RETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTENCMQVTSENFTEL-----ATSPAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGK 271          

HSP 2 Score: 83.5741 bits (205), Expect = 4.493e-59
Identity = 38/66 (57.58%), Postives = 49/66 (74.24%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGA +GIKYYLTP++++L +  VW DAA+QIFFSL    G L+ ++SYNKF NNC R
Sbjct:  286 ILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYR 351          
BLAST of Transporter vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0343316)

HSP 1 Score: 166.392 bits (420), Expect = 4.493e-59
Identity = 94/203 (46.31%), Postives = 125/203 (61.58%), Query Frame = 3
Query:  288 RGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCW-IISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSK--GIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            R  WG K +F+   I FAV LGNVWRFPY+ Y+NGGGAFL+PYCL L+  GLP+F++E A+GQF   G +S W  I P  KGVGY + +I  Y+ +YYN I+   V+YLF+SFTSKLPW++C N WN        S N   L       S  ++++E+ VLE  K  G++  G     L LC+   +++V   L KGV S GK
Sbjct:   74 RETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTENCMQVTSENFTEL-----ATSPAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGK 271          

HSP 2 Score: 83.5741 bits (205), Expect = 4.493e-59
Identity = 38/66 (57.58%), Postives = 49/66 (74.24%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGA +GIKYYLTP++++L +  VW DAA+QIFFSL    G L+ ++SYNKF NNC R
Sbjct:  286 ILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYR 351          
BLAST of Transporter vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0330002)

HSP 1 Score: 178.333 bits (451), Expect = 2.997e-58
Identity = 100/238 (42.02%), Postives = 143/238 (60.08%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCW-IISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWND---------------------------------NTTCFDGSN-NTIHLLAIENKISATEQYYEKYVLEV--SKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            ER  W GK+DF+ + I FAV L NVWRFPYL YKNGGGAFL+PY +ML+  G+P+F++E A+GQ +  G I+CW  + PLFKG+GY +V+I +Y+  YYNVI+A  + + F+SFT+ LPW++C N WN                                  N T  +GS+ +T  +  +E   SA  +Y+ +Y+LE+  S+GI D G   W + LCLL+ ++I    L KG+S+ GK
Sbjct:   26 ERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGISTSGK 263          

HSP 2 Score: 68.5514 bits (166), Expect = 2.997e-58
Identity = 34/66 (51.52%), Postives = 42/66 (63.64%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPG+  GI+YYLTP F  +    VW DAATQ+FFSL    G L+  ASYNK+ NN  +
Sbjct:  278 ILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYK 343          
BLAST of Transporter vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0087125)

HSP 1 Score: 178.333 bits (451), Expect = 3.749e-58
Identity = 100/238 (42.02%), Postives = 143/238 (60.08%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCW-IISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWND---------------------------------NTTCFDGSN-NTIHLLAIENKISATEQYYEKYVLEV--SKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            ER  W GK+DF+ + I FAV L NVWRFPYL YKNGGGAFL+PY +ML+  G+P+F++E A+GQ +  G I+CW  + PLFKG+GY +V+I +Y+  YYNVI+A  + + F+SFT+ LPW++C N WN                                  N T  +GS+ +T  +  +E   SA  +Y+ +Y+LE+  S+GI D G   W + LCLL+ ++I    L KG+S+ GK
Sbjct:   26 ERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGISTSGK 263          

HSP 2 Score: 68.5514 bits (166), Expect = 3.749e-58
Identity = 34/66 (51.52%), Postives = 42/66 (63.64%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPG+  GI+YYLTP F  +    VW DAATQ+FFSL    G L+  ASYNK+ NN  +
Sbjct:  278 ILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYK 343          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a9 (solute carrier family 6 member 9 [Source:ZFIN;Acc:ZDB-GENE-050105-3])

HSP 1 Score: 192.2 bits (487), Expect = 4.886e-68
Identity = 99/220 (45.00%), Postives = 140/220 (63.64%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWND------------NTTCFDGSNNTIHLLAIEN---KISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            D+   RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FFLE + GQF+SLG +  W +SP+FKGVGYGM++++ Y+ +YYNV++    +Y F S T+ LPW+ C N WN             N T  + S     +  I N   + S +E+Y+  YVL +S GI +FG     +L CL +SW +V   L++GV S GK
Sbjct:   26 DENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVSTHRANATFANMSAVVSGVTEIVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAVSWFVVFLCLIRGVKSSGK 245          

HSP 2 Score: 87.8113 bits (216), Expect = 4.886e-68
Identity = 41/67 (61.19%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GIKYYLTPQ+ ++ D  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  259 TILFIRGITLDGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFR 325          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a9 (solute carrier family 6 member 9 [Source:ZFIN;Acc:ZDB-GENE-050105-3])

HSP 1 Score: 192.2 bits (487), Expect = 5.768e-68
Identity = 99/220 (45.00%), Postives = 140/220 (63.64%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWND------------NTTCFDGSNNTIHLLAIEN---KISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            D+   RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FFLE + GQF+SLG +  W +SP+FKGVGYGM++++ Y+ +YYNV++    +Y F S T+ LPW+ C N WN             N T  + S     +  I N   + S +E+Y+  YVL +S GI +FG     +L CL +SW +V   L++GV S GK
Sbjct:   22 DENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVSTHRANATFANMSAVVSGVTEIVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAVSWFVVFLCLIRGVKSSGK 241          

HSP 2 Score: 87.8113 bits (216), Expect = 5.768e-68
Identity = 41/67 (61.19%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GIKYYLTPQ+ ++ D  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  255 TILFIRGITLDGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFR 321          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a9 (solute carrier family 6 member 9 [Source:ZFIN;Acc:ZDB-GENE-050105-3])

HSP 1 Score: 192.2 bits (487), Expect = 6.215e-68
Identity = 99/220 (45.00%), Postives = 140/220 (63.64%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWND------------NTTCFDGSNNTIHLLAIEN---KISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            D+   RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FFLE + GQF+SLG +  W +SP+FKGVGYGM++++ Y+ +YYNV++    +Y F S T+ LPW+ C N WN             N T  + S     +  I N   + S +E+Y+  YVL +S GI +FG     +L CL +SW +V   L++GV S GK
Sbjct:   17 DENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVSTHRANATFANMSAVVSGVTEIVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAVSWFVVFLCLIRGVKSSGK 236          

HSP 2 Score: 87.8113 bits (216), Expect = 6.215e-68
Identity = 41/67 (61.19%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GIKYYLTPQ+ ++ D  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  250 TILFIRGITLDGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFR 316          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a9 (solute carrier family 6 member 9 [Source:ZFIN;Acc:ZDB-GENE-050105-3])

HSP 1 Score: 191.43 bits (485), Expect = 8.240e-68
Identity = 99/220 (45.00%), Postives = 140/220 (63.64%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWND------------NTTCFDGSNNTIHLLAIEN---KISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            D+   RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FFLE + GQF+SLG +  W +SP+FKGVGYGM++++ Y+ +YYNV++    +Y F S T+ LPW+ C N WN             N T  + S     +  I N   + S +E+Y+  YVL +S GI +FG     +L CL +SW +V   L++GV S GK
Sbjct:   26 DENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVSTHRANATFANMSAVVSGVTEIVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAVSWFVVFLCLIRGVKSSGK 245          

HSP 2 Score: 87.8113 bits (216), Expect = 8.240e-68
Identity = 41/67 (61.19%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GIKYYLTPQ+ ++ D  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  259 TILFIRGITLDGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFR 325          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 181.03 bits (458), Expect = 1.582e-65
Identity = 101/236 (42.80%), Postives = 138/236 (58.47%), Query Frame = 3
Query:  276 QKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWND------------------------NTTCFDGSNNTIHLLA------IENK--ISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +   RG W  K+DFI + + +AVGLGNVWRFPYL ++NGGGAFLIPY +ML   G+PIF LE ++GQF+S GP+S W   P  +G G  M+II+  + +YYN+I+   ++YLF+S    LPW+TC N WN                           T F  S N +  L+      ++NK  +S +E+Y++  VL +SKGIE  G   W L  CL L+W+IV A L KG+ S GK
Sbjct:  173 ENKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGK 408          

HSP 2 Score: 90.5077 bits (223), Expect = 1.582e-65
Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGAG GI Y++TP++ +L+D  VW DAATQIFFSLS   GGLI ++SYNKF NNC R
Sbjct:  423 ILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYR 488          
BLAST of Transporter vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 223.402 bits (568), Expect = 9.864e-72
Identity = 115/207 (55.56%), Postives = 150/207 (72.46%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDG----SNNTIHLLAIENKISATEQYYEKYVLEV--SKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +RG W GK+DF+ +CI + VGLGNVWRFPY  Y NGGGAFLIPY +ML   G+P+FF+E ++GQFSSLGP++ W ISPLFKGVG GM++I   + +YYN+I+A+ +FYLF+S TS LPW  CGN+WN +  C D     ++N+  L+ I N +S +E+Y+ +YVL +  S GI D G   WKL LCLLLSW IV   +LKGV S GK
Sbjct:   35 DRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTD-LCLDHHVIRASNSALLVNISNTVSPSEEYWSRYVLHIQGSSGIGDPGQLRWKLCLCLLLSWTIVYLCILKGVKSSGK 240          

HSP 2 Score: 69.3218 bits (168), Expect = 9.864e-72
Identity = 35/66 (53.03%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   L GA  GIK+YLTPQF  L    VW +AA QIF+SL    GGL+  ASYN F  N  R
Sbjct:  255 MLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYR 320          
BLAST of Transporter vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 223.402 bits (568), Expect = 1.090e-71
Identity = 115/207 (55.56%), Postives = 150/207 (72.46%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDG----SNNTIHLLAIENKISATEQYYEKYVLEV--SKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +RG W GK+DF+ +CI + VGLGNVWRFPY  Y NGGGAFLIPY +ML   G+P+FF+E ++GQFSSLGP++ W ISPLFKGVG GM++I   + +YYN+I+A+ +FYLF+S TS LPW  CGN+WN +  C D     ++N+  L+ I N +S +E+Y+ +YVL +  S GI D G   WKL LCLLLSW IV   +LKGV S GK
Sbjct:   35 DRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTD-LCLDHHVIRASNSALLVNISNTVSPSEEYWSRYVLHIQGSSGIGDPGQLRWKLCLCLLLSWTIVYLCILKGVKSSGK 240          

HSP 2 Score: 69.3218 bits (168), Expect = 1.090e-71
Identity = 35/66 (53.03%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   L GA  GIK+YLTPQF  L    VW +AA QIF+SL    GGL+  ASYN F  N  R
Sbjct:  255 MLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYR 320          
BLAST of Transporter vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 223.016 bits (567), Expect = 1.481e-71
Identity = 115/207 (55.56%), Postives = 150/207 (72.46%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDG----SNNTIHLLAIENKISATEQYYEKYVLEV--SKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +RG W GK+DF+ +CI + VGLGNVWRFPY  Y NGGGAFLIPY +ML   G+P+FF+E ++GQFSSLGP++ W ISPLFKGVG GM++I   + +YYN+I+A+ +FYLF+S TS LPW  CGN+WN +  C D     ++N+  L+ I N +S +E+Y+ +YVL +  S GI D G   WKL LCLLLSW IV   +LKGV S GK
Sbjct:   32 DRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTD-LCLDHHVIRASNSALLVNISNTVSPSEEYWSRYVLHIQGSSGIGDPGQLRWKLCLCLLLSWTIVYLCILKGVKSSGK 237          

HSP 2 Score: 69.3218 bits (168), Expect = 1.481e-71
Identity = 35/66 (53.03%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   L GA  GIK+YLTPQF  L    VW +AA QIF+SL    GGL+  ASYN F  N  R
Sbjct:  252 MLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYR 317          
BLAST of Transporter vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 223.402 bits (568), Expect = 1.706e-71
Identity = 115/207 (55.56%), Postives = 150/207 (72.46%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDG----SNNTIHLLAIENKISATEQYYEKYVLEV--SKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +RG W GK+DF+ +CI + VGLGNVWRFPY  Y NGGGAFLIPY +ML   G+P+FF+E ++GQFSSLGP++ W ISPLFKGVG GM++I   + +YYN+I+A+ +FYLF+S TS LPW  CGN+WN +  C D     ++N+  L+ I N +S +E+Y+ +YVL +  S GI D G   WKL LCLLLSW IV   +LKGV S GK
Sbjct:   33 DRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTD-LCLDHHVIRASNSALLVNISNTVSPSEEYWSRYVLHIQGSSGIGDPGQLRWKLCLCLLLSWTIVYLCILKGVKSSGK 238          

HSP 2 Score: 68.9366 bits (167), Expect = 1.706e-71
Identity = 35/66 (53.03%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   L GA  GIK+YLTPQF  L    VW +AA QIF+SL    GGL+  ASYN F  N  R
Sbjct:  253 MLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYR 318          
BLAST of Transporter vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 222.246 bits (565), Expect = 2.208e-71
Identity = 115/207 (55.56%), Postives = 150/207 (72.46%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDG----SNNTIHLLAIENKISATEQYYEKYVLEV--SKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +RG W GK+DF+ +CI + VGLGNVWRFPY  Y NGGGAFLIPY +ML   G+P+FF+E ++GQFSSLGP++ W ISPLFKGVG GM++I   + +YYN+I+A+ +FYLF+S TS LPW  CGN+WN +  C D     ++N+  L+ I N +S +E+Y+ +YVL +  S GI D G   WKL LCLLLSW IV   +LKGV S GK
Sbjct:   28 DRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTD-LCLDHHVIRASNSALLVNISNTVSPSEEYWSRYVLHIQGSSGIGDPGQLRWKLCLCLLLSWTIVYLCILKGVKSSGK 233          

HSP 2 Score: 69.707 bits (169), Expect = 2.208e-71
Identity = 35/66 (53.03%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   L GA  GIK+YLTPQF  L    VW +AA QIF+SL    GGL+  ASYN F  N  R
Sbjct:  248 MLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYR 313          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a7 (solute carrier family 6 (neurotransmitter transporter, L-proline), member 7 [Source:MGI Symbol;Acc:MGI:2147363])

HSP 1 Score: 211.46 bits (537), Expect = 4.332e-70
Identity = 110/211 (52.13%), Postives = 146/211 (69.19%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFD----GSNNTIHLLAIENKISATEQYYEKYVLEV--SKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            D   +RG W GK+DF+ +CI + VGLGNVWRFPY  Y NGGGAFL+PY LML   G+P+FFLE ++GQFSSLGP++ W ISPLFKG G  M++I   + +YYN+I+A+ +FYLF+S TS LPW  CGN+WN    C +     S N +  L + + +S +E+Y+ +YVL +  S+GI   G   W L LCLLL+W+IV   +LKGV S GK
Sbjct:   32 DFAADRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTE-LCLEHRGPKSGNGVLPLNLSSTVSPSEEYWSRYVLHIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGK 241          

HSP 2 Score: 75.485 bits (184), Expect = 4.332e-70
Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGA +GI++YLTPQF+ L    VW +AA QIF+SL    GGL+  ASYN F  N  R
Sbjct:  256 MLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYR 321          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 196.052 bits (497), Expect = 7.418e-70
Identity = 115/267 (43.07%), Postives = 157/267 (58.80%), Query Frame = 3
Query:  198 LTKESLNLPTETIGS--EGEVYKIT-----YGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN-----DNT-----TCFDGS-------NNTIHLLAIENK-------------ISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +++ ++ L T+ I S   G V   T      GD+   RG W  K+DFI + + +AVGLGNVWRFPYL ++NGGGAFLIPY +ML   GLPIFFLE ++GQF+S GP+S W   P  +G G  M+II+  + +YYNVI+ + +FYLF+SF S LPW +C N WN     D T     +C  G        N+T  + A  N              +S +E+Y++ +VL++S GIE  G   W L  CL L+W+IV A L KG+ S GK
Sbjct:  148 MSQSTVVLGTDGIASVLPGSVATTTIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGK 414          

HSP 2 Score: 90.1225 bits (222), Expect = 7.418e-70
Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGAG GI Y++TP++ +L+D  VW DAATQIFFSLS   GGLI ++SYNKF NNC R
Sbjct:  429 ILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYR 494          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 196.052 bits (497), Expect = 7.418e-70
Identity = 115/267 (43.07%), Postives = 157/267 (58.80%), Query Frame = 3
Query:  198 LTKESLNLPTETIGS--EGEVYKIT-----YGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN-----DNT-----TCFDGS-------NNTIHLLAIENK-------------ISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +++ ++ L T+ I S   G V   T      GD+   RG W  K+DFI + + +AVGLGNVWRFPYL ++NGGGAFLIPY +ML   GLPIFFLE ++GQF+S GP+S W   P  +G G  M+II+  + +YYNVI+ + +FYLF+SF S LPW +C N WN     D T     +C  G        N+T  + A  N              +S +E+Y++ +VL++S GIE  G   W L  CL L+W+IV A L KG+ S GK
Sbjct:  148 MSQSTVVLGTDGIASVLPGSVATTTIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGK 414          

HSP 2 Score: 90.1225 bits (222), Expect = 7.418e-70
Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGAG GI Y++TP++ +L+D  VW DAATQIFFSLS   GGLI ++SYNKF NNC R
Sbjct:  429 ILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYR 494          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 196.052 bits (497), Expect = 7.418e-70
Identity = 115/267 (43.07%), Postives = 157/267 (58.80%), Query Frame = 3
Query:  198 LTKESLNLPTETIGS--EGEVYKIT-----YGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN-----DNT-----TCFDGS-------NNTIHLLAIENK-------------ISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +++ ++ L T+ I S   G V   T      GD+   RG W  K+DFI + + +AVGLGNVWRFPYL ++NGGGAFLIPY +ML   GLPIFFLE ++GQF+S GP+S W   P  +G G  M+II+  + +YYNVI+ + +FYLF+SF S LPW +C N WN     D T     +C  G        N+T  + A  N              +S +E+Y++ +VL++S GIE  G   W L  CL L+W+IV A L KG+ S GK
Sbjct:  148 MSQSTVVLGTDGIASVLPGSVATTTIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGK 414          

HSP 2 Score: 90.1225 bits (222), Expect = 7.418e-70
Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGAG GI Y++TP++ +L+D  VW DAATQIFFSLS   GGLI ++SYNKF NNC R
Sbjct:  429 ILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYR 494          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a9 (solute carrier family 6 (neurotransmitter transporter, glycine), member 9 [Source:MGI Symbol;Acc:MGI:95760])

HSP 1 Score: 197.593 bits (501), Expect = 1.613e-68
Identity = 104/225 (46.22%), Postives = 143/225 (63.56%), Query Frame = 3
Query:  258 KITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN--DNTTCFDGSN------------NTIHLLAIE-NKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            + T  DQ L RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FF+E + GQF+S G +  W ISP+FKGVGYGM++++ Y+ +YYNV++    +Y FSS T  LPW+ C N WN  D     D SN            N  HL      + S +E+Y+  YVL++S  I +FG     LL CL +SW++V   L++GV S GK
Sbjct:   17 EATKKDQNLTRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLDASNLTNGSRPAALSGNLSHLFNYTLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSGK 241          

HSP 2 Score: 83.9593 bits (206), Expect = 1.613e-68
Identity = 39/67 (58.21%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GI YYLTPQ+ ++ +  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  255 TILFVRGVTLEGAFTGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYR 321          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|Q6PGE7|SC6A7_MOUSE (Sodium-dependent proline transporter OS=Mus musculus OX=10090 GN=Slc6a7 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 2.644e-69
Identity = 110/211 (52.13%), Postives = 146/211 (69.19%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFD----GSNNTIHLLAIENKISATEQYYEKYVLEV--SKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            D   +RG W GK+DF+ +CI + VGLGNVWRFPY  Y NGGGAFL+PY LML   G+P+FFLE ++GQFSSLGP++ W ISPLFKG G  M++I   + +YYN+I+A+ +FYLF+S TS LPW  CGN+WN    C +     S N +  L + + +S +E+Y+ +YVL +  S+GI   G   W L LCLLL+W+IV   +LKGV S GK
Sbjct:   32 DFAADRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTE-LCLEHRGPKSGNGVLPLNLSSTVSPSEEYWSRYVLHIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGK 241          

HSP 2 Score: 75.485 bits (184), Expect = 2.644e-69
Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGA +GI++YLTPQF+ L    VW +AA QIF+SL    GGL+  ASYN F  N  R
Sbjct:  256 MLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYR 321          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|Q761V0|SC6A5_MOUSE (Sodium- and chloride-dependent glycine transporter 2 OS=Mus musculus OX=10090 GN=Slc6a5 PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 4.235e-69
Identity = 115/267 (43.07%), Postives = 157/267 (58.80%), Query Frame = 3
Query:  198 LTKESLNLPTETIGS--EGEVYKIT-----YGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN-----DNT-----TCFDGS-------NNTIHLLAIENK-------------ISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +++ ++ L T+ I S   G V   T      GD+   RG W  K+DFI + + +AVGLGNVWRFPYL ++NGGGAFLIPY +ML   GLPIFFLE ++GQF+S GP+S W   P  +G G  M+II+  + +YYNVI+ + +FYLF+SF S LPW +C N WN     D T     +C  G        N+T  + A  N              +S +E+Y++ +VL++S GIE  G   W L  CL L+W+IV A L KG+ S GK
Sbjct:  156 MSQSTVVLGTDGIASVLPGSVATTTIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGK 422          

HSP 2 Score: 90.1225 bits (222), Expect = 4.235e-69
Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGAG GI Y++TP++ +L+D  VW DAATQIFFSLS   GGLI ++SYNKF NNC R
Sbjct:  437 ILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYR 502          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|Q9Y345|SC6A5_HUMAN (Sodium- and chloride-dependent glycine transporter 2 OS=Homo sapiens OX=9606 GN=SLC6A5 PE=1 SV=3)

HSP 1 Score: 195.282 bits (495), Expect = 7.570e-69
Identity = 105/236 (44.49%), Postives = 144/236 (61.02%), Query Frame = 3
Query:  270 GDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN--------------------------DNTTCFDGSNNT--IHLLAIENK--ISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            GD+   RG W  K+DFI + + +AVGLGNVWRFPYL ++NGGGAFLIPY +ML   GLPIFFLE ++GQF+S GP+S W   P  +G G  M+II+  + +YYNVI+ + +FYLF+SF S LPW +C N WN                          ++T C     N   ++  +  NK  +S +E+Y++ +VL++S GIE  G   W L LCL L+W+IV A L KG+ + GK
Sbjct:  185 GDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGK 420          

HSP 2 Score: 90.1225 bits (222), Expect = 7.570e-69
Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGAG GI Y++TP++ +L+D  VW DAATQIFFSLS   GGLI ++SYNKF NNC R
Sbjct:  435 ILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYR 500          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|P58295|SC6A5_RAT (Sodium- and chloride-dependent glycine transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a5 PE=1 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 7.761e-69
Identity = 119/295 (40.34%), Postives = 168/295 (56.95%), Query Frame = 3
Query:  120 PEKIPDQQIVIDSRPLKHITLSDR--ILLTKESLNLPTETIGS--EGEVYKIT-----YGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN-----DNT-----TCFDGS-------NNTIHLLAIENK-------------ISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            PE+  D+ + +    L+H        + +++ ++ L T+ I S   G V   T      GD+   RG W  K+DFI + + +AVGLGNVWRFPYL ++NGGGAFLIPY +ML   GLPIFFLE ++GQF+S GP+S W   P  +G G  M+II+  + +YYNVI+ + +FYLF+SF S LPW +C N WN     D T     +C  G        N+T  + A  N              +S +E+Y++ +VL++S GIE  G   W L  CL L+W+IV A L KG+ + GK
Sbjct:  130 PEE--DENVSVGKGTLEHNNTPAVGWVNMSQSTVVLGTDGIASVLPGSVATTTIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKTSGK 422          

HSP 2 Score: 90.1225 bits (222), Expect = 7.761e-69
Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGAG GI Y++TP++ +L+D  VW DAATQIFFSLS   GGLI ++SYNKF NNC R
Sbjct:  437 ILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYR 502          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|P48067|SC6A9_HUMAN (Sodium- and chloride-dependent glycine transporter 1 OS=Homo sapiens OX=9606 GN=SLC6A9 PE=1 SV=3)

HSP 1 Score: 200.29 bits (508), Expect = 1.354e-68
Identity = 110/247 (44.53%), Postives = 153/247 (61.94%), Query Frame = 3
Query:  195 LLTKESLNLPTE-TIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN--DNTTCFDGSN------------NTIHLLAIE-NKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            L+ + SL +     + SE      T  DQ L+RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FF+E + GQF+S G +  W ISP+FKGVGYGM++++ Y+ +YYNV++    +Y FSS T  LPW+ C N WN  D     D SN            N  HLL     + S +E+Y+  YVL++S  I +FG     LL CL +SW++V   L++GV S GK
Sbjct:   73 LMAQHSLAMAQNGAVPSEA-----TKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGK 314          

HSP 2 Score: 84.3445 bits (207), Expect = 1.354e-68
Identity = 39/67 (58.21%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GI YYLTPQ+ ++ +  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  328 TILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYR 394          
BLAST of Transporter vs. TrEMBL
Match: A0A564Y2T9 (Transporter OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2321 PE=3 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.125e-92
Identity = 143/258 (55.43%), Postives = 178/258 (68.99%), Query Frame = 3
Query:  117 SPEKIPDQQIVIDSRPLKHITLSDRILLTKESLNLPTETIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCF-DGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            S  K+PD  I     P    +LSD               I S+ +V  +   D +  RG WG KI+F+ +CI+FAVGLGNVWRFPYL YKNGGGAFL+PY +ML+C+GLPIFFLEFA GQF+SLGPIS W ISPLFKGVGY M I++WY++LYYNVI+A  +FYLF+SF S+LPWSTC N+WN+ +TC+  G+N+ I    I    S   +YY  YVL+ S G +DFG P W + LCLLL+WIIV   L+KGV SLGK
Sbjct:   16 SDPKLPDAVI-----PENEDSLSD---------------IVSDNKVDDVEANDDQ-NRGGWGLKIEFLLSCIAFAVGLGNVWRFPYLCYKNGGGAFLVPYVIMLICLGLPIFFLEFAFGQFASLGPISIWSISPLFKGVGYAMTIVSWYISLYYNVIIATALFYLFASFNSRLPWSTCDNWWNNGSTCYIIGTNSNI---PINETTSPAVEYYNNYVLQKSSGFDDFGTPVWHMTLCLLLAWIIVVLSLIKGVQSLGK 249          

HSP 2 Score: 103.99 bits (258), Expect = 1.125e-92
Identity = 48/67 (71.64%), Postives = 54/67 (80.60%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++LL R+A L GA  G+ YYL P F RLSDP VWTDAATQI FSLSCC+GGLI M+SYNKFKNNC R
Sbjct:  263 TILLVRAATLEGAIDGVIYYLNPDFSRLSDPTVWTDAATQIIFSLSCCNGGLIAMSSYNKFKNNCYR 329          
BLAST of Transporter vs. TrEMBL
Match: A0A564Y3D8 (Transporter OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2322 PE=3 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.467e-92
Identity = 143/258 (55.43%), Postives = 178/258 (68.99%), Query Frame = 3
Query:  117 SPEKIPDQQIVIDSRPLKHITLSDRILLTKESLNLPTETIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCF-DGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            S  K+PD  I     P    +LSD               I S+ +V  +   D +  RG WG KI+F+ +CI+FAVGLGNVWRFPYL YKNGGGAFL+PY +ML+C+GLPIFFLEFA GQF+SLGPIS W ISPLFKGVGY M I++WY++LYYNVI+A  +FYLF+SF S+LPWSTC N+WN+ +TC+  G+N+ I    I    S   +YY  YVL+ S G +DFG P W + LCLLL+WIIV   L+KGV SLGK
Sbjct:   16 SDPKLPDAVI-----PENEDSLSD---------------IVSDNKVDDVEANDDQ-NRGGWGLKIEFLLSCIAFAVGLGNVWRFPYLCYKNGGGAFLVPYVIMLICLGLPIFFLEFAFGQFASLGPISIWSISPLFKGVGYAMTIVSWYISLYYNVIIATALFYLFASFNSRLPWSTCDNWWNNGSTCYIIGTNSNI---PINETTSPAVEYYNNYVLQKSSGFDDFGTPVWHMTLCLLLAWIIVVLSLIKGVQSLGK 249          

HSP 2 Score: 103.99 bits (258), Expect = 1.467e-92
Identity = 48/67 (71.64%), Postives = 54/67 (80.60%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++LL R+A L GA  G+ YYL P F RLSDP VWTDAATQI FSLSCC+GGLI M+SYNKFKNNC R
Sbjct:  263 TILLVRAATLEGAIDGVIYYLNPDFSRLSDPTVWTDAATQIIFSLSCCNGGLIAMSSYNKFKNNCYR 329          
BLAST of Transporter vs. TrEMBL
Match: A0A564Y2N8 (Transporter OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2321 PE=3 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 2.743e-92
Identity = 143/258 (55.43%), Postives = 178/258 (68.99%), Query Frame = 3
Query:  117 SPEKIPDQQIVIDSRPLKHITLSDRILLTKESLNLPTETIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCF-DGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            S  K+PD  I     P    +LSD               I S+ +V  +   D +  RG WG KI+F+ +CI+FAVGLGNVWRFPYL YKNGGGAFL+PY +ML+C+GLPIFFLEFA GQF+SLGPIS W ISPLFKGVGY M I++WY++LYYNVI+A  +FYLF+SF S+LPWSTC N+WN+ +TC+  G+N+ I    I    S   +YY  YVL+ S G +DFG P W + LCLLL+WIIV   L+KGV SLGK
Sbjct:   16 SDPKLPDAVI-----PENEDSLSD---------------IVSDNKVDDVEANDDQ-NRGGWGLKIEFLLSCIAFAVGLGNVWRFPYLCYKNGGGAFLVPYVIMLICLGLPIFFLEFAFGQFASLGPISIWSISPLFKGVGYAMTIVSWYISLYYNVIIATALFYLFASFNSRLPWSTCDNWWNNGSTCYIIGTNSNI---PINETTSPAVEYYNNYVLQKSSGFDDFGTPVWHMTLCLLLAWIIVVLSLIKGVQSLGK 249          

HSP 2 Score: 103.605 bits (257), Expect = 2.743e-92
Identity = 48/67 (71.64%), Postives = 54/67 (80.60%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++LL R+A L GA  G+ YYL P F RLSDP VWTDAATQI FSLSCC+GGLI M+SYNKFKNNC R
Sbjct:  263 TILLVRAATLEGAIDGVIYYLNPDFSRLSDPTVWTDAATQIIFSLSCCNGGLIAMSSYNKFKNNCYR 329          
BLAST of Transporter vs. TrEMBL
Match: A0A564Z4T3 (Transporter OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS12534 PE=3 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 3.789e-92
Identity = 143/258 (55.43%), Postives = 178/258 (68.99%), Query Frame = 3
Query:  117 SPEKIPDQQIVIDSRPLKHITLSDRILLTKESLNLPTETIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCF-DGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            S  K+PD  I     P    +LSD               I S+ +V  +   D +  RG WG KI+F+ +CI+FAVGLGNVWRFPYL YKNGGGAFL+PY +ML+C+GLPIFFLEFA GQF+SLGPIS W ISPLFKGVGY M I++WY++LYYNVI+A  +FYLF+SF S+LPWSTC N+WN+ +TC+  G+N+ I    I    S   +YY  YVL+ S G +DFG P W + LCLLL+WIIV   L+KGV SLGK
Sbjct:   16 SDPKLPDAVI-----PENEDSLSD---------------IVSDNKVDDVEANDDQ-NRGGWGLKIEFLLSCIAFAVGLGNVWRFPYLCYKNGGGAFLVPYVIMLICLGLPIFFLEFAFGQFASLGPISIWSISPLFKGVGYAMTIVSWYISLYYNVIIATALFYLFASFNSRLPWSTCDNWWNNGSTCYIIGTNSNI---PINETTSPAVEYYNNYVLQKSSGFDDFGTPVWHMTLCLLLAWIIVVLSLIKGVQSLGK 249          

HSP 2 Score: 103.605 bits (257), Expect = 3.789e-92
Identity = 48/67 (71.64%), Postives = 54/67 (80.60%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++LL R+A L GA  G+ YYL P F RLSDP VWTDAATQI FSLSCC+GGLI M+SYNKFKNNC R
Sbjct:  263 TILLVRAATLEGAIDGVIYYLNPDFSRLSDPTVWTDAATQIIFSLSCCNGGLIAMSSYNKFKNNCYR 329          
BLAST of Transporter vs. TrEMBL
Match: A0A087W1G6 (Transporter OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000220200 PE=3 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 2.848e-91
Identity = 128/201 (63.68%), Postives = 153/201 (76.12%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            ERG WG KI+FI +CI+FAVGLGNVWRFPYL +KNGGGAFL+PY +ML+C+GLPIFFLEFA GQF+SLGPIS W ISPLFKGVGY M  ++WY++LYYNVI+A   FYLF+SF  +LPWSTC N+WN+N TC       I     +N  S   +YY  YVL+ S+G EDFG P W + LCLL SWI+V   L+KGV SLGK
Sbjct:   67 ERGGWGLKIEFILSCIAFAVGLGNVWRFPYLCFKNGGGAFLVPYVIMLVCLGLPIFFLEFAFGQFASLGPISIWSISPLFKGVGYAMTTVSWYISLYYNVIIATAFFYLFASFNKQLPWSTCDNWWNNNFTC-----QPIGAPQSDNATSPAVEYYNNYVLQKSRGFEDFGTPVWHITLCLLFSWIVVVLSLIKGVQSLGK 262          

HSP 2 Score: 105.145 bits (261), Expect = 2.848e-91
Identity = 47/67 (70.15%), Postives = 56/67 (83.58%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++LL R+A L G+ +G+KYY+TP F RLSDP  WTDAATQI FSLSCC+GGLI M+SYNKFKNNC R
Sbjct:  276 TILLVRAATLEGSLEGVKYYVTPDFSRLSDPTAWTDAATQIIFSLSCCNGGLIAMSSYNKFKNNCYR 342          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 191.43 bits (485), Expect = 6.705e-68
Identity = 97/220 (44.09%), Postives = 141/220 (64.09%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWND------------NTTCFDGSNNTIHLLAIEN---KISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            D+   RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FFLE + GQF+SLG +  W +SP+FKGVGYGM++++ Y+ +YYNV++    +Y F S T+ LPW+ C N WN             N +  + S     +  + N   + S +E+Y+  YVL +S GI +FG     +L CL +SW++V   L++GV S GK
Sbjct:   26 DENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSQRLNASIANISAVVSGVTEVVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAISWVVVFLCLIRGVKSSGK 245          

HSP 2 Score: 87.8113 bits (216), Expect = 6.705e-68
Identity = 41/67 (61.19%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GIKYYLTPQ+ ++ D  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  259 TILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFR 325          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 191.43 bits (485), Expect = 7.107e-68
Identity = 97/220 (44.09%), Postives = 141/220 (64.09%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWND------------NTTCFDGSNNTIHLLAIEN---KISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            D+   RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF+ PY +ML+  G+P+FFLE + GQF+SLG +  W +SP+FKGVGYGM++++ Y+ +YYNV++    +Y F S T+ LPW+ C N WN             N +  + S     +  + N   + S +E+Y+  YVL +S GI +FG     +L CL +SW++V   L++GV S GK
Sbjct:   22 DENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSQRLNASIANISAVVSGVTEVVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAISWVVVFLCLIRGVKSSGK 241          

HSP 2 Score: 87.8113 bits (216), Expect = 7.107e-68
Identity = 41/67 (61.19%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GIKYYLTPQ+ ++ D  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  255 TILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFR 321          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a11b (solute carrier family 6 member 11 [Source:NCBI gene;Acc:103035223])

HSP 1 Score: 191.815 bits (486), Expect = 3.938e-66
Identity = 100/226 (44.25%), Postives = 143/226 (63.27%), Query Frame = 3
Query:  222 PTETIGSEGEVYKITYGDQKL---ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWI-ISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            P + + +E     +   + K    ERG+W  KI+F+ +     +GLGNVWRFPYL YKNGGGAF +PY +  +C G+P+FFLE A+GQF+S G I+CW  + PLF+G+GY   +I  +L +YY VI++  +FYL + FT++LPW+ CG+YWN    C D +N +I  L      S   +++E+ VL +S GIE  G   W+L LCLL++WII    + KG  S GK
Sbjct:   14 PDDAMDAEASNTNLVRSNDKKVVNERGQWNNKIEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFVPYVIFFVCCGIPVFFLETALGQFTSEGGITCWRKVCPLFEGIGYATQVIEAHLNVYYVVILSWAIFYLLNCFTTELPWANCGHYWNTE-NCVDFNNASIENLTNPYATSPVMEFWERRVLSISDGIEHVGKLRWELALCLLVAWIICYFCIWKGPKSTGK 238          

HSP 2 Score: 81.6481 bits (200), Expect = 3.938e-66
Identity = 38/66 (57.58%), Postives = 43/66 (65.15%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGA  GIK+YL P   RLSDP VW DA TQIFFS + C G L  + SYN + NNC R
Sbjct:  253 ILLIRGITLPGAADGIKFYLYPDISRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNSYNNNCYR 318          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a3 (solute carrier family 6 member 3 [Source:NCBI gene;Acc:103026128])

HSP 1 Score: 188.734 bits (478), Expect = 6.426e-63
Identity = 96/203 (47.29%), Postives = 137/203 (67.49%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEV--SKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +R  WG KIDF+ + I FAV L NVWRFPYL YKNGGGAFL+PY L ++  G+P+F++E A+GQ++  G    W I P+FKGVG+ +++I+ Y+  YYNVI+A  +FYLFSSF+ +LPW  C N WN +  C D +     LL   +K++   +Y+E+ VL +  S+GI+D GLP W+L  CL +  +++   L KGV + GK
Sbjct:   60 QRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQYNREGAAGVWKICPVFKGVGFTVILISLYVGFYYNVIIAWALFYLFSSFSGELPWVNCNNTWN-SANCSDLNAT---LLNDSHKVTPALEYFERGVLHMQDSRGIDDLGLPRWQLTCCLAVVIVVLYFSLWKGVKTSGK 258          

HSP 2 Score: 73.9442 bits (180), Expect = 6.426e-63
Identity = 39/67 (58.21%), Postives = 43/67 (64.18%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +VLL R   LPGA  GIK YL+  F RL D  VW +AATQI FSL    G LI  +SYNKF NNC R
Sbjct:  272 TVLLLRGVTLPGAIDGIKAYLSVDFLRLCDAQVWIEAATQICFSLGVGFGVLIAFSSYNKFSNNCYR 338          
BLAST of Transporter vs. Ensembl Cavefish
Match: ENSAMXT00000015774.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:26496274:26511103:1 gene:ENSAMXG00000015324.2 transcript:ENSAMXT00000015774.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 184.111 bits (466), Expect = 9.259e-63
Identity = 97/207 (46.86%), Postives = 136/207 (65.70%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWI-ISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTC-FDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            ++  +RG+W  K++F+ +     +GLGNVWRFPYL YKNGGGAF IPY + L   G+P+FFLE A+GQ++S G I+CW  ISPLF+GVGY   +I   L +YY +++A  +FYL  SF+S LPWS+C N WN      F   N +I    +EN  S   +++E+ VL +S GI++ G   W ++LCLLL+WI+    + KGV S GK
Sbjct:   19 EKMKDRGQWSNKLEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLIFLATCGIPVFFLETALGQYTSEGGITCWRKISPLFEGVGYATQVIVALLNVYYIIVLAWGIFYLAFSFSSNLPWSSCNNTWNTEACMEFQRRNESIDQRHMENATSPVIEFWERRVLRISSGIDEIGELHWDMVLCLLLAWILCYFCIWKGVKSTGK 225          

HSP 2 Score: 78.1814 bits (191), Expect = 9.259e-63
Identity = 36/64 (56.25%), Postives = 43/64 (67.19%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNC 1065
            +LL R   LPGA  GI++YL P   RL+DP VW DA TQIFFS + C G L  + SYNK+ NNC
Sbjct:  240 ILLIRGITLPGASIGIQFYLYPDLGRLADPQVWMDAGTQIFFSYAICLGCLTALGSYNKYNNNC 303          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001684.1 (pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 gene:ENSPMAG00000001516.1 transcript:ENSPMAT00000001684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.69 bits (535), Expect = 6.936e-62
Identity = 109/211 (51.66%), Postives = 144/211 (68.25%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLL------AIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            D+  ERG W  K +++ + I  AVGLGN+WRFPYL YKNGGGAFLIPY +ML  VGLP+FFLE +IGQF+SLGPI+ W + PL KG+G+ MVI +  + LYYN I+A+ +FYLF+SFTS+LPWS+C  +W  +  CFD S     L          +K + +EQY+ KY L  S+ +++ G   W L L LLLSWI+  A L+KG+ S GK
Sbjct:    1 DENAERGNWASKSEYMLSMIGNAVGLGNLWRFPYLAYKNGGGAFLIPYIIMLAFVGLPLFFLECSIGQFASLGPITIWKVVPLLKGLGWMMVITSSLIALYYNSIIAYGLFYLFASFTSELPWSSCKKWWGADENCFDRSVCNSSLAEGNCSSVNSSKQTPSEQYWNKYALRRSESMDETGDVVWHLALTLLLSWIVTCAALVKGIKSSGK 211          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 176.792 bits (447), Expect = 4.502e-60
Identity = 91/200 (45.50%), Postives = 137/200 (68.50%), Query Frame = 3
Query:  288 RGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            RG W G+ DF+ +C+ +A+GLGNVWRFPYL  KNGGGAFLIPY L L+  G+P+F LE ++GQ++S+G +  W ++P+FKGVG   V+I++YL +YY VI++  ++YL++SFTS LPW  C N WN +  CF  SN +I  L   N  S   +++E+ + ++S G+++ G     L + L +SW++V   + KGV+  GK
Sbjct:   10 RGAWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLVFAGIPLFLLETSLGQYTSVGGLGVWKLAPMFKGVGLASVVISFYLNIYYIVIISWAIYYLYNSFTSMLPWQDCNNPWNTD-KCF--SNYSI--LDTTNLTSTVVEFWERNMHQLSSGLDEPGQVRGPLAITLAISWVMVYFCIWKGVAWTGK 204          

HSP 2 Score: 73.9442 bits (180), Expect = 4.502e-60
Identity = 41/89 (46.07%), Postives = 50/89 (56.18%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNN---------CCR*YLYNLFNCFHIFK 1113
            VL  R   LPGA +GI +Y+TP F RL+D  VW DAATQIFFS     G L+ + SYN F NN         CC   + ++F  F IF 
Sbjct:  219 VLFFRGITLPGAKEGILFYITPDFRRLTDSAVWLDAATQIFFSYGLGLGSLVALGSYNPFHNNVYNRDSIIVCCINSVTSVFAGFVIFS 307          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 123.25 bits (308), Expect = 4.397e-44
Identity = 80/169 (47.34%), Postives = 109/169 (64.50%), Query Frame = 3
Query:  396 GAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWI-ISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN--DNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEV--SKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            GAFLIPYCLM +  G+P+F++E A+GQF   G IS W  I P+FKGVG+ + II +Y+  YYN I+A  ++YL+SSFTS LPW+ C N WN  + T+ FD    T  +   ++  S  E++Y + VLE+  SKG+   G   W+LLLCL L + IV   L KGV + GK
Sbjct:    1 GAFLIPYCLMAVFGGIPLFYMELALGQFHRNGAISIWRRICPIFKGVGFAICIINFYVAFYYNTIIAWALYYLYSSFTSTLPWTKCDNPWNTVNCTSYFD----TTGVAWGKHSRSPAEEFYTRNVLEIQYSKGLGGVGGLRWQLLLCLFLIFTIVYFSLWKGVKTSGK 165          

HSP 2 Score: 73.9442 bits (180), Expect = 4.397e-44
Identity = 41/80 (51.25%), Postives = 50/80 (62.50%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR*YLY-NLFNCFHIF 1110
            +LL R A LPGA +G+ +YL P + +L    VW DAA QIFFSL    G L+ +ASYNKF NNC R  L  +  NCF  F
Sbjct:  180 ILLIRGATLPGAWRGVLFYLKPNWKKLLTTEVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYRDALVTSSVNCFTSF 259          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008631.1 (pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 gene:ENSPMAG00000007785.1 transcript:ENSPMAT00000008631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 4.220e-37
Identity = 68/172 (39.53%), Postives = 102/172 (59.30%), Query Frame = 3
Query:  396 GAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSF-TSKLPWSTCGNYWNDNTTCFD-------GSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            GAFL+PY L ++CVG+P+FFLE A+GQ +  G I  W I PLF GVG   +++ +   LYY V++A  ++YL  S  T++LPW+ C  +W     C D        SN +    A ++  S   +++E+ VL VS G+ D G  +W++LLCLL  W++V   + KG+   GK
Sbjct:    1 GAFLVPYGLTVVCVGIPLFFLEVALGQLTQQGTIGVWKIVPLFTGVGVASMVVVFLSDLYYIVVLAWSLYYLLHSLTTAQLPWTHCQGWWA-TAACSDTLGTSRAASNASEGASACQDTTSPAVEFWERNVLRVSSGMHDLGSVNWEMLLCLLAVWLLVYFSVWKGIKFSGK 171          

HSP 2 Score: 65.4698 bits (158), Expect = 4.220e-37
Identity = 29/62 (46.77%), Postives = 38/62 (61.29%), Query Frame = 1
Query:  886 RSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +   LPGA  GI YYL P + +L+ P VW +A+TQ+F+      G L  + SYNKF NNC R
Sbjct:  190 QGVMLPGALDGITYYLQPDWAKLATPQVWVEASTQVFYCYGVGFGVLPALGSYNKFHNNCYR 251          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003306.1 (pep scaffold:Pmarinus_7.0:GL476462:11074:20014:-1 gene:ENSPMAG00000003023.1 transcript:ENSPMAT00000003306.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.028 bits (323), Expect = 5.055e-34
Identity = 79/214 (36.92%), Postives = 117/214 (54.67%), Query Frame = 3
Query:  348 LGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN--------DNTTCF---DGSNNTIHLLAIENKISATE-----------------------QYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            LGNVWRFPYL Y++G   FLIPY L+ +  G+PIFF+E A+GQF   G I  W I+PLF+G+G   +++ ++  +YY +++   ++YL   F + +PWSTCGN WN         +  C+   D +N T   LA  +  ++                         +++EK VL +S+G+   G  +  LLLCLL  WII+   + KGV S GK
Sbjct:    1 LGNVWRFPYLCYQSGSSVFLIPYFLIAVTCGIPIFFMEIALGQFMKQGSIGIWKIAPLFQGLGVSSMVMLFFSNIYYIMVLTWAMYYLLHCFRATVPWSTCGNEWNTPACAVHFQHQRCYNYSDDANETSPALATTDAATSVRIFINSTNGTGGCWGAAETTSPIVEFWEKKVLRISEGLHQPGSINVHLLLCLLAVWIIIYFCVWKGVKSTGK 214          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO49218 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4])

HSP 1 Score: 206.068 bits (523), Expect = 2.716e-70
Identity = 98/202 (48.51%), Postives = 144/202 (71.29%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCW-IISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            ER +WG K++F   C+ +AVGLGNVWRFPYL +KNGGGAFLIPY  ML+  G+P+FF+E ++GQF SLGP++ W  I P+ KGVG+ M+++++   +YYNVI+A C++YLF SF   +PW TC N+WN  T C     +T    A++   S ++++YE YVL ++  I+ FG+  W+L++CL+L+W++V   L KG+ S GK
Sbjct:   37 EREKWGRKVEFFLACVGYAVGLGNVWRFPYLCFKNGGGAFLIPYLCMLLICGMPLFFMELSLGQFVSLGPVTSWAAICPISKGVGFAMLVVSFLCCVYYNVIIAWCLYYLFESFAKDVPWKTCDNWWNTATNCTSNLTDT----ALKEYSSPSKEFYENYVLRITPDIDTFGVMRWQLVVCLILAWVLVYFCLWKGIKSSGK 234          

HSP 2 Score: 79.7221 bits (195), Expect = 2.716e-70
Identity = 38/66 (57.58%), Postives = 44/66 (66.67%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R   LPGA +G+ +YL P F +L D  VW DAATQIF+SL    G LI M SYNKF NNC R
Sbjct:  249 ILLIRGLTLPGAMKGLSFYLKPNFSKLGDAIVWVDAATQIFYSLGIGFGSLIAMGSYNKFHNNCFR 314          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO31545 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0])

HSP 1 Score: 182.57 bits (462), Expect = 3.503e-63
Identity = 99/235 (42.13%), Postives = 144/235 (61.28%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCW-IISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDG---------------------------------SNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            ER  WG K DF+ +CI FAVGLGNVWRFPYL Y NGGGAFL+PY +ML+  G+P+FF+E + GQ+ SLGPI  W  I PLF+G+G+  ++I++ + +YYNVI+A C+++L  SF S++ W  C N+WN +  C+ G                                 +N T   L  EN++S + +++E Y+L +S GI + G   W++L+CL+L+W+ V   + KGV S GK
Sbjct:    5 ERETWGKKADFLLSCIGFAVGLGNVWRFPYLCYANGGGAFLLPYLIMLVLCGMPMFFMELSAGQYFSLGPIGVWGAICPLFRGIGFASIVISFLVCVYYNVIIAWCLYFLAVSFRSEVLWKHCDNWWNTD-NCYAGRIPESMSCSLGSGSNNSLVNSTLANATVLAANATNATTECLFPENQVSPSLEFWENYILRLSDGIGEAGEIRWQILVCLILAWVGVYFCMWKGVKSSGK 238          

HSP 2 Score: 79.337 bits (194), Expect = 3.503e-63
Identity = 35/66 (53.03%), Postives = 44/66 (66.67%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +L  R   LPGA +GI +YL P+++RL DP VW  AATQIF+SL    G L+ M SYNKF NN  +
Sbjct:  253 ILFVRGVTLPGADKGIAFYLKPEWHRLKDPKVWVAAATQIFYSLGIGFGSLVAMGSYNKFHNNIFK 318          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO32356 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2])

HSP 1 Score: 171.014 bits (432), Expect = 2.578e-59
Identity = 93/212 (43.87%), Postives = 125/212 (58.96%), Query Frame = 3
Query:  276 QKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNT--------TCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            + +ER  W GK+DFI   I F+VGLGN+WRFPYL YKNGGG FLIPY + L+  G+P+  LE  +GQF S G I+ W I PLF+G+GY  V+I  YL +YY VI+    +Y+F SF + LPWS C N WN           T F+  +    L     K    +     YVL +S G++  G  +W++ LCLL +WI+    + KGV S G+
Sbjct:    5 EVVERETWVGKLDFILALIGFSVGLGNIWRFPYLCYKNGGGCFLIPYLICLLLAGVPLLILEVCLGQFMSQGGITAWKICPLFQGIGYASVVIVQYLNIYYIVILGWAFYYMFHSFQAVLPWSHCDNDWNTEKCHVGRKMITTFNSGSKCCQLFIKSFKCLWKDA--ADYVLNISGGLDQIGTINWQMALCLLFAWIVCYLCVFKGVKSTGR 214          

HSP 2 Score: 77.7962 bits (190), Expect = 2.578e-59
Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +++  R+  LPGA +GI++YL P + RL D +VW  AATQ+FFS S   G LI + SYNKFKNNC R
Sbjct:  228 TIICVRAVTLPGAREGIRFYLEPDWSRLQDGSVWLQAATQVFFSYSIGLGTLIALGSYNKFKNNCYR 294          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO39708 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978])

HSP 1 Score: 162.54 bits (410), Expect = 1.982e-58
Identity = 84/202 (41.58%), Postives = 133/202 (65.84%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCW-IISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            ER +W  KIDF+ +CI +AVGLGNVWRFPYL YKNGG +FLIPY + L+  G+PIF+LE A+GQ+++ G ++ W ++SP+  G+G+ M +IT+  ++YYNVI+A   +Y+F ++ + +PW+ C N WN   T F    + +++ +       +     + VL++S  +   G   ++L +CLLL+WI+V   + KG+ S GK
Sbjct:    3 EREQWSNKIDFLLSCIGYAVGLGNVWRFPYLCYKNGGASFLIPYLVCLVFCGIPIFYLEVALGQYTAQGVVNAWAVVSPIMTGIGFAMTVITFLCSVYYNVIMAWSFYYMFDAWRAVVPWNDCNNEWN---TQFCSCTHAMNIPSFHENTIISVTLSRRKVLQLSGDVGKPGEVRFELAMCLLLAWIVVYFCVWKGIKSAGK 201          

HSP 2 Score: 83.1889 bits (204), Expect = 1.982e-58
Identity = 40/66 (60.61%), Postives = 44/66 (66.67%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            +LL R A LPGA  G  +Y+ P F +L DP VW DAA QIFFSLS   GGLI   SYNKF NNC R
Sbjct:  216 ILLIRGATLPGAANGALFYVKPDFTKLGDPRVWVDAAGQIFFSLSVGFGGLITYGSYNKFNNNCQR 281          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO28939 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7T524])

HSP 1 Score: 156.377 bits (394), Expect = 1.896e-56
Identity = 80/208 (38.46%), Postives = 127/208 (61.06%), Query Frame = 3
Query:  285 ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWI-ISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNN-TIHLLAIENK-----ISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            +R +WG K +FI +C+ +AVGLGN+WRFPYL +KNGG +FLIPY  ML+  G+PIF++E A+GQF   G    W  + P   G+G  M++++ ++++YYNVI+A  + YL++S   ++P+  C N WN    C D   N T   L ++        + +E+++   +L  S G+E  G   + L   LL++WI+V   + +G+ S GK
Sbjct:   11 KREQWGHKAEFILSCVGYAVGLGNIWRFPYLCFKNGGASFLIPYGSMLLFCGIPIFYMELALGQFLRKGASKAWASVCPAAAGIGVAMMMVSGFISIYYNVIIAWSLLYLWNSLAKEIPFKHCKNPWN-TLLCRDADTNVTCASLGLDRNCTLQFTTPSEEFWTNKILHSSSGVEQVGEVRYDLATALLIAWIVVYLCVSRGIRSSGK 217          

HSP 2 Score: 83.1889 bits (204), Expect = 1.896e-56
Identity = 39/64 (60.94%), Postives = 46/64 (71.88%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNC 1065
            VL+ R A LPGA QG+ +YL+P F RL+DP  W DAA+QIFFSLS   GGLI   SYN  +NNC
Sbjct:  232 VLIVRGATLPGAYQGVLFYLSPDFSRLADPQTWIDAASQIFFSLSVGLGGLIVFGSYNNRRNNC 295          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 190.66 bits (483), Expect = 2.013e-67
Identity = 105/246 (42.68%), Postives = 150/246 (60.98%), Query Frame = 3
Query:  204 KESLNLPTETIGSEGEVY-KITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWND-NTTCFDGS---------NNTIHLLA-------IENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
             ES  +   T    G V  +    D+ L RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF++PY +ML+  G+P+FFLE + GQF+S G +  W ISP+FKGVGYGM++++ Y+ +YYNV++    +Y F S T+ LPW+ C N WN  + +   GS         N T  L+A          + S +E+Y++ YVL +S  I +FG     +L CL +SW +V   L++GV S GK
Sbjct:    2 SESNTVAASTADQNGAVPGEPVKKDENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGK 247          

HSP 2 Score: 87.0409 bits (214), Expect = 2.013e-67
Identity = 41/67 (61.19%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GIKYYLTPQ+ ++ D  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  261 TILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFR 327          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 190.274 bits (482), Expect = 2.973e-67
Identity = 100/222 (45.05%), Postives = 143/222 (64.41%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN-DNTTCFDGS---------NNTIHLLA-------IENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            D+ L RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF++PY +ML+  G+P+FFLE + GQF+S G +  W ISP+FKGVGYGM++++ Y+ +YYNV++    +Y F S T+ LPW+ C N WN  + +   GS         N T  L+A          + S +E+Y++ YVL +S  I +FG     +L CL +SW +V   L++GV S GK
Sbjct:   22 DENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGK 243          

HSP 2 Score: 87.0409 bits (214), Expect = 2.973e-67
Identity = 41/67 (61.19%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GIKYYLTPQ+ ++ D  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  257 TILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFR 323          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 190.274 bits (482), Expect = 2.973e-67
Identity = 100/222 (45.05%), Postives = 143/222 (64.41%), Query Frame = 3
Query:  273 DQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN-DNTTCFDGS---------NNTIHLLA-------IENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            D+ L RG WG +I+F+ T + +AVGLGNVWRFPYL Y+NGGGAF++PY +ML+  G+P+FFLE + GQF+S G +  W ISP+FKGVGYGM++++ Y+ +YYNV++    +Y F S T+ LPW+ C N WN  + +   GS         N T  L+A          + S +E+Y++ YVL +S  I +FG     +L CL +SW +V   L++GV S GK
Sbjct:   22 DENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGK 243          

HSP 2 Score: 87.0409 bits (214), Expect = 2.973e-67
Identity = 41/67 (61.19%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++L  R   L GA  GIKYYLTPQ+ ++ D  VW DAA+QIF+SL C  GGLI MASYNKF NNC R
Sbjct:  257 TILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFR 323          
BLAST of Transporter vs. Ensembl Medaka
Match: ENSORLT00000002876.2 (sodium- and chloride-dependent GABA transporter 2 [Source:NCBI gene;Acc:101165729])

HSP 1 Score: 191.815 bits (486), Expect = 9.066e-66
Identity = 107/227 (47.14%), Postives = 148/227 (65.20%), Query Frame = 3
Query:  213 LNLPTETIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWI-ISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN-DNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            LN P + + S  E  K+T      +RG+WG KI+FI +     +GLGNVWRFPYL YKNGGGAF IPY + L   G+P+F LE A+GQ+++ G I+CW  I PLF+GVGY   +I   L +YY V++A  +FYLF+SFTS LPW++C N WN D+   F   N++I+    EN  S   +++E+ VL +S GIE+ G  +W L+LCL L+W++    + KGV S GK
Sbjct:   20 LNRPLDIVPSTEE--KMT------DRGQWGNKIEFILSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLIFLFACGIPVFLLETALGQYTTEGGITCWRKICPLFEGVGYATQVIVALLNVYYIVVLAWAIFYLFNSFTSNLPWASCNNTWNTDSCMAFQRGNSSIN--HHENATSPVIEFWERRVLRLSSGIEEIGTLNWDLVLCLALAWVLCYFCIWKGVKSTGK 236          

HSP 2 Score: 80.4925 bits (197), Expect = 9.066e-66
Identity = 39/66 (59.09%), Postives = 43/66 (65.15%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            VLL R   LPGA  GI +YL P   RLSDP VW DA TQIFFS + C G L  + SYNK+ NNC R
Sbjct:  251 VLLIRGITLPGASVGIHFYLYPDLGRLSDPQVWMDAGTQIFFSYAICLGCLTALGSYNKYNNNCYR 316          
BLAST of Transporter vs. Ensembl Medaka
Match: ENSORLT00000002877.2 (sodium- and chloride-dependent GABA transporter 2 [Source:NCBI gene;Acc:101165729])

HSP 1 Score: 191.43 bits (485), Expect = 1.182e-65
Identity = 107/227 (47.14%), Postives = 148/227 (65.20%), Query Frame = 3
Query:  213 LNLPTETIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWI-ISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWN-DNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            LN P + + S  E  K+T      +RG+WG KI+FI +     +GLGNVWRFPYL YKNGGGAF IPY + L   G+P+F LE A+GQ+++ G I+CW  I PLF+GVGY   +I   L +YY V++A  +FYLF+SFTS LPW++C N WN D+   F   N++I+    EN  S   +++E+ VL +S GIE+ G  +W L+LCL L+W++    + KGV S GK
Sbjct:   10 LNRPLDIVPSTEE--KMT------DRGQWGNKIEFILSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLIFLFACGIPVFLLETALGQYTTEGGITCWRKICPLFEGVGYATQVIVALLNVYYIVVLAWAIFYLFNSFTSNLPWASCNNTWNTDSCMAFQRGNSSIN--HHENATSPVIEFWERRVLRLSSGIEEIGTLNWDLVLCLALAWVLCYFCIWKGVKSTGK 226          

HSP 2 Score: 80.4925 bits (197), Expect = 1.182e-65
Identity = 39/66 (59.09%), Postives = 43/66 (65.15%), Query Frame = 1
Query:  874 VLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            VLL R   LPGA  GI +YL P   RLSDP VW DA TQIFFS + C G L  + SYNK+ NNC R
Sbjct:  241 VLLIRGITLPGASVGIHFYLYPDLGRLSDPQVWMDAGTQIFFSYAICLGCLTALGSYNKYNNNCYR 306          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000003011.1 (SMESG000003011.1)

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 265/265 (100.00%), Postives = 265/265 (100.00%), Query Frame = 3
Query:   93 MNLNKKGNSPEKIPDQQIVIDSRPLKHITLSDRILLTKESLNLPTETIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKXXXXXXXSWIIVTAVLLKGVSSLGK 887
            MNLNKKGNSPEKIPDQQIVIDSRPLKHITLSDRILLTKESLNLPTETIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKLLLCLLLSWIIVTAVLLKGVSSLGK
Sbjct:    1 MNLNKKGNSPEKIPDQQIVIDSRPLKHITLSDRILLTKESLNLPTETIGSEGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKLLLCLLLSWIIVTAVLLKGVSSLGK 265          

HSP 2 Score: 139.428 bits (350), Expect = 0.000e+0
Identity = 64/67 (95.52%), Postives = 66/67 (98.51%), Query Frame = 1
Query:  871 SVLLARSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 1071
            ++LL RSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR
Sbjct:  279 TILLIRSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCR 345          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000076702.1 (SMESG000076702.1)

HSP 1 Score: 198.364 bits (503), Expect = 2.142e-133
Identity = 101/227 (44.49%), Postives = 138/227 (60.79%), Query Frame = 3
Query: 1698 VHDHAHFTGQYHGTACQDCNLVRRINPTLPVVFHNPRGYDIHHFLKCAFGKFSELNLNVIPQSTEKFLTLTVTTKGRRI*FIDSLQFLNSSLVNLSKNVRNVPITSKVFISGKGIFPYDIVTSMEVL*STAELPPIWSRFNQIEYMHANQIWQQYNCKTLLGYLLVYIKFNIFLLADDFEAFKDKTFVGDGLEAVSFVSIPGLS*ASAVKQLSESVELIQDPEFSDY 2378
            V DH HFTG+Y G AC+ CN+ R I   LPVVFHN RGYD+HH LK    +F   NL+ IP S+EKFL+L V     RI FIDS QF N SL    K + ++P+T  VF               EVL +T ELPPIW   +++EY  A  IW +  C  LL Y+++Y+K + FLLAD F+ F+ K+   + LE +++  IPG+S +SA+  L + +EL+QD E  ++
Sbjct:  559 VRDHDHFTGKYIGPACKSCNVNRSIKELLPVVFHNLRGYDLHHILKYGINQFPNWNLSCIPISSEKFLSLMVYVGKLRIRFIDSYQFANDSLARAVKTLTSLPLTKSVF--------------TEVLENTYELPPIWEGVSEVEYEKAQLIWTETKCVNLLDYMMIYLKLDCFLLADFFQQFRAKSIAHNSLEPLNYFGIPGMSWSSALITLDKPIELLQDMEIYNF 771          

HSP 2 Score: 129.413 bits (324), Expect = 2.142e-133
Identity = 80/193 (41.45%), Postives = 114/193 (59.07%), Query Frame = 2
Query: 2366 IF*LFETGIRGGMTFINKYHLESDDTTQMAYQDVKNLYGWAY--------FRWLEDQTEMDYIIKRCGSGDEFYGDHVYLLKVDIVIPDNIQDKLDDLPIAPELSYPSGSKVEKLLLTHEPKTNYVINGR---I*MSGYAMV**FQKSIVL*SLRR*PFSKKYIDYYTKMRAASTDPF*RDYCKLKNNSLYRK 2911
            I+  +E GIRG +TF+NK+ +++D  T++ Y D+ NLYGWA         F W+ D    D I+  C + +     + Y L+V++ IP ++ DKLDD PIA E   P GSKVEKLLLTH PK NYVI+ R   + +S    V    +++     ++ P  K YID  T++RA ST+   ++Y KL NNSLY K
Sbjct:  768 IYNFYEGGIRGCLTFVNKHFVKTDKITELLYIDINNLYGWALSQPLPCSEFNWIFDG--FDTILFDCLTLNLESLSYGYTLEVNLEIPSDLHDKLDDFPIAAEKMKPEGSKVEKLLLTHYPKKNYVIHWRLLKLYLSLGVEVTHVNRAV---RFKQSPIFKNYIDTNTELRAKSTNTLDKNYYKLLNNSLYEK 955          

HSP 3 Score: 124.79 bits (312), Expect = 2.142e-133
Identity = 71/166 (42.77%), Postives = 101/166 (60.84%), Query Frame = 1
Query: 1195 YHYLKVTNLDRMLN-FRNRVEGVRIQSHWCHMCLHDF*KTWVFVR--KIC-------SIQHAP*NK--YIEFKDWSKTIKQQFVVYAGFESVLPPDDKYFQKHKPIAAKFVLLHQGNPIRN-ETFVGDNCIVQFM*ALNDISAEIVYPWYKINGKKEMIQLTREQE 1653
            YHY  VTNL  ++N  +N    VRI   WC  CL+ F K   F +  ++C       ++   P +K  Y+EFK+WSKTI   FV+YA FES+LP DD YFQKH PI+A  +L++    + +   F+G NC+ +F+  ++DI   IV P+YK NGKK M+ LT ++E
Sbjct:  374 YHYTAVTNLQSLMNCHKNNDCNVRICCKWCENCLNGFRKPKSFEKHQELCKKNQLGTTLYTLPKDKDKYLEFKNWSKTITPPFVIYADFESILPKDDIYFQKHLPISAGLLLINNFTGMTSYHHFIGQNCVYEFLKKVSDIGTNIVLPYYKENGKKLMLPLTFDEE 539          

HSP 4 Score: 88.1965 bits (217), Expect = 2.142e-133
Identity = 49/82 (59.76%), Postives = 56/82 (68.29%), Query Frame = 3
Query: 2961 SKRLIIYSSNHMFQRSIKIADDLIAVLLFKEIV*LDRPMYIGKTVLDLSKL-------------RDEFNC*INIVAGDTDSF 3167
             K++I Y+S   FQRSIKIADDLIA LL  + V LDRP YIG++VLDLSKL             R +FNC INIVAGDTDSF
Sbjct:  954 EKKMITYASKPTFQRSIKIADDLIAALLNPDSVCLDRPSYIGQSVLDLSKLRMYELQYKDLEKYRRQFNCEINIVAGDTDSF 1035          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000053372.1 (SMESG000053372.1)

HSP 1 Score: 217.624 bits (553), Expect = 8.135e-129
Identity = 108/215 (50.23%), Postives = 140/215 (65.12%), Query Frame = 3
Query: 1671 LSKKIINMLVHDHAHFTGQYHGTACQDCNLVRRINPTLPVVFHNPRGYDIHHFLKCAFGKFSELNLNVIPQSTEKFLTLTVTTKGRRI*FIDSLQFLNSSLVNLSKNVRNVPITSKVF----ISGKGIFPYDIVTSMEVL*STAELPPIWSRFNQIEYMHANQIWQQYNCKTLLGYLLVYIKFNIFLLADDFEAFKDKTFVGDGLEAVSFVSIPG 2303
            L KK I   V DH HFTG Y G AC+ CN+ RRI   LP+VFHN RGYD+HH LK    +F   NL++IP STEKF++L V      + FIDS+QF+N SL    K + ++P+TS VF    +  KGIFPY+   S EVL +T ELPPIW   ++ EY  A  IW Q NC+TL  Y+L+Y+K ++FLLAD F+ F+ K  V +GLE ++F  IPG
Sbjct: 1138 LCKKPIVNPVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFLSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDKAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPG 1352          

HSP 2 Score: 134.806 bits (338), Expect = 8.135e-129
Identity = 83/201 (41.29%), Postives = 116/201 (57.71%), Query Frame = 2
Query: 2375 LFETGIRGGMTFINKYHLESDDTTQMAYQDVKNLYGWAY--------FRWLEDQTEMDYIIKRCGSGDEF----YGDHVYLLKVDIVIPDNIQDKLDDLPIAPELSYPSGSKVEKLLLTHEPKTNYVING---RI*MSGYAMV**FQKSIVL*SLRR*PFSKKYIDYYTKMRAASTDPF*RDYCKLKNNSLYRKTVENFDK 2932
             +E GIRGG+TF+NK+++ + + T++ Y D+ NLYGWA         F W+ D   +D ++  C +  +     YG   Y ++VDI IPDN+ D L+D PI PE   P  SKVEKL+LTH PK NYV++    R+ +S  A V    ++I     ++ P  K YID  T +RA +     RD  KL NNSLY K+VEN  K
Sbjct: 1358 FYEGGIRGGLTFVNKHYIAASEDTELLYIDINNLYGWALSQSLPYADFTWVYDG--LDEVLNECANVVDIEILPYG---YTMEVDIEIPDNLHDFLNDFPIGPEKMCPPNSKVEKLMLTHYPKKNYVLHWRLLRLYLSLGAKVTHIHRAI---KYKQAPTFKHYIDKNTNLRANAVSELYRDLFKLYNNSLYGKSVENLKK 1550          

HSP 3 Score: 93.2041 bits (230), Expect = 8.135e-129
Identity = 57/154 (37.01%), Postives = 84/154 (54.55%), Query Frame = 1
Query: 1195 YHYLKVTNLDRMLN-FRNRVEGVRIQSHWCHMCLHDF*KTWVFVRKIC---------SIQHAP*NKYIEFKDWSKTIKQQFVVYAGFESVLPPDDKYFQKHKPIAAKFVLLHQ-GNPIRNETFVGDNCIVQFM*ALNDISAEIVYPWYKINGKK 1623
            YHY  VTN++ ++N  +N    ++I+  WC  CL+ F     F   +          ++   P NK +EF ++SK I   FV+YA FESVLPPDD++ Q H PIAA  +L++   N      F G +CI  F+  + +I+ EIV P+Y   G K
Sbjct:  964 YHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDK 1117          

HSP 4 Score: 80.1073 bits (196), Expect = 8.135e-129
Identity = 43/85 (50.59%), Postives = 57/85 (67.06%), Query Frame = 3
Query: 2952 CINSKRLIIYSSNHMFQRSIKIADDLIAVLLFKEIV*LDRPMYIGKTVLDLSKL-------------RDEFNC*INIVAGDTDSF 3167
            C ++++LI YSS   F+++I+I DDL A  L K+ + LDRP YIG++VLDLSKL             RD +NC IN+VAGDTDSF
Sbjct: 1557 CNSAEKLITYSSKPAFRKTIEITDDLFAAHLNKDSICLDRPSYIGQSVLDLSKLRMYQLQYVELQKYRDIYNCDINLVAGDTDSF 1641          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000062279.1 (SMESG000062279.1)

HSP 1 Score: 213.772 bits (543), Expect = 1.696e-128
Identity = 104/212 (49.06%), Postives = 134/212 (63.21%), Query Frame = 3
Query: 1671 LSKKIINMLVHDHAHFTGQYHGTACQDCNLVRRINPTLPVVFHNPRGYDIHHFLKCAFGKFSELNLNVIPQSTEKFLTLTVTTKGRRI*FIDSLQFLNSSLVNLSKNVRNVPITSKVF----ISGKGIFPYDIVTSMEVL*STAELPPIWSRFNQIEYMHANQIWQQYNCKTLLGYLLVYIKFNIFLLADDFEAFKDKTFVGDGLEAVSFVS 2294
            L KK I   V DH HF+G+Y G AC  CN+ RRI   LPVVFHN RGYD+HH LK     FS   LN+IP +TEKF++L        + FIDS+QF+NSSL    K + ++P+T  VF    +  K IFPYD   S+EVL ST ELPPIW   +  EY  A QIW Q NC+T+L Y+L Y+K ++FLLAD F+ F+ K    + LE ++F+ 
Sbjct: 1448 LCKKFIRDKVKDHCHFSGKYLGAACMKCNVSRRIQKQLPVVFHNLRGYDLHHILKYGLNNFSSWELNIIPTTTEKFISLIAYINKLPVRFIDSMQFINSSLAKAVKTLTDLPLTDSVFDGAIVRAKAIFPYDFAKSLEVLESTTELPPIWGSVSVDEYATAQQIWTQQNCETMLDYMLTYLKLDVFLLADYFQQFRAKAIAYNTLEPLNFME 1659          

HSP 2 Score: 126.331 bits (316), Expect = 1.696e-128
Identity = 82/204 (40.20%), Postives = 116/204 (56.86%), Query Frame = 2
Query: 2366 IF*LFETGIRGGMTFINKYHLESDDTTQMAYQDVKNLYGWAY--------FRWLEDQTEMDYIIKRCGSGDEF----YGDHVYLLKVDIVIPDNIQDKLDDLPIAPELSYPSGSKVEKLLLTHEPKTNYVING---RI*MSGYAMV**FQKSIVL*SLRR*PFSKKYIDYYTKMRAASTDPF*RDYCKLKNNSLYRKTVENFDK 2932
            +F  +E GIRGG+TF+NK+++ S + T+  Y D+ NLYGWA         F W+ D   +D ++  C +  +     YG   Y ++VDI IPD + + L+D PI PE   P  SKVEKL+LTH PK N+V++    R+ +S    V    ++I     ++ P    YID  TK+RA ST    R+  KL NNSLY K+VEN  K
Sbjct: 1665 MFNFYEGGIRGGLTFVNKHYVASFEDTEFLYIDINNLYGWALSQYLPYADFVWVYDG--LDDVLNECMNVADIEILPYG---YTMEVDIDIPDYLHNFLNDFPIGPEKMCPPNSKVEKLMLTHWPKKNHVLHWRLLRLYLSLGVNVVKVHRAI---KFKQAPIFHAYIDKNTKLRAQSTSELYRNLFKLYNNSLYGKSVENLKK 1860          

HSP 3 Score: 99.7525 bits (247), Expect = 1.696e-128
Identity = 58/170 (34.12%), Postives = 99/170 (58.24%), Query Frame = 1
Query: 1192 NYHYLKVTNLDRMLNFRNRVE-GVRIQSHWCHMCLHDF*KTWVFVR--KICS-------IQHAP*NKYIEFKDWSKTIKQQFVVYAGFESVLPPDDKYFQKHKPIAAKFVLLHQ-GNPIRNETFVGDNCIVQFM*ALNDISAEIVYPWYKINGKKEMIQLT-REQEEFTN 1665
            NYHY  V +L++++N        V+I  HWC  CL+ F     F     +CS       +   P NKY++F +++K+I   FV+YA FES+LP D ++ Q H PIAA  +L++   N  +   F+GD+C++ F+  +++I+  IV P+Y+++ +K +  L+ +E  EF +
Sbjct: 1273 NYHYTAVFDLNKLMNCHATTSCNVQISVHWCPHCLNGFRLKPAFDAHVALCSKNQTGTTLYTLPKNKYLKFTNFAKSITPPFVIYADFESILPLDIRHHQIHMPIAAGLLLINNYTNTKQYFNFIGDDCVLAFLKKIDEIALSIVLPYYEVHCQKPIGPLSFKEDREFKD 1442          

HSP 4 Score: 84.7297 bits (208), Expect = 1.696e-128
Identity = 46/85 (54.12%), Postives = 58/85 (68.24%), Query Frame = 3
Query: 2952 CINSKRLIIYSSNHMFQRSIKIADDLIAVLLFKEIV*LDRPMYIGKTVLDLSKL-------------RDEFNC*INIVAGDTDSF 3167
            C + +++I+Y+S   F++SI I D+LIA  L K+ + LDRP YIG+TVLDLSKL             RDEFNC INIVAGDTDSF
Sbjct: 1867 CNSDEKMIVYASKPTFRKSIIIDDNLIATHLNKDSICLDRPSYIGQTVLDLSKLRMYELQYKELAKYRDEFNCEINIVAGDTDSF 1951          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000072420.1 (SMESG000072420.1)

HSP 1 Score: 177.178 bits (448), Expect = 8.371e-124
Identity = 94/228 (41.23%), Postives = 128/228 (56.14%), Query Frame = 3
Query: 1698 VHDHAHFTGQYHGTACQDCNLVRRINPTLPVVFHNPRGYDIHHFLKCAFGKFSELNLNVIPQSTEKFLTLTVTTKGRRI*FIDSLQFLNSSLVNLSKNVRNVPITSKVF----ISGKGIFPYDIVTSMEVL*STAELPPIWSRFNQIEYMHANQIWQQYNCKTLLGYLLVYIKFNIFLLADDFEAFKDKTFVGDGLEAVSFVSIPGLS*ASAVKQLSESVELIQDPEF 2369
            V DH HFTG+Y G AC D                   GYD+HH LK    KF    L  IP ++EKF++L        + FIDS QF+N SL    K +  +P+T   F    +  KGIFPY+  TS++VL  T ELPPIW   ++ EY  A  IW + NC+TLL Y+ VY+K + FLLAD F+ F+ K+   + LE +++  IPG+S +SA+  L E +ELI + E 
Sbjct: 2267 VRDHDHFTGEYLGAACND-------------------GYDMHHILKYGLSKFKNWALGCIPITSEKFISLIAHLGKISVRFIDSYQFVNDSLAKAVKTLTTLPLTRSAFTGTIVDEKGIFPYNFATSLDVLHDTYELPPIWKGVSEAEYEKALLIWDETNCRTLLDYMKVYLKLDCFLLADFFQQFRAKSIAHNRLEPLNYFGIPGMSWSSALMSLDEPIELITENEM 2475          

HSP 2 Score: 139.043 bits (349), Expect = 8.371e-124
Identity = 87/204 (42.65%), Postives = 120/204 (58.82%), Query Frame = 2
Query: 2354 SRSGIF*LFETGIRGGMTFINKYHLESDDTTQMAYQDVKNLYGWAY--------FRWLEDQTEMDYIIKRCGSGDEFYGDHVYLLKVDIVIPDNIQDKLDDLPIAPELSYPSGSKVEKLLLTHEPKTNYVINGR---I*MSGYAMV**FQKSIVL*SLRR*PFSKKYIDYYTKMRAASTDPF*RDYCKLKNNSLYRKTVENFDK 2932
            + + +F  +E GIRGG+TF+NK+++++D+ T + Y D+ NLYGWA         F W+ +    D I+  C + D     + Y L+VD+ IP  +  KLDD PIA E   P GSKVEKLLLTH PK NYVI+ R   + MS    V    + +     ++    KKYID  T++RA ST+   ++Y KL NNSLY KTVEN  K
Sbjct: 2471 TENEMFSFYEGGIRGGLTFVNKHYVKTDENTDLLYIDINNLYGWALSQPLPCGEFNWIFEG--FDTILSDCLTLDLESLSYGYTLEVDLEIPSELHVKLDDFPIAAEKMKPEGSKVEKLLLTHYPKYNYVIHWRLLKLYMSLGVKVTHVNRGV---RFKQSNIFKKYIDINTELRAKSTNTLDKNYYKLLNNSLYGKTVENLKK 2669          

HSP 3 Score: 107.842 bits (268), Expect = 8.371e-124
Identity = 61/164 (37.20%), Postives = 97/164 (59.15%), Query Frame = 1
Query: 1195 YHYLKVTNLDRMLNFRNRVEGVRIQSHWCHMCLHDF*KTWVFVRK--IC-------SIQHAP*NKYIEFKDWSKTIKQQFVVYAGFESVLPPDDKYFQKHKPIAAKFVLLHQ--GNPIRNETFVGDNCIVQFM*ALNDISAEIVYPWYKINGKKEMIQLTREQE 1653
            YHY+ +T+L+R+LN +++    RI+S WCH CL+ F       +   +C       ++   P NK+I+F DWSKT+   +V+YA FESVLP DD + Q H PI+A  +L++   G+ I  E F+G++C+ QF+  +  I+   V P+Y   G   + +LT  Q+
Sbjct: 2086 YHYVGITSLNRLLNCKDKTTE-RIRSLWCHRCLNGFRNKKALDKHEILCMRNQLGTTLYTFPENKFIKFTDWSKTVTPPYVIYADFESVLPKDDVHHQIHLPISAGLLLINNFDGSTIYKE-FIGEDCVEQFLKTVEKIAKYTVLPYYYKMGNNTIKELTNIQQ 2247          

HSP 4 Score: 84.3445 bits (207), Expect = 8.371e-124
Identity = 45/85 (52.94%), Postives = 56/85 (65.88%), Query Frame = 3
Query: 2952 CINSKRLIIYSSNHMFQRSIKIADDLIAVLLFKEIV*LDRPMYIGKTVLDLSKL-------------RDEFNC*INIVAGDTDSF 3167
            C   K+L+ Y+S   F++SIKI +DLIA LL  + + LDRP YIG++VLDLSKL             R +FNC INIVAGDTDSF
Sbjct: 2676 CTTDKKLVTYTSKPTFKKSIKIDNDLIAALLNPDSICLDRPSYIGQSVLDLSKLRMYELQYKDLEKYRQQFNCEINIVAGDTDSF 2760          
The following BLAST results are available for this feature:
BLAST of Transporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A51.712e-6944.49solute carrier family 6 member 5 [Source:HGNC Symb... [more]
SLC6A93.062e-6944.53solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A94.164e-6946.67solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A94.417e-6946.67solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A96.000e-6946.67solute carrier family 6 member 9 [Source:HGNC Symb... [more]
back to top
BLAST of Transporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snf-31.126e-5839.24Sodium- and chloride-dependent betaine transporter... [more]
mod-51.168e-5435.15Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7][more]
snf-66.380e-5238.43Sodium-dependent acetylcholine transporter [Sourc... [more]
dat-11.189e-5137.84Sodium-dependent dopamine transporter [Source:Uni... [more]
snf-112.755e-4737.66Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
back to top
BLAST of Transporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GlyT2.043e-6141.56gene:FBgn0034911 transcript:FBtr0301162[more]
SerT4.493e-5946.31gene:FBgn0010414 transcript:FBtr0072362[more]
SerT4.493e-5946.31gene:FBgn0010414 transcript:FBtr0343316[more]
DAT2.997e-5842.02gene:FBgn0034136 transcript:FBtr0330002[more]
DAT3.749e-5842.02gene:FBgn0034136 transcript:FBtr0087125[more]
back to top
BLAST of Transporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a94.886e-6845.00solute carrier family 6 member 9 [Source:ZFIN;Acc:... [more]
slc6a95.768e-6845.00solute carrier family 6 member 9 [Source:ZFIN;Acc:... [more]
slc6a96.215e-6845.00solute carrier family 6 member 9 [Source:ZFIN;Acc:... [more]
slc6a98.240e-6845.00solute carrier family 6 member 9 [Source:ZFIN;Acc:... [more]
slc6a51.582e-6542.80solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Transporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4c9.864e-7255.56leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c1.090e-7155.56leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c1.481e-7155.56leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c1.706e-7155.56leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c2.208e-7155.56leucine rich repeat containing 4C [Source:Xenbase;... [more]
back to top
BLAST of Transporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc6a74.332e-7052.13solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a57.418e-7043.07solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a57.418e-7043.07solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a57.418e-7043.07solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a91.613e-6846.22solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of Transporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PGE7|SC6A7_MOUSE2.644e-6952.13Sodium-dependent proline transporter OS=Mus muscul... [more]
sp|Q761V0|SC6A5_MOUSE4.235e-6943.07Sodium- and chloride-dependent glycine transporter... [more]
sp|Q9Y345|SC6A5_HUMAN7.570e-6944.49Sodium- and chloride-dependent glycine transporter... [more]
sp|P58295|SC6A5_RAT7.761e-6940.34Sodium- and chloride-dependent glycine transporter... [more]
sp|P48067|SC6A9_HUMAN1.354e-6844.53Sodium- and chloride-dependent glycine transporter... [more]
back to top
BLAST of Transporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Y2T91.125e-9255.43Transporter OS=Hymenolepis diminuta OX=6216 GN=WMS... [more]
A0A564Y3D81.467e-9255.43Transporter OS=Hymenolepis diminuta OX=6216 GN=WMS... [more]
A0A564Y2N82.743e-9255.43Transporter OS=Hymenolepis diminuta OX=6216 GN=WMS... [more]
A0A564Z4T33.789e-9255.43Transporter OS=Hymenolepis diminuta OX=6216 GN=WMS... [more]
A0A087W1G62.848e-9163.68Transporter OS=Echinococcus multilocularis OX=6211... [more]
back to top
BLAST of Transporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a96.705e-6844.09solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a97.107e-6844.09solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a11b3.938e-6644.25solute carrier family 6 member 11 [Source:NCBI gen... [more]
slc6a36.426e-6347.29solute carrier family 6 member 3 [Source:NCBI gene... [more]
ENSAMXT00000015774.29.259e-6346.86pep primary_assembly:Astyanax_mexicanus-2.0:8:2649... [more]
back to top
BLAST of Transporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001684.16.936e-6251.66pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 ge... [more]
slc6a1a4.502e-6045.50solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
slc6a4b4.397e-4447.34solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000008631.14.220e-3739.53pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 ... [more]
ENSPMAT00000003306.15.055e-3436.92pep scaffold:Pmarinus_7.0:GL476462:11074:20014:-1 ... [more]
back to top
BLAST of Transporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492182.716e-7048.51Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4][more]
EDO315453.503e-6342.13Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0][more]
EDO323562.578e-5943.87Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2][more]
EDO397081.982e-5841.58Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978][more]
EDO289391.896e-5638.46Transporter [Source:UniProtKB/TrEMBL;Acc:A7T524][more]
back to top
BLAST of Transporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a92.013e-6742.68solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a92.973e-6745.05solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a92.973e-6745.05solute carrier family 6 member 9 [Source:NCBI gene... [more]
ENSORLT00000002876.29.066e-6647.14sodium- and chloride-dependent GABA transporter 2 ... [more]
ENSORLT00000002877.21.182e-6547.14sodium- and chloride-dependent GABA transporter 2 ... [more]
back to top
BLAST of Transporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003011.10.000e+0100.00SMESG000003011.1[more]
SMESG000076702.12.142e-13344.49SMESG000076702.1[more]
SMESG000053372.18.135e-12950.23SMESG000053372.1[more]
SMESG000062279.11.696e-12849.06SMESG000062279.1[more]
SMESG000072420.18.371e-12441.23SMESG000072420.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001440 ID=SMED30001440|Name=Transporter|organism=Schmidtea mediterranea sexual|type=transcript|length=3337bp
GTAAATCAATTTCTATAAAATTTAAAACTTTAAAATTAATATATAAATTT
TCTTTATATTATTGAGCAATTAATCTACTCTGTTAGTTCGAAATGAATTT
AAATAAAAAAGGAAATTCACCTGAAAAAATACCTGATCAACAAATTGTTA
TTGATAGTCGACCACTTAAGCATATTACGTTGAGTGATCGTATTTTATTG
ACAAAAGAATCGTTGAATTTACCCACAGAAACGATCGGCTCAGAAGGAGA
AGTTTACAAGATAACATATGGAGATCAGAAACTTGAACGAGGCGAATGGG
GTGGGAAAATCGATTTCATTTTTACCTGCATTAGTTTTGCAGTTGGTTTG
GGAAATGTGTGGCGCTTTCCATATTTAGTATATAAAAATGGCGGAGGAGC
CTTTCTTATTCCGTATTGTCTCATGTTGATGTGCGTTGGTCTGCCTATTT
TTTTCCTCGAATTCGCAATCGGACAATTTTCCAGTCTTGGACCTATATCT
TGCTGGATAATCAGTCCTCTTTTCAAAGGAGTTGGCTATGGAATGGTAAT
CATAACCTGGTATCTGACCCTCTATTACAATGTGATAGTTGCACATTGTG
TTTTCTATCTGTTTTCCAGCTTTACAAGTAAATTGCCATGGAGCACTTGT
GGTAATTATTGGAATGATAATACAACTTGTTTTGACGGATCTAATAATAC
TATCCACTTATTGGCTATCGAAAATAAGATATCTGCTACTGAGCAGTATT
ACGAAAAATACGTTTTGGAAGTATCTAAGGGAATAGAGGATTTTGGCCTA
CCATCATGGAAGTTGCTACTGTGTTTATTATTAAGCTGGATAATCGTAAC
AGCAGTTCTTCTCAAGGGAGTCAGTTCTCTTGGCAAGGAGTGCATTCCTT
CCCGGAGCTGGACAAGGCATAAAATATTATCTGACTCCCCAGTTCTATCG
ACTTTCCGATCCAAATGTGTGGACTGACGCTGCTACTCAAATATTCTTCT
CTCTCTCGTGCTGCAGTGGTGGACTGATCAACATGGCAAGTTACAACAAA
TTCAAGAACAATTGTTGTCGGTAATATTTGTATAATTTGTTTAATTGCTT
TCATATATTTAAGGAAACCCTAGATGATCAAAGATCTTTATAGTGTAATA
ATAGCCCTGCATATTAATATATTAACTAAATTTTCAAATTAAATTACCAC
TATTTAAAGGTAACTAATCTCGATCGAATGCTCAATTTTAGAAATAGAGT
GGAAGGAGTTAGAATTCAATCTCATTGGTGCCACATGTGTCTTCATGATT
TCTAAAAGACATGGGTATTTGTAAGAAAAATATGTAGCATACAACATGCC
CCATAGAATAAATATATTGAATTTAAAGACTGGAGTAAAACTATAAAACA
GCAATTTGTTGTCTATGCAGGCTTTGAATCGGTATTACCTCCAGATGATA
AATATTTCCAAAAACATAAACCGATTGCAGCAAAATTTGTACTTCTTCAT
CAGGGAAATCCAATCCGGAATGAAACATTTGTTGGCGACAATTGTATCGT
TCAGTTCATGTAGGCGTTGAATGATATATCTGCAGAAATAGTTTACCCAT
GGTATAAAATTAATGGTAAAAAGGAAATGATACAACTCACTCGTGAACAA
GAAGAATTCACCAACCAAACCTTAGCAAAAAGATTATAAATATGCTTGTT
CACGATCATGCACATTTTACAGGTCAATATCATGGTACAGCATGCCAAGA
TTGTAATTTGGTTAGAAGAATCAATCCGACTCTGCCAGTCGTATTTCACA
ATCCTCGCGGTTATGATATTCATCATTTCTTAAAATGTGCTTTTGGAAAA
TTTTCCGAATTGAATTTAAATGTTATTCCTCAATCAACAGAAAAGTTTCT
CACACTTACAGTAACAACAAAAGGAAGAAGAATTTGATTCATTGATTCCC
TGCAATTCTTAAATAGTAGTTTGGTAAATTTATCAAAAAACGTACGAAAT
GTTCCAATTACTTCAAAGGTTTTCATATCTGGTAAGGGTATTTTTCCTTA
TGATATTGTTACCTCAATGGAGGTATTATAATCAACAGCTGAACTACCGC
CAATTTGGTCAAGATTTAATCAAATAGAATATATGCATGCCAATCAAATA
TGGCAACAATACAACTGTAAGACACTTTTAGGTTACTTGTTAGTATATAT
TAAGTTCAATATTTTTCTGTTGGCTGATGATTTTGAAGCATTCAAAGACA
AAACATTTGTTGGAGATGGATTGGAAGCTGTTTCTTTCGTTTCTATACCA
GGATTGAGTTGAGCTTCAGCTGTTAAACAATTATCTGAATCGGTAGAGCT
AATTCAAGATCCGGAATTTTCTGATTATTTGAAACAGGAATTCGTGGTGG
AATGACATTTATCAACAAATATCATCTTGAGTCAGATGATACAACTCAAA
TGGCATACCAAGATGTTAAAAATTTATATGGATGGGCTTATTTCAGATGG
TTAGAAGATCAGACTGAAATGGATTATATTATTAAAAGATGTGGGAGCGG
AGATGAGTTTTATGGAGATCATGTTTATCTTTTAAAGGTAGACATTGTGA
TTCCTGACAATATTCAAGATAAATTGGATGATTTGCCCATTGCACCTGAA
CTTAGTTATCCATCTGGCAGTAAAGTCGAGAAACTTTTATTAACACATGA
ACCAAAGACCAATTATGTGATTAATGGTAGGATTTGAATGAGTGGTTATG
CTATGGTGTAGTAATTTCAAAAGTCAATCGTGTTGTAGAGCTTACGCAGG
TAGCCATTTTCAAAAAAATATATCGATTACTATACCAAAATGAGAGCAGC
CAGTACAGATCCTTTTTAGCGAGATTATTGTAAGTTAAAGAACAATAGTT
TGTACAGAAAAACTGTTGAAAATTTTGATAAAACGTAAAAGCCTAAGATT
ATGTATCAACAGTAAAAGACTGATAATTTACAGCAGTAATCATATGTTCC
AGCGTAGTATCAAGATTGCTGATGATCTAATTGCAGTTTTACTTTTCAAA
GAAATAGTATGATTGGATAGACCAATGTATATTGGAAAAACCGTTCTTGA
TTTATCCAAACTTCGAGATGAATTCAATTGCTAAATAAACATCGTAGCTG
GTGACACTGACTCCTTTATAGACTTACGCGTATTATTTATTGTTAATAAT
TACATTATAATTAATTTTAGTGATCATTTTTCCAAATTCATTTATAGAAT
AAGTAATATTCTTTTGTTCTAATAAAATATTAATAAAATGTAATAAATTA
AATAAATAAATAAAAATAATAAATTATTGAAACTGAT
back to top

protein sequence of SMED30001440-orf-1

>SMED30001440-orf-1 ID=SMED30001440-orf-1|Name=SMED30001440-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=295bp
MNLNKKGNSPEKIPDQQIVIDSRPLKHITLSDRILLTKESLNLPTETIGS
EGEVYKITYGDQKLERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNG
GGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYG
MVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGS
NNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKLLLCLLLSWI
IVTAVLLKGVSSLGKECIPSRSWTRHKILSDSPVLSTFRSKCVD*
back to top

protein sequence of SMED30001440-orf-2

>SMED30001440-orf-2 ID=SMED30001440-orf-2|Name=SMED30001440-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
MTFINKYHLESDDTTQMAYQDVKNLYGWAYFRWLEDQTEMDYIIKRCGSG
DEFYGDHVYLLKVDIVIPDNIQDKLDDLPIAPELSYPSGSKVEKLLLTHE
PKTNYVINGRI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037272SNS_sf
IPR000175Na/ntran_symport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006836neurotransmitter transport
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005328neurotransmitter:sodium symporter activity
GO:0015293symporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000175Sodium:neurotransmitter symporterPRINTSPR00176NANEUSMPORTcoord: 74..95
score: 64.83
coord: 103..122
score: 53.11
coord: 146..172
score: 39.47
IPR000175Sodium:neurotransmitter symporterPFAMPF00209SNFcoord: 66..265
e-value: 5.4E-76
score: 256.4
IPR000175Sodium:neurotransmitter symporterPANTHERPTHR11616SODIUM/CHLORIDE DEPENDENT TRANSPORTERcoord: 58..265
IPR000175Sodium:neurotransmitter symporterPROSITEPS00610NA_NEUROTRAN_SYMP_1coord: 90..104
IPR000175Sodium:neurotransmitter symporterPROSITEPS50267NA_NEUROTRAN_SYMP_3coord: 65..265
score: 37.864
NoneNo IPR availablePANTHERPTHR11616:SF231SODIUM-DEPENDENT PROLINE TRANSPORTERcoord: 58..265
NoneNo IPR availableTMHMMTMhelixcoord: 73..95
NoneNo IPR availableTMHMMTMhelixcoord: 152..174
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
IPR037272Sodium:neurotransmitter symporter superfamilySUPERFAMILYSSF161070SNF-likecoord: 66..269