SMED30001437

Overview
NameSMED30001437
Smed IDSMED30001437
Length (bp)2043
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30001437 (SMED30001437) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30001437 (SMED30001437) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001437 (SMED30001437) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001437 (SMED30001437) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001437

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30001437SMESG000056307.1 PL06009A2D07_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30001437 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.004490:9761..11852 -10109
Homology
BLAST of SMED30001437 vs. Ensembl Human
Match: OCRL (OCRL inositol polyphosphate-5-phosphatase [Source:HGNC Symbol;Acc:HGNC:8108])

HSP 1 Score: 168.703 bits (426), Expect = 4.541e-43
Identity = 142/547 (25.96%), Postives = 255/547 (46.62%), Query Frame = -1
Query:  148 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRT----------IPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLD-----------RIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQAR-LSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFI 1707
            G+ L +F RK        ++ ++   TV  G +G M NKG +++ F     T C +N HL A  E+ ERR    + +  ++     N+T  + +N ++ +  VV   GDLN+RL    A+ V   I  NK K +  L+KFD+L + R     + +F E +I F+PTYK+   +D ++S    RVP++CDRILW G +   ++Y+S+ E   SDHKP+S  F I ++    R   K+F+             +P + +      F +V F +    + +I+N G V    +F   +   +    W    P    LEP ++  +   +++    V+  N   +K    I+   +  G D  LT +  Y  + FG  L  L  + RPI      ++I +E    ++     +    LD           + I++L+  + F +   ++ + + P    +++++I  ++  T I  T P    + +     E ++IF+++LP+P+I + +  R L S Y+ R     V+  LP+ +    R L+ +L   +
Sbjct:  321 GMMLLIFARKDQ----CRYIRDIATETVGTGIMGKMGNKGGVAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQ-LNIMKHE--VVIWLGDLNYRLCMPDANEVKSLI--NK-KDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSGKCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIE-DILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIWLLVDHL-FKYACHQEDLFQTPGMQEELQQIIDCLD--TSIPETIPGSNHSVA-----EALLIFLEALPEPVICYELYQRCLDSAYDPR-ICRQVISQLPRCHRNVFRYLMAFLRELL 847          
BLAST of SMED30001437 vs. Ensembl Human
Match: OCRL (OCRL inositol polyphosphate-5-phosphatase [Source:HGNC Symbol;Acc:HGNC:8108])

HSP 1 Score: 166.007 bits (419), Expect = 3.674e-42
Identity = 143/547 (26.14%), Postives = 254/547 (46.44%), Query Frame = -1
Query:  148 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRT----------IPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLD-----------RIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQAR-LSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFI 1707
            G+ L +F RK        ++ ++   TV  G +G M NKG +++ F     T C +N HL A  E+ ERR    + +  ++     N+T  + +N ++ +  VV   GDLN+RL    A+ V   I  NK K +  L+KFD+L + R     + +F E +I F+PTYK+   +D ++S    RVP++CDRILW G +   ++Y+S+ E   SDHKP+S  F I ++    R   K+F+             +P + +      F +V F +    + +I+N G V    +F   +   +    W    P    LEP ++  +   +++    V+  N   +K    I+   +  G D  LT +  Y  + FG  L  L  + RPI      ++I +E S         +    LD           + I++L+  + F +   ++ + + P    +++++I  ++  T I  T P    + +     E ++IF+++LP+P+I + +  R L S Y+ R     V+  LP+ +    R L+ +L   +
Sbjct:  321 GMMLLIFARKDQ----CRYIRDIATETVGTGIMGKMGNKGGVAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQ-LNIMKHE--VVIWLGDLNYRLCMPDANEVKSLI--NK-KDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSGKCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIE-DILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEKS--------LLQMVPLDEGASERPLQVPKEIWLLVDHL-FKYACHQEDLFQTPGMQEELQQIIDCLD--TSIPETIPGSNHSVA-----EALLIFLEALPEPVICYELYQRCLDSAYDPR-ICRQVISQLPRCHRNVFRYLMAFLRELL 839          
BLAST of SMED30001437 vs. Ensembl Human
Match: INPP5B (inositol polyphosphate-5-phosphatase B [Source:HGNC Symbol;Acc:HGNC:6077])

HSP 1 Score: 147.517 bits (371), Expect = 2.586e-36
Identity = 143/585 (24.44%), Postives = 249/585 (42.56%), Query Frame = -1
Query:   34 VFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKM-PTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRF-----IDRPIDTYTPKEIIQIESSKNIKSFT--IFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTH--METIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGF---ILKPS-----DIEIIANFVVSCIPPSNPSLKNPLVSVIAFLTEK 1692
            + L  Y+ +  A ++S +   TV  G +G M NKG ++I F+    +IC +N HL A  E  ERR    + +  ++Q  Q + +         ++ DV+   GDLN+R++ L    V + I+    K    L  +D+L +      +++ F E ++ F PTYK+   SD +++    R P++CDRILW G +   +SYQS+     SDHKP+S  F I +R  +  L  K  +             IP + +      F +V +M+ +  E    + G V     F      +     W    PS   L P     +   +F++    +  N   +K    I+   +  G D  L+ +  Y  + FG  +  L +     +D P++T +   ++ + +  +       + I   L   + Y+    +Q      ++ + + P  +    E I+   DT  ID          S S H   E +++F++SLP+P+I +           +      V+  LP    +F + + HYL  F   +LK S     D  I+A+   S +      L+NP       +TEK
Sbjct:  183 IMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICSRMQFCQPDPSLPP---LTISNHDVILWLGDLNYRIEELDVEKVKKLIEE---KDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDELYRKTLEEIVRSLDKMENANIPSVSLSKREFCFQNVKYMQ-LKVESFTIHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVNKMTATKLNSGEDKIE-DILVLHLDRGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILDLPLETISELTLMPVWTGDDGSQLDSPMEIPKELWMMVDYLYRNAVQ------QEDLFQQP-GLRSEFEHIRDCLDTGMID--------NLSASNHSVAEALLLFLESLPEPVICYSTYHNCLECSGNYTASKQVISTLP----IFHKNVFHYLMAFLRELLKNSAKNHLDENILASIFGSLL------LRNPAGHQKLDMTEK 734          
BLAST of SMED30001437 vs. Ensembl Human
Match: INPP5B (inositol polyphosphate-5-phosphatase B [Source:HGNC Symbol;Acc:HGNC:6077])

HSP 1 Score: 147.517 bits (371), Expect = 4.216e-36
Identity = 143/585 (24.44%), Postives = 249/585 (42.56%), Query Frame = -1
Query:   34 VFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKK-MPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRF-----IDRPIDTYTPKEIIQIESSKNIKSFT--IFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTH--METIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGF---ILKPS-----DIEIIANFVVSCIPPSNPSLKNPLVSVIAFLTEK 1692
            + L  Y+ +  A ++S +   TV  G +G M NKG ++I F+    +IC +N HL A  E  ERR    + +  ++Q  Q + +         ++ DV+   GDLN+R++ L    V + I+    K    L  +D+L +      +++ F E ++ F PTYK+   SD +++    R P++CDRILW G +   +SYQS+     SDHKP+S  F I +R  +  L  K  +             IP + +      F +V +M+ +  E    + G V     F      +     W    PS   L P     +   +F++    +  N   +K    I+   +  G D  L+ +  Y  + FG  +  L +     +D P++T +   ++ + +  +       + I   L   + Y+    +Q      ++ + + P  +    E I+   DT  ID          S S H   E +++F++SLP+P+I +           +      V+  LP    +F + + HYL  F   +LK S     D  I+A+   S +      L+NP       +TEK
Sbjct:  347 IMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICSRMQFCQPDPSLPP---LTISNHDVILWLGDLNYRIEELDVEKVKKLIEE---KDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDELYRKTLEEIVRSLDKMENANIPSVSLSKREFCFQNVKYMQ-LKVESFTIHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVNKMTATKLNSGEDKIE-DILVLHLDRGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILDLPLETISELTLMPVWTGDDGSQLDSPMEIPKELWMMVDYLYRNAVQ------QEDLFQQP-GLRSEFEHIRDCLDTGMID--------NLSASNHSVAEALLLFLESLPEPVICYSTYHNCLECSGNYTASKQVISTLP----IFHKNVFHYLMAFLRELLKNSAKNHLDENILASIFGSLL------LRNPAGHQKLDMTEK 898          
BLAST of SMED30001437 vs. Ensembl Human
Match: INPP5B (inositol polyphosphate-5-phosphatase B [Source:HGNC Symbol;Acc:HGNC:6077])

HSP 1 Score: 146.362 bits (368), Expect = 1.119e-35
Identity = 143/585 (24.44%), Postives = 249/585 (42.56%), Query Frame = -1
Query:   34 VFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKM-PTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRF-----IDRPIDTYTPKEIIQIESSKNIKSFT--IFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTH--METIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGF---ILKPS-----DIEIIANFVVSCIPPSNPSLKNPLVSVIAFLTEK 1692
            + L  Y+ +  A ++S +   TV  G +G M NKG ++I F+    +IC +N HL A  E  ERR    + +  ++Q  Q + +         ++ DV+   GDLN+R++ L    V + I+    K    L  +D+L +      +++ F E ++ F PTYK+   SD +++    R P++CDRILW G +   +SYQS+     SDHKP+S  F I +R  +  L  K  +             IP + +      F +V +M+ +  E    + G V     F      +     W    PS   L P     +   +F++    +  N   +K    I+   +  G D  L+ +  Y  + FG  +  L +     +D P++T +   ++ + +  +       + I   L   + Y+    +Q      ++ + + P  +    E I+   DT  ID          S S H   E +++F++SLP+P+I +           +      V+  LP    +F + + HYL  F   +LK S     D  I+A+   S +      L+NP       +TEK
Sbjct:  427 IMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICSRMQFCQPDPSLPP---LTISNHDVILWLGDLNYRIEELDVEKVKKLIEE---KDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDELYRKTLEEIVRSLDKMENANIPSVSLSKREFCFQNVKYMQ-LKVESFTIHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVNKMTATKLNSGEDKIE-DILVLHLDRGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILDLPLETISELTLMPVWTGDDGSQLDSPMEIPKELWMMVDYLYRNAVQ------QEDLFQQP-GLRSEFEHIRDCLDTGMID--------NLSASNHSVAEALLLFLESLPEPVICYSTYHNCLECSGNYTASKQVISTLP----IFHKNVFHYLMAFLRELLKNSAKNHLDENILASIFGSLL------LRNPAGHQKLDMTEK 978          
BLAST of SMED30001437 vs. Ensembl Celegans
Match: ocrl-1 (OCRL (Lowe's oculocerebrorenal syndrome protein) homolog [Source:UniProtKB/TrEMBL;Acc:A5Z2U3])

HSP 1 Score: 106.686 bits (265), Expect = 1.142e-23
Identity = 100/411 (24.33%), Postives = 179/411 (43.55%), Query Frame = -1
Query:  619 LSLFVFLRKYLNKVIANHVSNLLVGTVPIGTL----GMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEA------DIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELI---VLRETDA---LYKNFFE-AQIDFLPTYKFVINSDAY---ESKRVPSYCDRILWMGNSCLNISYQSYPE--------------FLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKK----MPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQ-IICASILNGADTPLTFNAKYHLNIFGLHLGVL 1704
            + +FV + + +N  +   VS++ V  V  G       + NKG  ++S ++ +  +CF+N H  AG   LERR    + +   +  +  ++    +   LE       D DVVF FGDLN+RL     +  +  I  ++V+ I    KF +L+    LRE  A   ++K+F E + + F PTYK+   ++ +   E  RVP++ DRIL         +++ YP+                 SDHKP+   F + ++  +   +N +++             +P++++    +DFG V +++  T    + NVG   V  +FK   + +        W  + P+   +    S  +   + I +  V      I     Q I+   + NG D  +   A Y+ + FG  L  L
Sbjct:  177 VGIFVIVFQAVNSKV--RVSDVNVKYVATGISVLVNKLGNKGGTAVSMKMNDTWVCFVNAHFAAGNNELERRNQDFRDIYNDMVFYPRSQQEGLRDRPLEVPIMCLYDHDVVFWFGDLNYRL-----NTDMYGISNDEVRRIASSDKFADLLQHCQLREQMARGTVFKDFEEPSTLPFRPTYKYDCGTNTWDTSEKGRVPAWTDRIL---------TFKKYPQVGLESIRPMVSIDTITISDHKPVRAMFNLKVKKINESGANNVYEEAIREADRRANEELPQVQLSLNEVDFGIVNYLEPKTRSVIVQNVGKSKVRFSFKVRPNARNNQEICEKWLMVTPTHYQIPQGSSMEISLTVSISTDIVRRIQDLIRNGQLQEILVLHLENGRDYFIPITAVYNNSCFGSTLEKL 571          
BLAST of SMED30001437 vs. Ensembl Celegans
Match: unc-26 (Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5ECL2])

HSP 1 Score: 88.1965 bits (217), Expect = 4.716e-19
Identity = 68/231 (29.44%), Postives = 111/231 (48.05%), Query Frame = -1
Query: 1048 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGM-ANKGALSISFRIGEFT--ICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILW-----MGNSCLNISYQSYPEFLFSDHKPISGDFLID 1707
            G+ LF+F R      ++ ++ +  V +V  G  G   NKG  S++FRI  F+  ICFI  H  AG+  +  R       ++K++     +  S          DV+F  GD N+R+ NL+   V  +++        +L++ D+L   +     +  F E Q+ F PTYK+   SD Y++    R P++ DRILW      G + L +SY    E   SDH+P+   F ++
Sbjct:  627 GVCLFLFARPR----VSPYLKDFAVASVKTGMGGATGNKG--SVAFRIVVFSTSICFICSHFAAGQNEIRDRNEDFATTLKKIRFPLGREIDSH---------DVIFWLGDFNYRI-NLSGDEVKNAVRNGDYA---KLVENDQLTQQKALGQTFVGFNEGQLTFAPTYKYDTFSDDYDTSEKCRAPAWTDRILWKDQRKKGKTQL-LSYDR-SELKTSDHRPVGAVFKVE 836          

HSP 2 Score: 26.1794 bits (56), Expect = 4.716e-19
Identity = 21/78 (26.92%), Postives = 33/78 (42.31%), Query Frame = -3
Query: 1757 LTETQYENTFLGTFLVRVCSYNVNCKFSKNEMYEKWL-----------KDEKSPDIIAIGFQELYFKLVDIVAPDTIQ 1957
            + E Q    F+GT+ V       N  F        W+           +DE+  DI+AIG +E    LVD+ A + ++
Sbjct:  521 IAEPQSIKIFVGTWNVNGGKNIHNVAFRNESSLSHWIFANSMTRLVSVEDEQLADIVAIGVEE----LVDLNASNMVK 594          
BLAST of SMED30001437 vs. Ensembl Celegans
Match: unc-26 (Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5ECL2])

HSP 1 Score: 88.1965 bits (217), Expect = 4.756e-19
Identity = 68/231 (29.44%), Postives = 111/231 (48.05%), Query Frame = -1
Query: 1048 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGM-ANKGALSISFRIGEFT--ICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILW-----MGNSCLNISYQSYPEFLFSDHKPISGDFLID 1707
            G+ LF+F R      ++ ++ +  V +V  G  G   NKG  S++FRI  F+  ICFI  H  AG+  +  R       ++K++     +  S          DV+F  GD N+R+ NL+   V  +++        +L++ D+L   +     +  F E Q+ F PTYK+   SD Y++    R P++ DRILW      G + L +SY    E   SDH+P+   F ++
Sbjct:  621 GVCLFLFARPR----VSPYLKDFAVASVKTGMGGATGNKG--SVAFRIVVFSTSICFICSHFAAGQNEIRDRNEDFATTLKKIRFPLGREIDSH---------DVIFWLGDFNYRI-NLSGDEVKNAVRNGDYA---KLVENDQLTQQKALGQTFVGFNEGQLTFAPTYKYDTFSDDYDTSEKCRAPAWTDRILWKDQRKKGKTQL-LSYDR-SELKTSDHRPVGAVFKVE 830          

HSP 2 Score: 26.1794 bits (56), Expect = 4.756e-19
Identity = 21/78 (26.92%), Postives = 33/78 (42.31%), Query Frame = -3
Query: 1757 LTETQYENTFLGTFLVRVCSYNVNCKFSKNEMYEKWL-----------KDEKSPDIIAIGFQELYFKLVDIVAPDTIQ 1957
            + E Q    F+GT+ V       N  F        W+           +DE+  DI+AIG +E    LVD+ A + ++
Sbjct:  515 IAEPQSIKIFVGTWNVNGGKNIHNVAFRNESSLSHWIFANSMTRLVSVEDEQLADIVAIGVEE----LVDLNASNMVK 588          
BLAST of SMED30001437 vs. Ensembl Celegans
Match: inpp-1 (INositol Polyphosphate-5-Phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EBY9])

HSP 1 Score: 83.9593 bits (206), Expect = 6.331e-17
Identity = 68/226 (30.09%), Postives = 110/226 (48.67%), Query Frame = -1
Query: 1045 LFVFLR-KYLNKVIANHVSNLLVGTV--PIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKV--KAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESKRVPSYCDRIL-WMGNS--CLNISYQSYPEFLFSDHKPISGDFLIDI 1698
            + VF+R K+L   I   VS +  G +  P+ T     KGA+++  R+ +  I  I CHL       ++R      V++ L+  Q  +  +   + +    DVV   GDLNFR+   T  + ++     K+  K   ++ + +EL   R+    + +F EA I F PT+KF  ++D Y  KR+PS+ DR+L W+ NS    NI Y        SDHK +   F + +
Sbjct:  171 VIVFIRQKHLRYAIQPQVSFIASGAMAKPVRT-----KGAIAVCLRLYQRFIVLIGCHL--SHATPQQRIQDYAKVVRTLRFPQLARFHAHAKDEIFGS-DVVLWIGDLNFRV---TVESNVDWRDPEKITEKTFRDVFETEELASHRKKQLAFTDFKEAPIKFPPTHKFEPDTDNYVPKRIPSFTDRVLFWVRNSEWLQNIQYDCMRGTTPSDHKAVFATFWLTV 385          
BLAST of SMED30001437 vs. Ensembl Celegans
Match: inpp-1 (INositol Polyphosphate-5-Phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EBY9])

HSP 1 Score: 83.9593 bits (206), Expect = 6.703e-17
Identity = 68/226 (30.09%), Postives = 110/226 (48.67%), Query Frame = -1
Query: 1045 LFVFLR-KYLNKVIANHVSNLLVGTV--PIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKV--KAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESKRVPSYCDRIL-WMGNS--CLNISYQSYPEFLFSDHKPISGDFLIDI 1698
            + VF+R K+L   I   VS +  G +  P+ T     KGA+++  R+ +  I  I CHL       ++R      V++ L+  Q  +  +   + +    DVV   GDLNFR+   T  + ++     K+  K   ++ + +EL   R+    + +F EA I F PT+KF  ++D Y  KR+PS+ DR+L W+ NS    NI Y        SDHK +   F + +
Sbjct:  182 VIVFIRQKHLRYAIQPQVSFIASGAMAKPVRT-----KGAIAVCLRLYQRFIVLIGCHL--SHATPQQRIQDYAKVVRTLRFPQLARFHAHAKDEIFGS-DVVLWIGDLNFRV---TVESNVDWRDPEKITEKTFRDVFETEELASHRKKQLAFTDFKEAPIKFPPTHKFEPDTDNYVPKRIPSFTDRVLFWVRNSEWLQNIQYDCMRGTTPSDHKAVFATFWLTV 396          
BLAST of SMED30001437 vs. Ensembl Fly
Match: Ocrl (gene:FBgn0023508 transcript:FBtr0070317)

HSP 1 Score: 145.976 bits (367), Expect = 2.336e-38
Identity = 102/393 (25.95%), Postives = 183/393 (46.56%), Query Frame = -1
Query:  565 LFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYES---KRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDAS----RRLSNKLFKP------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKF-NCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQI 1698
            L V +RK L +    H+      +V  G    + NKG ++IS ++ E  ICF+N HL A    +E R     A+++ ++   ++  R+       +D D +F  GDLN+R+Q          +   +   +  L+++D+L         ++ + E +I F PTYK+   +D Y+S   +R P+YCDR+LW G     ++Y S  E   SDHKP+   F + ++       +R+  ++ K          P+I +E T++DFG V F +  T +  + N   + V+ +FK          W  + P    L    +++++ ++  +   ++   R I    N  I+   + NG D  +T    Y  + FGL +  +   DRP+  Y+  +I Q+
Sbjct:  274 LTVIVRKQLRQ----HIIRCRPKSVARGIFNTLGNKGGVAISLQLNEGNICFVNSHLAAHMGYVEERNQDYNAIVEGIR---FDDGRTI------SDHDHIFWVGDLNYRIQEPPGQQRPGPLSDAQTYEL--LLQYDQLRQEMRRGKCFEGYTEGEIKFRPTYKYDPGTDNYDSSEKQRAPAYCDRVLWKGTRIEQLAYNSIMEIRQSDHKPVYAVFQVKVKTRDEVKYKRVQEEVLKAVDKRENDNQPQINVEKTVIDFGTVRFNEPSTRDFNVYNNCPLPVDFSFKEKDIHAICEPWLHVDPRQDSLLIDSARSIRLKMNANVRTIAGLLRKIRASDNFDILILHVENGRDIFITVTGDYQPSCFGLSMETMCRTDRPLSEYSQDQIKQL 651          

HSP 2 Score: 33.4982 bits (75), Expect = 2.336e-38
Identity = 26/89 (29.21%), Postives = 41/89 (46.07%), Query Frame = -3
Query: 1721 GSEESTLTETQYENTFLGTFLVRVCSYNVN---CKFSKNEMYEKWLK-DEKSPDIIAIGFQELYFKLVDIVAPDTIQNVDIAPHKRWLD 1975
            G  +  L + + E       ++   ++NVN   C  S N +   WL   EK PDI AIG QEL      ++    +Q ++    K+W+D
Sbjct:  166 GEVKQELKKRESEYIVYKDIIIYCATWNVNNKTCSDSNNPL-RAWLACSEKPPDIYAIGLQELDTPTKAMLNSTQVQAIE----KQWID 249          
BLAST of SMED30001437 vs. Ensembl Fly
Match: Ocrl (gene:FBgn0023508 transcript:FBtr0332586)

HSP 1 Score: 145.976 bits (367), Expect = 2.336e-38
Identity = 102/393 (25.95%), Postives = 183/393 (46.56%), Query Frame = -1
Query:  565 LFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYES---KRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDAS----RRLSNKLFKP------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKF-NCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQI 1698
            L V +RK L +    H+      +V  G    + NKG ++IS ++ E  ICF+N HL A    +E R     A+++ ++   ++  R+       +D D +F  GDLN+R+Q          +   +   +  L+++D+L         ++ + E +I F PTYK+   +D Y+S   +R P+YCDR+LW G     ++Y S  E   SDHKP+   F + ++       +R+  ++ K          P+I +E T++DFG V F +  T +  + N   + V+ +FK          W  + P    L    +++++ ++  +   ++   R I    N  I+   + NG D  +T    Y  + FGL +  +   DRP+  Y+  +I Q+
Sbjct:  274 LTVIVRKQLRQ----HIIRCRPKSVARGIFNTLGNKGGVAISLQLNEGNICFVNSHLAAHMGYVEERNQDYNAIVEGIR---FDDGRTI------SDHDHIFWVGDLNYRIQEPPGQQRPGPLSDAQTYEL--LLQYDQLRQEMRRGKCFEGYTEGEIKFRPTYKYDPGTDNYDSSEKQRAPAYCDRVLWKGTRIEQLAYNSIMEIRQSDHKPVYAVFQVKVKTRDEVKYKRVQEEVLKAVDKRENDNQPQINVEKTVIDFGTVRFNEPSTRDFNVYNNCPLPVDFSFKEKDIHAICEPWLHVDPRQDSLLIDSARSIRLKMNANVRTIAGLLRKIRASDNFDILILHVENGRDIFITVTGDYQPSCFGLSMETMCRTDRPLSEYSQDQIKQL 651          

HSP 2 Score: 33.4982 bits (75), Expect = 2.336e-38
Identity = 26/89 (29.21%), Postives = 41/89 (46.07%), Query Frame = -3
Query: 1721 GSEESTLTETQYENTFLGTFLVRVCSYNVN---CKFSKNEMYEKWLK-DEKSPDIIAIGFQELYFKLVDIVAPDTIQNVDIAPHKRWLD 1975
            G  +  L + + E       ++   ++NVN   C  S N +   WL   EK PDI AIG QEL      ++    +Q ++    K+W+D
Sbjct:  166 GEVKQELKKRESEYIVYKDIIIYCATWNVNNKTCSDSNNPL-RAWLACSEKPPDIYAIGLQELDTPTKAMLNSTQVQAIE----KQWID 249          
BLAST of SMED30001437 vs. Ensembl Fly
Match: CG9784 (gene:FBgn0030761 transcript:FBtr0074289)

HSP 1 Score: 103.99 bits (258), Expect = 4.294e-23
Identity = 78/259 (30.12%), Postives = 130/259 (50.19%), Query Frame = -1
Query:  967 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGM-ANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQID-FLPTYKFVINSDAYESKRVPSYCDRILW----------MGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTI 1707
            GL L +F+R+        H+ ++       G  G+  NKGA+S+ F +    + F+  HL A    ++ R   ++   Q L+ H Y+  R ++I     D D VF FGDLNFRLQ   +S  +  +  ++ +    LI+ D+L  +RE   L     + ++  F PT+KF   +  Y+ KR P++ DRI++          M  S    SY+S+P +  SDHKP++ DF I +   + R    +F P ++ +I  E+T+
Sbjct:  123 GLLLSMFVRRQH----VEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDER---IEDYKQILENHHYHVKRYREI----YDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQH-EALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKFREGTSEYDLKRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPLYTISDHKPVTSDFTIKLY-PNVRAPGVVFSPLSLWKIGDENTV 368          
BLAST of SMED30001437 vs. Ensembl Fly
Match: CG9784 (gene:FBgn0030761 transcript:FBtr0310319)

HSP 1 Score: 103.99 bits (258), Expect = 4.294e-23
Identity = 78/259 (30.12%), Postives = 130/259 (50.19%), Query Frame = -1
Query:  967 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGM-ANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQID-FLPTYKFVINSDAYESKRVPSYCDRILW----------MGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTI 1707
            GL L +F+R+        H+ ++       G  G+  NKGA+S+ F +    + F+  HL A    ++ R   ++   Q L+ H Y+  R ++I     D D VF FGDLNFRLQ   +S  +  +  ++ +    LI+ D+L  +RE   L     + ++  F PT+KF   +  Y+ KR P++ DRI++          M  S    SY+S+P +  SDHKP++ DF I +   + R    +F P ++ +I  E+T+
Sbjct:  123 GLLLSMFVRRQH----VEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDER---IEDYKQILENHHYHVKRYREI----YDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQH-EALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKFREGTSEYDLKRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPLYTISDHKPVTSDFTIKLY-PNVRAPGVVFSPLSLWKIGDENTV 368          
BLAST of SMED30001437 vs. Ensembl Fly
Match: CG9784 (gene:FBgn0030761 transcript:FBtr0330409)

HSP 1 Score: 103.99 bits (258), Expect = 4.368e-23
Identity = 78/259 (30.12%), Postives = 130/259 (50.19%), Query Frame = -1
Query:  967 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGM-ANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQID-FLPTYKFVINSDAYESKRVPSYCDRILW----------MGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTI 1707
            GL L +F+R+        H+ ++       G  G+  NKGA+S+ F +    + F+  HL A    ++ R   ++   Q L+ H Y+  R ++I     D D VF FGDLNFRLQ   +S  +  +  ++ +    LI+ D+L  +RE   L     + ++  F PT+KF   +  Y+ KR P++ DRI++          M  S    SY+S+P +  SDHKP++ DF I +   + R    +F P ++ +I  E+T+
Sbjct:  123 GLLLSMFVRRQH----VEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDER---IEDYKQILENHHYHVKRYREI----YDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQH-EALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKFREGTSEYDLKRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPLYTISDHKPVTSDFTIKLY-PNVRAPGVVFSPLSLWKIGDENTV 368          
BLAST of SMED30001437 vs. Ensembl Zebrafish
Match: inpp5b (inositol polyphosphate-5-phosphatase B [Source:ZFIN;Acc:ZDB-GENE-110411-228])

HSP 1 Score: 175.252 bits (443), Expect = 1.792e-45
Identity = 134/525 (25.52%), Postives = 233/525 (44.38%), Query Frame = -1
Query:  148 YLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFI 1677
            Y+    A H+S +   TV  G +G M NKGA+SI F+     IC +N HL A  E  ERR    + + +++Q  Q + T    +  L+ +I  V   GDLN+R+ +L    V + I     K    L  +D+L    + + ++  F E +IDF PTYK+   SD +++    RVP++CDRILW G S   + YQS+     SDHKP+S    I I+  +     + F+             IP + +      F DV FM++      + N G V  +  F + +        W T  P+   L    S  +   +F++ H     N  +++    I+   +  G D  ++    Y  + FG  L  L  +  PI     + I ++    N            + + I++++  + F +   ++ + + P  +    E I+   DT  +D T P    + +     E +++F+ +LP+P+IPF    +     +D  H   ++  LP+ +    + + +YL  F+
Sbjct:  339 YVKAEHAPHISEVEAETVGTGVMGRMGNKGAVSIRFQFHNSDICVVNSHLAAHTEEFERRNQDFKDICRRIQFRQEDPTLPP-LTILKHNI--VLWLGDLNYRISDLEVDHVKDLISK---KDFETLHTYDQLKRQMDEEVVFVGFTEGEIDFQPTYKYDTGSDQWDTSEKCRVPAWCDRILWRGKSIKQLHYQSHMTLKTSDHKPVSSLLEIGIKVVNEESYKRTFEEIVRQIDRLENDCIPSVSLSEREFHFQDVKFMQHQARTVTVHNDGQVPCQFEFIQKLDEPAYCKPWLTANPAKGFLAQGASVDIDLEVFVNRHTAPELNAGLQQLE-DILVLHLERGKDYFISITGSYLPSCFGSSLSALCLLREPIQDMPLESIRELSVKSNSPVIDSADKPQEIPKEIWMMVDHL-FRYAKKQEDLFQQP-GLRSEFEEIRDCLDTGCLD-TLPGSNHSVA-----EALLLFLDALPEPVIPFSFYQQCLDCCSDSSHCRQIISMLPQCH----KNVFNYLTAFL 844          
BLAST of SMED30001437 vs. Ensembl Zebrafish
Match: ocrl (OCRL inositol polyphosphate-5-phosphatase [Source:ZFIN;Acc:ZDB-GENE-061110-61])

HSP 1 Score: 147.517 bits (371), Expect = 2.491e-36
Identity = 133/568 (23.42%), Postives = 253/568 (44.54%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTIL----------DFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLD-------RIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI------PPSN 1707
            G+ L V+++K     I   +++  VGT  +  +G  NKG +++ F     + CF+N HL A  ++ ERR    + +  ++  H         +       DVV   GDLN+RL    A  V   I   +++ + E   +D+L + R+T  ++ +F E +I+F+PTYK+   SD ++S    R+P++CDRILW G++   + Y+S+ E   SDHKP+S  F I ++    +   K+F+       R+E+  L           F +V F +       ITN G V     F   +   +    W    P    L+P +   +   +++    V+  N   +     I+   +  G D  +T +  Y  + FG  L  L  + +PI      ++I +E ++     T  + S   +       + +++L+  +       ED + + P   ++++ +I  ++  T I  + P    + +     E ++IF+++LP+P++ + +  R     +D      ++  LP+ +    R L+ +L   +    D  + AN + +        PP N
Sbjct:  371 GMMLVVYIKKEHKDQI-REIASESVGTGLMNKMG--NKGGVAVRFVFHNTSFCFVNSHLAAHVDDFERRNQDYKDICARMSFHLLEYPPVSIVKH-----DVVIWLGDLNYRLCLPDAGEVKRLIAEKELRRLQE---YDQLNLQRKTKRVFTDFMEGEINFIPTYKYDAKSDRWDSSGKCRIPAWCDRILWRGSNVKQLHYRSHMELKTSDHKPVSSVFSIGVKMVIEQRYKKIFEEIVRDMDRMENDFLPSLSLTRREFTFENVKFRQLQRQSFLITNDGQVACTFAFIPKLNDSQYCKPWLRAEPCEGVLDPNEKIEIFLEVYVSKDSVTLLNSGEDNIE-DILVLHLDRGKDYFITVSGNYLPSCFGTSLETLCRMKKPIREIPITKLIDLEKAR----MTFLLDSAGTEDKPLKIPKEVWLLVNHLYTKACQQED-LFQTPGLQDELQSIIDCLD--TSIPDSIPGCNHSVA-----EALLIFLEALPEPVLCYELFQRCLECSHDSRLCKQLISQLPRAHRNVFRYLMAFLRELLKHSIDNNLNANLLATLFASLLIRPPPN 914          
BLAST of SMED30001437 vs. Ensembl Zebrafish
Match: ocrl (OCRL inositol polyphosphate-5-phosphatase [Source:ZFIN;Acc:ZDB-GENE-061110-61])

HSP 1 Score: 147.517 bits (371), Expect = 2.491e-36
Identity = 133/568 (23.42%), Postives = 253/568 (44.54%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTIL----------DFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLD-------RIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI------PPSN 1707
            G+ L V+++K     I   +++  VGT  +  +G  NKG +++ F     + CF+N HL A  ++ ERR    + +  ++  H         +       DVV   GDLN+RL    A  V   I   +++ + E   +D+L + R+T  ++ +F E +I+F+PTYK+   SD ++S    R+P++CDRILW G++   + Y+S+ E   SDHKP+S  F I ++    +   K+F+       R+E+  L           F +V F +       ITN G V     F   +   +    W    P    L+P +   +   +++    V+  N   +     I+   +  G D  +T +  Y  + FG  L  L  + +PI      ++I +E ++     T  + S   +       + +++L+  +       ED + + P   ++++ +I  ++  T I  + P    + +     E ++IF+++LP+P++ + +  R     +D      ++  LP+ +    R L+ +L   +    D  + AN + +        PP N
Sbjct:  371 GMMLVVYIKKEHKDQI-REIASESVGTGLMNKMG--NKGGVAVRFVFHNTSFCFVNSHLAAHVDDFERRNQDYKDICARMSFHLLEYPPVSIVKH-----DVVIWLGDLNYRLCLPDAGEVKRLIAEKELRRLQE---YDQLNLQRKTKRVFTDFMEGEINFIPTYKYDAKSDRWDSSGKCRIPAWCDRILWRGSNVKQLHYRSHMELKTSDHKPVSSVFSIGVKMVIEQRYKKIFEEIVRDMDRMENDFLPSLSLTRREFTFENVKFRQLQRQSFLITNDGQVACTFAFIPKLNDSQYCKPWLRAEPCEGVLDPNEKIEIFLEVYVSKDSVTLLNSGEDNIE-DILVLHLDRGKDYFITVSGNYLPSCFGTSLETLCRMKKPIREIPITKLIDLEKAR----MTFLLDSAGTEDKPLKIPKEVWLLVNHLYTKACQQED-LFQTPGLQDELQSIIDCLD--TSIPDSIPGCNHSVA-----EALLIFLEALPEPVLCYELFQRCLECSHDSRLCKQLISQLPRAHRNVFRYLMAFLRELLKHSIDNNLNANLLATLFASLLIRPPPN 914          
BLAST of SMED30001437 vs. Ensembl Zebrafish
Match: ocrl (OCRL inositol polyphosphate-5-phosphatase [Source:ZFIN;Acc:ZDB-GENE-061110-61])

HSP 1 Score: 147.132 bits (370), Expect = 3.496e-36
Identity = 133/568 (23.42%), Postives = 253/568 (44.54%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTIL----------DFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLD-------RIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI------PPSN 1707
            G+ L V+++K     I   +++  VGT  +  +G  NKG +++ F     + CF+N HL A  ++ ERR    + +  ++  H         +       DVV   GDLN+RL    A  V   I   +++ + E   +D+L + R+T  ++ +F E +I+F+PTYK+   SD ++S    R+P++CDRILW G++   + Y+S+ E   SDHKP+S  F I ++    +   K+F+       R+E+  L           F +V F +       ITN G V     F   +   +    W    P    L+P +   +   +++    V+  N   +     I+   +  G D  +T +  Y  + FG  L  L  + +PI      ++I +E ++     T  + S   +       + +++L+  +       ED + + P   ++++ +I  ++  T I  + P    + +     E ++IF+++LP+P++ + +  R     +D      ++  LP+ +    R L+ +L   +    D  + AN + +        PP N
Sbjct:  383 GMMLVVYIKKEHKDQI-REIASESVGTGLMNKMG--NKGGVAVRFVFHNTSFCFVNSHLAAHVDDFERRNQDYKDICARMSFHLLEYPPVSIVKH-----DVVIWLGDLNYRLCLPDAGEVKRLIAEKELRRLQE---YDQLNLQRKTKRVFTDFMEGEINFIPTYKYDAKSDRWDSSGKCRIPAWCDRILWRGSNVKQLHYRSHMELKTSDHKPVSSVFSIGVKMVIEQRYKKIFEEIVRDMDRMENDFLPSLSLTRREFTFENVKFRQLQRQSFLITNDGQVACTFAFIPKLNDSQYCKPWLRAEPCEGVLDPNEKIEIFLEVYVSKDSVTLLNSGEDNIE-DILVLHLDRGKDYFITVSGNYLPSCFGTSLETLCRMKKPIREIPITKLIDLEKAR----MTFLLDSAGTEDKPLKIPKEVWLLVNHLYTKACQQED-LFQTPGLQDELQSIIDCLD--TSIPDSIPGCNHSVA-----EALLIFLEALPEPVLCYELFQRCLECSHDSRLCKQLISQLPRAHRNVFRYLMAFLRELLKHSIDNNLNANLLATLFASLLIRPPPN 926          
BLAST of SMED30001437 vs. Ensembl Zebrafish
Match: ocrl (OCRL inositol polyphosphate-5-phosphatase [Source:ZFIN;Acc:ZDB-GENE-061110-61])

HSP 1 Score: 144.821 bits (364), Expect = 1.970e-35
Identity = 133/568 (23.42%), Postives = 247/568 (43.49%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTIL----------DFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMP-KIQFDFKSFEDVILRDPCNIND------VRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI------PPSN 1707
            G+ L V+++K     I   +++  VGT  +  +G  NKG +++ F     + CF+N HL A  ++ ERR    + +  ++  H         +       DVV   GDLN+RL    A  V   I   +++ + E   +D+L + R+T  ++ +F E +I+F+PTYK+   SD ++S    R+P++CDRILW G++   + Y+S+ E   SDHKP+S  F I ++    +   K+F+       R+E+  L           F +V F +       ITN G V     F   +   +    W    P    L+P +   +   +++    V+  N   +     I+   +  G D  +T +  Y  + FG  L  L  + +PI      ++I +     ++     +T  LLD       P KI  +     + +    C   D      +++ ++ + D     +   +     S++   E ++IF+++LP+P++ + +  R     +D      ++  LP+ +    R L+ +L   +    D  + AN + +        PP N
Sbjct:  371 GMMLVVYIKKEHKDQI-REIASESVGTGLMNKMG--NKGGVAVRFVFHNTSFCFVNSHLAAHVDDFERRNQDYKDICARMSFHLLEYPPVSIVKH-----DVVIWLGDLNYRLCLPDAGEVKRLIAEKELRRLQE---YDQLNLQRKTKRVFTDFMEGEINFIPTYKYDAKSDRWDSSGKCRIPAWCDRILWRGSNVKQLHYRSHMELKTSDHKPVSSVFSIGVKMVIEQRYKKIFEEIVRDMDRMENDFLPSLSLTRREFTFENVKFRQLQRQSFLITNDGQVACTFAFIPKLNDSQYCKPWLRAEPCEGVLDPNEKIEIFLEVYVSKDSVTLLNSGEDNIE-DILVLHLDRGKDYFITVSGNYLPSCFGTSLETLCRMKKPIREIPITKLIDLGEDSCMEKEKARMT-FLLDSAGTEDKPLKIPKEVWLLVNHLYTKACQQEDLFQTPGLQDELQSIIDCLDTSIPDSIPGCNHSVA---EALLIFLEALPEPVLCYELFQRCLECSHDSRLCKQLISQLPRAHRNVFRYLMAFLRELLKHSIDNNLNANLLATLFASLLIRPPPN 922          
BLAST of SMED30001437 vs. Ensembl Xenopus
Match: hes5.2 (hairy and enhancer of split 5, gene 2 [Source:Xenbase;Acc:XB-GENE-876635])

HSP 1 Score: 176.407 bits (446), Expect = 1.031e-45
Identity = 145/569 (25.48%), Postives = 260/569 (45.69%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADI---DVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTILD----------FGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSK----NIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI------PPSN 1707
            G+ + VF +    K    H+  ++  +V  G +G M NKG +++ F     + CF+N HL A  E+ ERR    + +  +L     ++      N   ++I   DVV   GDLN+RL    A+ V   I  N ++    L+K+D+L + RE   ++ +F E  I+F+PTYKF   +D ++S    RVP++CDR+LW G +   + Y+S+ E   SDHKP+S  F I ++    R   K F+       R+E+  L           F  V F +    + +I N G V    +F   +   +    W    P    LEP+++  +   +++    V+  N + +K    I+   +  G D  LT +  Y ++ FG  L  L  + RPI      ++I +E +      ++S         + + I++L+  +  +    ED + + P    +++++I  ++  T I  T P    + +     E ++IF+++LP+P+I + +  R     +D      V+  LP+ +    R L+ +L   +    D  + AN + +        PP N
Sbjct:  328 GMMMLVFAKHEHFK----HIREVVAESVGTGIMGKMGNKGGVAVRFVFHNTSFCFVNSHLAAHVEDFERRNQDYKDICARLNFTVPDQ------NIPISNIMKHDVVIWLGDLNYRLCKFDAAEVKSLIAKNDIQT---LLKYDQLNIQREMKNVFSDFTEGTINFIPTYKFDAKTDRWDSSGKCRVPAWCDRVLWRGTNITQLKYRSHMELKTSDHKPVSSLFSIGVKVVDERRYRKAFEDIVRMMDRMENEFLPSLNLSRREFVFERVRFRQLQKEKFQIKNDGQVTCHFSFIPKLNDTQYCKPWLRAEPCEGYLEPEETVDISLEVYVSKDSVTMLNSEEDKIE-DILVLHLDRGKDYFLTISGSYLVSCFGTSLEALCRMKRPIREIPVTKLIDLEKAALQMLPLESDETADKPMKIPKEIWLLVDHLYKNACRQED-LFQTPGKQEELQQIIDCLD--TSIPETIPGSNHSVA-----EALLIFLEALPEPVICYELYQRCIDCSHDTRLCRQVISQLPRCHRNVFRYLMAFLRELLKYTGDNNLSANMIATVFTSLLLRPPPN 874          
BLAST of SMED30001437 vs. Ensembl Xenopus
Match: hes5.2 (hairy and enhancer of split 5, gene 2 [Source:Xenbase;Acc:XB-GENE-876635])

HSP 1 Score: 175.637 bits (444), Expect = 1.045e-45
Identity = 149/573 (26.00%), Postives = 258/573 (45.03%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADI---DVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTILD----------FGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDV------RELIKRVNDTTKIDLTFPLEKTTFSLSTH--METIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI------PPSN 1707
            G+ + VF +    K    H+  ++  +V  G +G M NKG +++ F     + CF+N HL A  E+ ERR    + +  +L     ++      N   ++I   DVV   GDLN+RL    A+ V   I  N ++    L+K+D+L + RE   ++ +F E  I+F+PTYKF   +D ++S    RVP++CDR+LW G +   + Y+S+ E   SDHKP+S  F I ++    R   K F+       R+E+  L           F  V F +    + +I N G V    +F   +   +    W    P    LEP+++  +   +++    V+  N + +K    I+   +  G D  LT +  Y ++ FG  L  L  + RPI      ++I + S +      + + S   D      M KI  +     D + ++ C   D+      +E ++++ D   +D + P    T   S H   E ++IF+++LP+P+I + +  R     +D      V+  LP+ +    R L+ +L   +    D  + AN + +        PP N
Sbjct:  177 GMMMLVFAKHEHFK----HIREVVAESVGTGIMGKMGNKGGVAVRFVFHNTSFCFVNSHLAAHVEDFERRNQDYKDICARLNFTVPDQ------NIPISNIMKHDVVIWLGDLNYRLCKFDAAEVKSLIAKNDIQT---LLKYDQLNIQREMKNVFSDFTEGTINFIPTYKFDAKTDRWDSSGKCRVPAWCDRVLWRGTNITQLKYRSHMELKTSDHKPVSSLFSIGVKVVDERRYRKAFEDIVRMMDRMENEFLPSLNLSRREFVFERVRFRQLQKEKFQIKNDGQVTCHFSFIPKLNDTQYCKPWLRAEPCEGYLEPEETVDISLEVYVSKDSVTMLNSEEDKIE-DILVLHLDRGKDYFLTISGSYLVSCFGTSLEALCRMKRPIREIPVTKLIDLVSKEKAALQMLPLES---DETADKPM-KIPKEIWLLVDHLYKNACRQEDLFQTPGKQEELQQIIDC--LDTSIP---ETIPGSNHSVAEALLIFLEALPEPVICYELYQRCIDCSHDTRLCRQVISQLPRCHRNVFRYLMAFLRELLKYTGDNNLSANMIATVFTSLLLRPPPN 726          
BLAST of SMED30001437 vs. Ensembl Xenopus
Match: hes5.2 (hairy and enhancer of split 5, gene 2 [Source:Xenbase;Acc:XB-GENE-876635])

HSP 1 Score: 174.866 bits (442), Expect = 2.583e-45
Identity = 147/574 (25.61%), Postives = 256/574 (44.60%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADI---DVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTILD----------FGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMP-KIQFDFKSFEDVILRDPCNINDV------RELIKRVNDTTKIDLTFPLEKTTFSLSTH--METIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI------PPSN 1707
            G+ + VF +    K    H+  ++  +V  G +G M NKG +++ F     + CF+N HL A  E+ ERR    + +  +L     ++      N   ++I   DVV   GDLN+RL    A+ V   I  N ++    L+K+D+L + RE   ++ +F E  I+F+PTYKF   +D ++S    RVP++CDR+LW G +   + Y+S+ E   SDHKP+S  F I ++    R   K F+       R+E+  L           F  V F +    + +I N G V    +F   +   +    W    P    LEP+++  +   +++    V+  N + +K    I+   +  G D  LT +  Y ++ FG  L  L  + RPI      ++I +      +     +    L+       P KI  +     D + ++ C   D+      +E ++++ D   +D + P    T   S H   E ++IF+++LP+P+I + +  R     +D      V+  LP+ +    R L+ +L   +    D  + AN + +        PP N
Sbjct:  248 GMMMLVFAKHEHFK----HIREVVAESVGTGIMGKMGNKGGVAVRFVFHNTSFCFVNSHLAAHVEDFERRNQDYKDICARLNFTVPDQ------NIPISNIMKHDVVIWLGDLNYRLCKFDAAEVKSLIAKNDIQT---LLKYDQLNIQREMKNVFSDFTEGTINFIPTYKFDAKTDRWDSSGKCRVPAWCDRVLWRGTNITQLKYRSHMELKTSDHKPVSSLFSIGVKVVDERRYRKAFEDIVRMMDRMENEFLPSLNLSRREFVFERVRFRQLQKEKFQIKNDGQVTCHFSFIPKLNDTQYCKPWLRAEPCEGYLEPEETVDISLEVYVSKDSVTMLNSEEDKIE-DILVLHLDRGKDYFLTISGSYLVSCFGTSLEALCRMKRPIREIPVTKLIDLGEDSFSEKEKAALQMLPLESDETADKPMKIPKEIWLLVDHLYKNACRQEDLFQTPGKQEELQQIIDC--LDTSIP---ETIPGSNHSVAEALLIFLEALPEPVICYELYQRCIDCSHDTRLCRQVISQLPRCHRNVFRYLMAFLRELLKYTGDNNLSANMIATVFTSLLLRPPPN 802          
BLAST of SMED30001437 vs. Ensembl Xenopus
Match: hes5.2 (hairy and enhancer of split 5, gene 2 [Source:Xenbase;Acc:XB-GENE-876635])

HSP 1 Score: 174.866 bits (442), Expect = 2.919e-45
Identity = 147/574 (25.61%), Postives = 256/574 (44.60%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADI---DVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTILD----------FGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMP-KIQFDFKSFEDVILRDPCNINDV------RELIKRVNDTTKIDLTFPLEKTTFSLSTH--METIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI------PPSN 1707
            G+ + VF +    K    H+  ++  +V  G +G M NKG +++ F     + CF+N HL A  E+ ERR    + +  +L     ++      N   ++I   DVV   GDLN+RL    A+ V   I  N ++    L+K+D+L + RE   ++ +F E  I+F+PTYKF   +D ++S    RVP++CDR+LW G +   + Y+S+ E   SDHKP+S  F I ++    R   K F+       R+E+  L           F  V F +    + +I N G V    +F   +   +    W    P    LEP+++  +   +++    V+  N + +K    I+   +  G D  LT +  Y ++ FG  L  L  + RPI      ++I +      +     +    L+       P KI  +     D + ++ C   D+      +E ++++ D   +D + P    T   S H   E ++IF+++LP+P+I + +  R     +D      V+  LP+ +    R L+ +L   +    D  + AN + +        PP N
Sbjct:  275 GMMMLVFAKHEHFK----HIREVVAESVGTGIMGKMGNKGGVAVRFVFHNTSFCFVNSHLAAHVEDFERRNQDYKDICARLNFTVPDQ------NIPISNIMKHDVVIWLGDLNYRLCKFDAAEVKSLIAKNDIQT---LLKYDQLNIQREMKNVFSDFTEGTINFIPTYKFDAKTDRWDSSGKCRVPAWCDRVLWRGTNITQLKYRSHMELKTSDHKPVSSLFSIGVKVVDERRYRKAFEDIVRMMDRMENEFLPSLNLSRREFVFERVRFRQLQKEKFQIKNDGQVTCHFSFIPKLNDTQYCKPWLRAEPCEGYLEPEETVDISLEVYVSKDSVTMLNSEEDKIE-DILVLHLDRGKDYFLTISGSYLVSCFGTSLEALCRMKRPIREIPVTKLIDLGEDSFSEKEKAALQMLPLESDETADKPMKIPKEIWLLVDHLYKNACRQEDLFQTPGKQEELQQIIDC--LDTSIP---ETIPGSNHSVAEALLIFLEALPEPVICYELYQRCIDCSHDTRLCRQVISQLPRCHRNVFRYLMAFLRELLKYTGDNNLSANMIATVFTSLLLRPPPN 829          
BLAST of SMED30001437 vs. Ensembl Xenopus
Match: hes5.2 (hairy and enhancer of split 5, gene 2 [Source:Xenbase;Acc:XB-GENE-876635])

HSP 1 Score: 174.866 bits (442), Expect = 3.219e-45
Identity = 147/574 (25.61%), Postives = 256/574 (44.60%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADI---DVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTILD----------FGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMP-KIQFDFKSFEDVILRDPCNINDV------RELIKRVNDTTKIDLTFPLEKTTFSLSTH--METIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI------PPSN 1707
            G+ + VF +    K    H+  ++  +V  G +G M NKG +++ F     + CF+N HL A  E+ ERR    + +  +L     ++      N   ++I   DVV   GDLN+RL    A+ V   I  N ++    L+K+D+L + RE   ++ +F E  I+F+PTYKF   +D ++S    RVP++CDR+LW G +   + Y+S+ E   SDHKP+S  F I ++    R   K F+       R+E+  L           F  V F +    + +I N G V    +F   +   +    W    P    LEP+++  +   +++    V+  N + +K    I+   +  G D  LT +  Y ++ FG  L  L  + RPI      ++I +      +     +    L+       P KI  +     D + ++ C   D+      +E ++++ D   +D + P    T   S H   E ++IF+++LP+P+I + +  R     +D      V+  LP+ +    R L+ +L   +    D  + AN + +        PP N
Sbjct:  266 GMMMLVFAKHEHFK----HIREVVAESVGTGIMGKMGNKGGVAVRFVFHNTSFCFVNSHLAAHVEDFERRNQDYKDICARLNFTVPDQ------NIPISNIMKHDVVIWLGDLNYRLCKFDAAEVKSLIAKNDIQT---LLKYDQLNIQREMKNVFSDFTEGTINFIPTYKFDAKTDRWDSSGKCRVPAWCDRVLWRGTNITQLKYRSHMELKTSDHKPVSSLFSIGVKVVDERRYRKAFEDIVRMMDRMENEFLPSLNLSRREFVFERVRFRQLQKEKFQIKNDGQVTCHFSFIPKLNDTQYCKPWLRAEPCEGYLEPEETVDISLEVYVSKDSVTMLNSEEDKIE-DILVLHLDRGKDYFLTISGSYLVSCFGTSLEALCRMKRPIREIPVTKLIDLGEDSFSEKEKAALQMLPLESDETADKPMKIPKEIWLLVDHLYKNACRQEDLFQTPGKQEELQQIIDC--LDTSIP---ETIPGSNHSVAEALLIFLEALPEPVICYELYQRCIDCSHDTRLCRQVISQLPRCHRNVFRYLMAFLRELLKYTGDNNLSANMIATVFTSLLLRPPPN 820          
BLAST of SMED30001437 vs. Ensembl Mouse
Match: Ocrl (OCRL, inositol polyphosphate-5-phosphatase [Source:MGI Symbol;Acc:MGI:109589])

HSP 1 Score: 175.637 bits (444), Expect = 1.722e-45
Identity = 154/575 (26.78%), Postives = 270/575 (46.96%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRI--RIESTILDFGDV----FFMKNVTCEK------EITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLD-----------RIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI-------PPSN 1707
            G+ L +F RK   + I + V+    GT  +G +G  NKG +++ F     T C +N HL A  E  ERR    + +  ++     N+T   ++N ++ D  VV   GDLN+RL    AS V   I  N+   +++L+KFD+L + R     + +F E +I+F+PTYK+   +D ++S    RVP++CDRILW G +   + Y+S+ E   SDHKP+S  F I ++    R   K+F+   I RI  R+E+  L   ++    FF +NV   +      +I+N G V    +F   +   +    W    P    LEP ++  +   +++    V+  N   +K    I+   +  G D  LT    Y  + FG  L  L  + RPI      ++I +E    ++     +    LD           + I++L+  + F +   ++ + + P    +++++I  ++  T I  T P    + +     E ++IF+++LP+P+I + +  R     +D      V+  LP+ +    R L+ +L   +LK SD   I   +++ +       PP N
Sbjct:  320 GMMLLIFARKDQCQYIRD-VATETTGTGIMGKMG--NKGGVAVRFVFHNTTFCIVNSHLAAHVEEFERRNQDYKDICARMTFSVPNQT-VPQVNIMKHD--VVIWLGDLNYRLCMPDASEVKSLINKNE---LHKLLKFDQLNIQRTQKKAFADFNEGEINFVPTYKYDSKTDRWDSSGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFE--DIVRIMDRMENDFLPSLELSRREFFFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETLDISLDVYVSKDSVTILNSGEDKIE-DILVLHLDRGKDYFLTIGGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSYLEKEKSLLQMVPLDEGTSERPLQVPKEIWLLVDHL-FKYACHQEDLFQTPGMQEELQQIIDCLD--TSIPETIPGNNHSVA-----EALLIFLEALPEPVICYELYQRCLDSAHDPRICKQVISQLPRCHRNVFRYLMAFLRE-LLKFSDYNNINTNMIATLFSSLLLRPPPN 873          
BLAST of SMED30001437 vs. Ensembl Mouse
Match: Ocrl (OCRL, inositol polyphosphate-5-phosphatase [Source:MGI Symbol;Acc:MGI:109589])

HSP 1 Score: 154.836 bits (390), Expect = 5.307e-39
Identity = 120/399 (30.08%), Postives = 194/399 (48.62%), Query Frame = -1
Query:  559 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRI--RIESTILDFGDV----FFMKNVTCEK------EITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIES 1707
            G+ L +F RK   + I + V+    GT  +G +G  NKG +++ F     T C +N HL A  E  ERR    + +  ++     N+T   ++N ++ D  VV   GDLN+RL    AS V   I  N+   +++L+KFD+L + R     + +F E +I+F+PTYK+   +D ++S    RVP++CDRILW G +   + Y+S+ E   SDHKP+S  F I ++    R   K+F+   I RI  R+E+  L   ++    FF +NV   +      +I+N G V    +F   +   +    W    P    LEP ++  +   +++    V+  N   +K    I+   +  G D  LT    Y  + FG  L  L  + RPI      ++I +E 
Sbjct:  320 GMMLLIFARKDQCQYIRD-VATETTGTGIMGKMG--NKGGVAVRFVFHNTTFCIVNSHLAAHVEEFERRNQDYKDICARMTFSVPNQT-VPQVNIMKHD--VVIWLGDLNYRLCMPDASEVKSLINKNE---LHKLLKFDQLNIQRTQKKAFADFNEGEINFVPTYKYDSKTDRWDSSGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFE--DIVRIMDRMENDFLPSLELSRREFFFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETLDISLDVYVSKDSVTILNSGEDKIE-DILVLHLDRGKDYFLTIGGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEE 706          
BLAST of SMED30001437 vs. Ensembl Mouse
Match: Inpp5b (inositol polyphosphate-5-phosphatase B [Source:MGI Symbol;Acc:MGI:103257])

HSP 1 Score: 147.132 bits (370), Expect = 4.221e-36
Identity = 124/497 (24.95%), Postives = 212/497 (42.66%), Query Frame = -1
Query:  274 VFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSK-KINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKK---MPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNIND------VRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPF 1692
            + L  Y+ +  A ++S +   TV  G +G M NKG ++I F++   +IC +N HL A  E  ERR    + +  ++Q  Q + ++    IN      DV+   GDLN+R++ L    V + ++    KA   L   D+L +      ++  F E +I F PTYK+   SD +++    R P++CDRILW G +   +SYQS+     SDHKP+S  F I +R  +  L  K  +             IP + +      F +V +M+  T   E   + +  V   F+ I    +      W T  PS   L P     ++  +F++    +  N   +     I+   +  G D  L+ +  Y  + FG  +  L ++  PI              K +   T+    T  DR       +I  +     D + R+     D      +R     + D     +   L     S++   E +++F++SLP+P+I +
Sbjct:  427 IMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQLHNTSICVVNSHLAAHTEEYERRNQDYRDICSRMQFPQVDPSQPPLTIN----KHDVILWLGDLNYRIEELDVGKVKKLVEE---KAFQTLYAHDQLKIQVAARTIFDGFTEGEITFQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNEELYRKTLEEIVRSLDKMENANIPSVTLSKREFCFENVKYMQLQT---ESFTIHNSQVPCQFEFINKPDEESYCKQWLTARPSKGFLLPDSHVEIELELFVNKSTATKLNSGKDTIE-DILVLHLERGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILDLP---------LKTVSDLTLMSVQTADDRSQLENPMEIPKELWMMVDYLYRNAVQQEDLFQQPGLRPEFDHIRDCLDTGMIDQLCANNHSVA---EALLLFLESLPEPVICY 900          
BLAST of SMED30001437 vs. Ensembl Mouse
Match: Inpp5b (inositol polyphosphate-5-phosphatase B [Source:MGI Symbol;Acc:MGI:103257])

HSP 1 Score: 140.969 bits (354), Expect = 3.129e-34
Identity = 104/383 (27.15%), Postives = 173/383 (45.17%), Query Frame = -1
Query:  598 VFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSK-KINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKK---MPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPI 1692
            + L  Y+ +  A ++S +   TV  G +G M NKG ++I F++   +IC +N HL A  E  ERR    + +  ++Q  Q + ++    IN      DV+   GDLN+R++ L    V + ++    KA   L   D+L +      ++  F E +I F PTYK+   SD +++    R P++CDRILW G +   +SYQS+     SDHKP+S  F I +R  +  L  K  +             IP + +      F +V +M+  T   E   + +  V   F+ I    +      W T  PS   L P     ++  +F++    +  N   +     I+   +  G D  L+ +  Y  + FG  +  L ++  PI
Sbjct:  427 IMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQLHNTSICVVNSHLAAHTEEYERRNQDYRDICSRMQFPQVDPSQPPLTIN----KHDVILWLGDLNYRIEELDVGKVKKLVEE---KAFQTLYAHDQLKIQVAARTIFDGFTEGEITFQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNEELYRKTLEEIVRSLDKMENANIPSVTLSKREFCFENVKYMQLQT---ESFTIHNSQVPCQFEFINKPDEESYCKQWLTARPSKGFLLPDSHVEIELELFVNKSTATKLNSGKDTIE-DILVLHLERGKDYFLSVSGNYLPSCFGSPIHTLCYMREPI 798          
BLAST of SMED30001437 vs. Ensembl Mouse
Match: Inpp5j (inositol polyphosphate 5-phosphatase J [Source:MGI Symbol;Acc:MGI:2158663])

HSP 1 Score: 114.005 bits (284), Expect = 5.165e-26
Identity = 76/271 (28.04%), Postives = 137/271 (50.55%), Query Frame = -1
Query:  883 MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYES---KRVPSYCDRILW-----------MGNSCLNI-----SYQSYPEFLFSDHKPISGDFLI------DIRDASRRLSNKLFKP-RTIPRIRIES----TILDFGDVFFMKNVTCEKEITNVGSVHVEV 1605
              NKG +S+        +CF+NCHLPA  +  E+R+   Q +   L L Q+    +  I     D D+VF FGDLNFR+++     V  +I +N+   +++L + D+L + + T  + K F E  ++F PT+KF + ++ Y++   KR P++ DRILW            G     +     SY+S+ E+  SDHKP++  F++      D+      ++++  +P + + R R+E+    +  D+  ++ +    C+  +  V + H EV
Sbjct:  163 WGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTI---LSLQQFQGPGAHGI----LDHDLVFWFGDLNFRIESYDLHFVKFAIDSNQ---LHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPSGGPSPSGRESHRLQVTQHSYRSHMEYTVSDHKPVAAQFILQFAFRDDVPLVRLEVADEWARPEQAVVRYRVETVFARSSWDWIGLYRVGFRHCKDYVAYVWAKHEEV 423          
BLAST of SMED30001437 vs. UniProt/SwissProt
Match: sp|Q6NVF0|OCRL_MOUSE (Inositol polyphosphate 5-phosphatase OCRL OS=Mus musculus OX=10090 GN=Ocrl PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.204e-44
Identity = 154/575 (26.78%), Postives = 270/575 (46.96%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRI--RIESTILDFGDV----FFMKNVTCEK------EITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLD-----------RIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI-------PPSN 1707
            G+ L +F RK   + I + V+    GT  +G +G  NKG +++ F     T C +N HL A  E  ERR    + +  ++     N+T   ++N ++ D  VV   GDLN+RL    AS V   I  N+   +++L+KFD+L + R     + +F E +I+F+PTYK+   +D ++S    RVP++CDRILW G +   + Y+S+ E   SDHKP+S  F I ++    R   K+F+   I RI  R+E+  L   ++    FF +NV   +      +I+N G V    +F   +   +    W    P    LEP ++  +   +++    V+  N   +K    I+   +  G D  LT    Y  + FG  L  L  + RPI      ++I +E    ++     +    LD           + I++L+  + F +   ++ + + P    +++++I  ++  T I  T P    + +     E ++IF+++LP+P+I + +  R     +D      V+  LP+ +    R L+ +L   +LK SD   I   +++ +       PP N
Sbjct:  320 GMMLLIFARKDQCQYIRD-VATETTGTGIMGKMG--NKGGVAVRFVFHNTTFCIVNSHLAAHVEEFERRNQDYKDICARMTFSVPNQT-VPQVNIMKHD--VVIWLGDLNYRLCMPDASEVKSLINKNE---LHKLLKFDQLNIQRTQKKAFADFNEGEINFVPTYKYDSKTDRWDSSGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFE--DIVRIMDRMENDFLPSLELSRREFFFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETLDISLDVYVSKDSVTILNSGEDKIE-DILVLHLDRGKDYFLTIGGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSYLEKEKSLLQMVPLDEGTSERPLQVPKEIWLLVDHL-FKYACHQEDLFQTPGMQEELQQIIDCLD--TSIPETIPGNNHSVA-----EALLIFLEALPEPVICYELYQRCLDSAHDPRICKQVISQLPRCHRNVFRYLMAFLRE-LLKFSDYNNINTNMIATLFSSLLLRPPPN 873          
BLAST of SMED30001437 vs. UniProt/SwissProt
Match: sp|D3ZGS3|OCRL_RAT (Inositol polyphosphate 5-phosphatase OCRL OS=Rattus norvegicus OX=10116 GN=Ocrl PE=1 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.187e-43
Identity = 151/576 (26.22%), Postives = 269/576 (46.70%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRI--RIESTILDFGDV----FFMKNVTCEK------EITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLD-----------RIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI-------PPSN 1707
            G+ L VF +K        ++ ++   TV  G +G M NKG +++ F     T C +N HL A  E  ERR    + +  ++     N+T  + +N ++ D  VV   GDLN+RL    A+ V   I  N+++   +L+KFD+L + R     + +F E +I F+PTYK+   +D ++S    RVP++CDRILW G +   + Y+S+ E   SDHKP+S  F I ++    R   K+F+   I RI  R+E+  L   D+    F  +NV   +      +I+N G V    +F   +   +    W    P    LEP ++  +   +++    V+  N   +K    I+   +  G D  LT +  Y  + FG  L  L  + RPI      ++I +E    ++     +    LD           + I++L+  + F +   ++ + + P    +++++I  ++  T I  T P    + +     E ++IF+++LP+P+I + +  R     +D      V+  LP+ +    R L+ +L   +LK SD   ++  +++ +       PP N
Sbjct:  322 GMMLLVFAKKDQ----CQYIRDIATETVGTGIMGKMGNKGGVAMRFVFHNTTFCIVNSHLAAHVEEFERRNQDYKDICARMSFSVPNQTLPQ-VNIMKHD--VVIWLGDLNYRLCMPDANEVKSLINKNELQ---KLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFE--DIVRIMDRMENDFLPSLDLSRREFMFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDTQYCKPWLRAEPFEGYLEPNETIDISLDVYVSKDSVTILNSGEDKIE-DILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQMVPLDEGTSERPLQVPKEIWLLVDHL-FKYACHQEDLFQTPGMQEELQQIIDCLD--TSIPETIPGSNHSVA-----EALLIFLEALPEPVICYELYQRCLDSAHDPRICKQVISQLPRCHRNVFRYLMAFLRE-LLKFSDYNNVSTNMIATLFTSLLLRPPPN 875          
BLAST of SMED30001437 vs. UniProt/SwissProt
Match: sp|Q01968|OCRL_HUMAN (Inositol polyphosphate 5-phosphatase OCRL OS=Homo sapiens OX=9606 GN=OCRL PE=1 SV=3)

HSP 1 Score: 168.703 bits (426), Expect = 2.181e-42
Identity = 142/547 (25.96%), Postives = 255/547 (46.62%), Query Frame = -1
Query:  148 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRT----------IPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLD-----------RIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQAR-LSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFI 1707
            G+ L +F RK        ++ ++   TV  G +G M NKG +++ F     T C +N HL A  E+ ERR    + +  ++     N+T  + +N ++ +  VV   GDLN+RL    A+ V   I  NK K +  L+KFD+L + R     + +F E +I F+PTYK+   +D ++S    RVP++CDRILW G +   ++Y+S+ E   SDHKP+S  F I ++    R   K+F+             +P + +      F +V F +    + +I+N G V    +F   +   +    W    P    LEP ++  +   +++    V+  N   +K    I+   +  G D  LT +  Y  + FG  L  L  + RPI      ++I +E    ++     +    LD           + I++L+  + F +   ++ + + P    +++++I  ++  T I  T P    + +     E ++IF+++LP+P+I + +  R L S Y+ R     V+  LP+ +    R L+ +L   +
Sbjct:  321 GMMLLIFARKDQ----CRYIRDIATETVGTGIMGKMGNKGGVAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQ-LNIMKHE--VVIWLGDLNYRLCMPDANEVKSLI--NK-KDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSGKCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIE-DILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIWLLVDHL-FKYACHQEDLFQTPGMQEELQQIIDCLD--TSIPETIPGSNHSVA-----EALLIFLEALPEPVICYELYQRCLDSAYDPR-ICRQVISQLPRCHRNVFRYLMAFLRELL 847          
BLAST of SMED30001437 vs. UniProt/SwissProt
Match: sp|Q8K337|I5P2_MOUSE (Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Mus musculus OX=10090 GN=Inpp5b PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.952e-35
Identity = 124/497 (24.95%), Postives = 212/497 (42.66%), Query Frame = -1
Query:  274 VFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSK-KINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKK---MPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNIND------VRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPF 1692
            + L  Y+ +  A ++S +   TV  G +G M NKG ++I F++   +IC +N HL A  E  ERR    + +  ++Q  Q + ++    IN      DV+   GDLN+R++ L    V + ++    KA   L   D+L +      ++  F E +I F PTYK+   SD +++    R P++CDRILW G +   +SYQS+     SDHKP+S  F I +R  +  L  K  +             IP + +      F +V +M+  T   E   + +  V   F+ I    +      W T  PS   L P     ++  +F++    +  N   +     I+   +  G D  L+ +  Y  + FG  +  L ++  PI              K +   T+    T  DR       +I  +     D + R+     D      +R     + D     +   L     S++   E +++F++SLP+P+I +
Sbjct:  427 IMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQLHNTSICVVNSHLAAHTEEYERRNQDYRDICSRMQFPQVDPSQPPLTIN----KHDVILWLGDLNYRIEELDVGKVKKLVEE---KAFQTLYAHDQLKIQVAARTIFDGFTEGEITFQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNEELYRKTLEEIVRSLDKMENANIPSVTLSKREFCFENVKYMQLQT---ESFTIHNSQVPCQFEFINKPDEESYCKQWLTARPSKGFLLPDSHVEIELELFVNKSTATKLNSGKDTIE-DILVLHLERGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILDLP---------LKTVSDLTLMSVQTADDRSQLENPMEIPKELWMMVDYLYRNAVQQEDLFQQPGLRPEFDHIRDCLDTGMIDQLCANNHSVA---EALLLFLESLPEPVICY 900          
BLAST of SMED30001437 vs. UniProt/SwissProt
Match: sp|P32019|I5P2_HUMAN (Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens OX=9606 GN=INPP5B PE=1 SV=4)

HSP 1 Score: 146.362 bits (368), Expect = 5.373e-35
Identity = 143/585 (24.44%), Postives = 249/585 (42.56%), Query Frame = -1
Query:   34 VFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKM-PTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRF-----IDRPIDTYTPKEIIQIESSKNIKSFT--IFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTH--METIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGF---ILKPS-----DIEIIANFVVSCIPPSNPSLKNPLVSVIAFLTEK 1692
            + L  Y+ +  A ++S +   TV  G +G M NKG ++I F+    +IC +N HL A  E  ERR    + +  ++Q  Q + +         ++ DV+   GDLN+R++ L    V + I+    K    L  +D+L +      +++ F E ++ F PTYK+   SD +++    R P++CDRILW G +   +SYQS+     SDHKP+S  F I +R  +  L  K  +             IP + +      F +V +M+ +  E    + G V     F      +     W    PS   L P     +   +F++    +  N   +K    I+   +  G D  L+ +  Y  + FG  +  L +     +D P++T +   ++ + +  +       + I   L   + Y+    +Q      ++ + + P  +    E I+   DT  ID          S S H   E +++F++SLP+P+I +           +      V+  LP    +F + + HYL  F   +LK S     D  I+A+   S +      L+NP       +TEK
Sbjct:  427 IMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICSRMQFCQPDPSLPP---LTISNHDVILWLGDLNYRIEELDVEKVKKLIEE---KDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDELYRKTLEEIVRSLDKMENANIPSVSLSKREFCFQNVKYMQ-LKVESFTIHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVNKMTATKLNSGEDKIE-DILVLHLDRGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILDLPLETISELTLMPVWTGDDGSQLDSPMEIPKELWMMVDYLYRNAVQ------QEDLFQQP-GLRSEFEHIRDCLDTGMID--------NLSASNHSVAEALLLFLESLPEPVICYSTYHNCLECSGNYTASKQVISTLP----IFHKNVFHYLMAFLRELLKNSAKNHLDENILASIFGSLL------LRNPAGHQKLDMTEK 978          
BLAST of SMED30001437 vs. TrEMBL
Match: G4VG34 (Putative ocrl type II inositol 5-phosphatase OS=Schistosoma mansoni OX=6183 GN=Smp_064190 PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 3.722e-55
Identity = 167/558 (29.93%), Postives = 283/558 (50.72%), Query Frame = -1
Query:  118 YLNKVIANHV--SNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKL----QLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLID----IRDASRR------LSNKLFKPRTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSG-KKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFG-LHLGVLRFIDRPIDTYTPKEI---IQIESSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSF------EDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTN-------ILFLRRLLHYLHGFILKPSDIEIIA 1677
            Y++  ++ H+    +    VP G    M NKG + I   I   ++CF+NCHL AG  NL+RR    + + +K+     ++  N  +S +  F+ +D D++F+FGDLN+R+  L + +V +SI     K  + L+K+DEL+ L E   L+  F E  I+F PTYKF +NS+ Y+S    RVPSYCDRI+W G+ C  I Y+S+PEF+ SDHKP+S  F +D    IR A +R      LS  L    ++P+  ++   LDFG V F +  +    +TN+G    +  FK +  G    P W T+ PS   ++   S  ++F+IF++   V   N    + +  I+   + +G D  ++ NA++    FG   + +L     P++  +  E+   I++  S+N   F   + S L+DR  +  +PK  F   +       E  + R     +D+  +I+ + DTT  +  FP    T S+ +    +++F+ +LP+ +IP     +  +   +    +  L +LP  N       I F++R L +        +DI+++A
Sbjct:    4 YISARLSAHLRREEISCQVVPTGVFNVMGNKGGVGIRLTIFNSSLCFVNCHLAAGEANLDRRNQDFREITRKMLFEFPMNSKNSIQSSEKAFI-SDHDIIFVFGDLNYRISGLDSPSVRKSIFE---KDFSSLLKYDELLKLMENRNLFDGFHEPIINFAPTYKFDMNSNVYDSSDKNRVPSYCDRIIWSGDGCKPIIYRSHPEFVCSDHKPVSAYFSVDLRRIIRSAFQRAYESVLLSIDLTTNLSLPQAELDRQELDFGCVHFHELCSQSLTLTNIGL--NDFQFKFLREGVGSFPLWLTVNPSCDTVKQGNSIKLEFQIFVNYKEVYALNSGTIQLS-TIVVLQLEDGKDYFISINAQFIPTSFGLPLILLLSLESEPVNKLSINELHEQIKLARSENSDYFKTKLCS-LVDRKPF-HVPKEIFRLVNHINEYITEPDLFRQMGPSSDIG-IIRDILDTTPANCPFP---ETISVHSITSCLLLFLNTLPESVIPQEFHEKCFNSLANFESAVQALQHLPICNQNLFYYLITFMQRCLTFKEQ---NGTDIDLLA 545          
BLAST of SMED30001437 vs. TrEMBL
Match: A0A183LDZ2 (Rho-GAP domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS2017 PE=4 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 5.589e-54
Identity = 169/569 (29.70%), Postives = 289/569 (50.79%), Query Frame = -1
Query:  118 AGLSLFVFLRKYLNKVIANHV--SNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKL----QLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLID----IRDASRR------LSNKLFKPRTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSG-KKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFG-LHLGVLRFIDRPIDTYTPKEI---IQIESSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSF------EDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTN-------ILFLRRLLHYLHGFILKPSDIEIIA 1710
            AG+ + V    Y++  +++H+    +    VP G    M NKG + I   I   ++CF+NCHL AG  NL+RR    + + +K+     ++  N  +S +  F+ +D D++F+FGDLN+R+  L + +V +SI     K  + L+K+DEL+ L E   L+  F E  I+F PTYKF +NS+ Y+S    RVPSYCDRI+W G+ C  I Y+S+PEF+ SDHKP+S  F +D    IR A +R      LS  L    ++P+  ++   LDFG V F +  +    +TN+G    +  FK +  G    P W ++ PS   ++   S  ++F+IF++   V   N    + +  I+   + +G D  ++ NA++    FG   + +L     P++  +  E+   I++  S+N   F   + S L+DR  +  +PK  F   +       E  + R     +D+  +I+ + DTT  +  FP    T S+ +    +++F+ +LP+ +IP     +  +   +    +  L +LP  N       I F++R L +        +DI+++A
Sbjct:   74 AGIIMIV----YISARLSSHLRREEISCQVVPTGVFNVMGNKGGVGIRLTIFNSSLCFVNCHLAAGEANLDRRNQDFREITRKMLFEFPMNSKNPIQSSEKAFI-SDHDIIFVFGDLNYRISGLDSPSVRKSIFE---KDFSSLLKYDELLKLMENRNLFDGFHEPIINFAPTYKFDMNSNVYDSSDKNRVPSYCDRIIWSGDGCEPIVYRSHPEFVCSDHKPVSAYFSVDLRRIIRSAFQRAYESVLLSIDLTTNLSLPQAELDKQELDFGYVHFHELCSQSLTLTNIG--LNDFQFKFLREGVGSFPPWLSVNPSCDSVKQGISIKLEFQIFVNYKEVYALNSGTIQLST-IVVLQLEDGKDYFISINAQFIPTSFGLPLILLLSLESEPVNKLSVDELQDQIKLARSENSDYFQTKLCS-LIDRNPF-HVPKEIFRLVNHINEYITEPDLFRQMGPSSDI-GIIRDILDTTPANCPFP---ETISVHSITSCLLLFLNTLPESVIPQEFHEKCFNSLANFESAVQALQHLPICNQNLFYYLITFMQRCLTFKEQ---NGTDIDLLA 622          
BLAST of SMED30001437 vs. TrEMBL
Match: A0A0X3PEY3 (Type II inositol 1,4,5-trisphosphate 5-phosphatase (Fragment) OS=Schistocephalus solidus OX=70667 GN=I5P2 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 5.686e-54
Identity = 161/553 (29.11%), Postives = 269/553 (48.64%), Query Frame = -1
Query:  142 AGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLE-ADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAY--ESKRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLG-VLRFIDRPIDTYTPKEIIQ-------------IESS--KNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILK 1710
            AGL L V++ + L      HVS + + +VP G    M NKGA+ +   +   ++CFINCHL AG  N ERR      +++K++  +  +T + +I FL   + D +F FGD+N+R+  LT +  I SI     +    L+K+DEL+ LR +  + ++F E QI F PTYKF I ++ Y     R+PSYCDRILW G     + Y+S+ +F  SDHKP+S  F +  R   R L  K ++            ++P+  + +  ++FG V F         I N G   ++  F T       P W T+ P +  +E   S T+   ++++   ++  +       C II  +++ G D  ++ + ++    FGL L  +L+  D P+ +  P+E +Q              E S  KN KS  +F+    L R++  +M  +       E  + R P   +D   +I+ V DTT  D+  P    + S+ +   +++IF+ +LP+P++P+  Q R  S        +  L  LP    +  + L +YL  F+ +
Sbjct:  113 AGLLLIVYVSRRL--YTRAHVSEICLQSVPTGMFNVMGNKGAVGLRLTVYNSSMCFINCHLAAGVANKERRIQDYSEIMRKMEFER--RTSTGEIQFLRIPEHDQLFFFGDMNYRIVGLTPAENIGSIIR---RTYEPLLKYDELLNLRNSGRIMQSFSEGQITFPPTYKFDILTNTYCLTEGRLPSYCDRILWSGKYVEQLLYRSHGDFRVSDHKPVSAFFKVGSRCVDRFLFAKAYEAVIRSQDLVYNMSLPQAALSTQEVEFGPVRFDDIYQDSIIIRNTGISALQFRF-TQEGAASFPPWLTVTPMSAIVEKDASCTITLDVYVNVDTLTGLHSGTCDLAC-IIVLTLVGGKDYFISVSGQFVPTCFGLPLSLLLKIPDTPVAS-IPRETLQKMFRESRIGDWKEGEPSIIKNAKS-PLFVVPKELYRLLGFIMNHLD------EAELFRQPGQRSDY-PIIRDVLDTTNHDVPIP---ESVSVHSVAYSLLIFLSTLPEPVVPYAFQDRCLSSIASFPQAVQALSCLP----IDYQNLFYYLVSFLRR 640          
BLAST of SMED30001437 vs. TrEMBL
Match: A0A0X3P2F3 (Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Schistocephalus solidus OX=70667 GN=I5P2 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 6.585e-54
Identity = 161/553 (29.11%), Postives = 269/553 (48.64%), Query Frame = -1
Query:  142 AGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLE-ADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAY--ESKRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLG-VLRFIDRPIDTYTPKEIIQ-------------IESS--KNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILK 1710
            AGL L V++ + L      HVS + + +VP G    M NKGA+ +   +   ++CFINCHL AG  N ERR      +++K++  +  +T + +I FL   + D +F FGD+N+R+  LT +  I SI     +    L+K+DEL+ LR +  + ++F E QI F PTYKF I ++ Y     R+PSYCDRILW G     + Y+S+ +F  SDHKP+S  F +  R   R L  K ++            ++P+  + +  ++FG V F         I N G   ++  F T       P W T+ P +  +E   S T+   ++++   ++  +       C II  +++ G D  ++ + ++    FGL L  +L+  D P+ +  P+E +Q              E S  KN KS  +F+    L R++  +M  +       E  + R P   +D   +I+ V DTT  D+  P    + S+ +   +++IF+ +LP+P++P+  Q R  S        +  L  LP    +  + L +YL  F+ +
Sbjct:  124 AGLLLIVYVSRRL--YTRAHVSEICLQSVPTGMFNVMGNKGAVGLRLTVYNSSMCFINCHLAAGVANKERRIQDYSEIMRKMEFER--RTSTGEIQFLRIPEHDQLFFFGDMNYRIVGLTPAENIGSIIR---RTYEPLLKYDELLNLRNSGRIMQSFSEGQITFPPTYKFDILTNTYCLTEGRLPSYCDRILWSGKYVEQLLYRSHGDFRVSDHKPVSAFFKVGSRCVDRFLFAKAYEAVIRSQDLVYNMSLPQAALSTQEVEFGPVRFDDIYQDSIIIRNTGISALQFRF-TQEGAASFPPWLTVTPMSAIVEKDASCTITLDVYVNVDTLTGLHSGTCDLAC-IIVLTLVGGKDYFISVSGQFVPTCFGLPLSLLLKIPDTPVAS-IPRETLQKMFRESRIGDWKEGEPSIIKNAKS-PLFVVPKELYRLLGFIMNHLD------EAELFRQPGQRSDY-PIIRDVLDTTNHDVPIP---ESVSVHSVAYSLLIFLSTLPEPVVPYAFQDRCLSSIASFPQAVQALSCLP----IDYQNLFYYLVSFLRR 651          
BLAST of SMED30001437 vs. TrEMBL
Match: A0A5K4FAM2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 9.421e-53
Identity = 168/570 (29.47%), Postives = 287/570 (50.35%), Query Frame = -1
Query:  118 AGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKL----QLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLID----IRDASRR------LSNKLFKPRTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSG-KKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFG-LHLGVLRFIDRPIDTYTPKEI---IQIESSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDP---------CNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTN-------ILFLRRLLHYLHGFILKPSDIEIIA 1710
            AG+ + V++   L+  +      +    VP G    M NKG + I   I   ++CF+NCHL AG  NL+RR    + + +K+     ++  N  +S +  F+ +D D++F+FGDLN+R+  L + +V +SI     K  + L+K+DEL+ L E   L+  F E  I+F PTYKF +NS+ Y+S    RVPSYCDRI+W G+ C  I Y+S+PEF+ SDHKP+S  F +D    IR A +R      LS  L    ++P+  ++   LDFG V F +  +    +TN+G    +  FK +  G    P W T+ PS   ++   S  ++F+IF++   V   N    + +  I+   + +G D  ++ NA++    FG   + +L     P++  +  E+   I++  S+N   F   + S L+DR  +  +PK  F   +  +  + +P          +I  +R+++    DTT  +  FP    T S+ +    +++F+ +LP+ +IP     +  +   +    +  L +LP  N       I F++R L +        +DI+++A
Sbjct:  429 AGIIMVVYISARLSAHLRRE--EISCQVVPTGVFNVMGNKGGVGIRLTIFNSSLCFVNCHLAAGEANLDRRNQDFREITRKMLFEFPMNSKNSIQSSEKAFI-SDHDIIFVFGDLNYRISGLDSPSVRKSIFE---KDFSSLLKYDELLKLMENRNLFDGFHEPIINFAPTYKFDMNSNVYDSSDKNRVPSYCDRIIWSGDGCKPIIYRSHPEFVCSDHKPVSAYFSVDLRRIIRSAFQRAYESVLLSIDLTTNLSLPQAELDRQELDFGCVHFHELCSQSLTLTNIGL--NDFQFKFLREGVGSFPLWLTVNPSCDTVKQGNSIKLEFQIFVNYKEVYALNSGTIQLST-IVVLQLEDGKDYFISINAQFIPTSFGLPLILLLSLESEPVNKLSINELHEQIKLARSENSDYFKTKLCS-LVDRKPF-HVPKEIFRLVNHINEYITEPDLFRQMGPSSDIGIIRDIL----DTTPANCPFP---ETISVHSITSCLLLFLNTLPESVIPQEFHEKCFNSLANFESAVQALQHLPICNQNLFYYLITFMQRCLTFKEQ---NGTDIDLLA 977          
BLAST of SMED30001437 vs. Ensembl Cavefish
Match: ocrl (OCRL inositol polyphosphate-5-phosphatase [Source:NCBI gene;Acc:103027958])

HSP 1 Score: 165.236 bits (417), Expect = 4.425e-42
Identity = 140/567 (24.69%), Postives = 258/567 (45.50%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTIL----------DFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITST-----LLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI------PPSN 1707
            G+ L VF++K       NH+ ++   TV  G +  M NKG +++ F     + C +N HL A  E+ ERR    + +  ++  H         +       DVV   GDLN+RL    A+ V + I  N+++ + E    D+L + R T   + +F E +I+F+PTYK+   SD ++S    RVP++CDRILW GN+   + Y+S+ E   SDHKP+S  F I ++  +     K+F+       R+E+  L           F +V F +       ITN G V     F   +   +    W    PS   L+P ++  +   +++    V+  N   +K    I+   +  G D  +T +  Y    FG  L  L  + +PI      ++I +E ++   +F +  T+T      + + I++L+  + F     ++ + + P   ++++ +I  ++  T I  + P    + +     E ++IF+++LP+P++ + +  +     +D      ++  LP+ +    R L+ +L   +    D  + AN + +        PP N
Sbjct:  398 GMMLVVFVKKEHK----NHIRDVAAETVGTGLMNKMGNKGGVAVRFVFHNTSFCIVNSHLAAHVEDFERRNQDYKDICARMSFHLMEHPPLSIVKH-----DVVIWLGDLNYRLFVYDAAEVKKLIAENELRKLQEC---DQLNIQRHTKRAFTDFMEGEINFVPTYKYDAKSDRWDSSGKCRVPAWCDRILWRGNNVKQLHYRSHMELKTSDHKPVSALFSIGVKMVNELRYKKVFEEIVRDMDRMENDFLPSLLLTRREFTFENVKFRQLQRQSFLITNDGQVPCTFAFIPKLTDSQYCKPWLRAEPSDGLLDPNETMEIMLEVYVSKDSVTLLNSGEDKIE-DILVLHLDRGKDYFITVSGNYLPCCFGTSLETLCRMKKPIREIPITKLIDLEKTR--MNFLLESTNTEDKPLKIPKEIWLLVNHL-FTKACQQEELFQTPGLQDELQNIIDCLD--TSIPDSIPGCNHSVA-----EALLIFLEALPEPVVCYELYQKCLECSHDSRLCKQLISQLPRAHRNVFRYLMAFLRELLKHSIDNNLTANLLATLFASLLIRPPPN 941          
BLAST of SMED30001437 vs. Ensembl Cavefish
Match: ocrl (OCRL inositol polyphosphate-5-phosphatase [Source:NCBI gene;Acc:103027958])

HSP 1 Score: 163.31 bits (412), Expect = 1.845e-41
Identity = 141/573 (24.61%), Postives = 257/573 (44.85%), Query Frame = -1
Query:   85 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTIL----------DFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQI------ESSKNIKSFTIFITST-----LLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCI------PPSN 1707
            G+ L VF++K       NH+ ++   TV  G +  M NKG +++ F     + C +N HL A  E+ ERR    + +  ++  H         +       DVV   GDLN+RL    A+ V + I  N+++ + E    D+L + R T   + +F E +I+F+PTYK+   SD ++S    RVP++CDRILW GN+   + Y+S+ E   SDHKP+S  F I ++  +     K+F+       R+E+  L           F +V F +       ITN G V     F   +   +    W    PS   L+P ++  +   +++    V+  N   +K    I+   +  G D  +T +  Y    FG  L  L  + +PI      ++I +      E  K   +F +  T+T      + + I++L+  + F     ++ + + P   ++++ +I  ++  T I  + P    + +     E ++IF+++LP+P++ + +  +     +D      ++  LP+ +    R L+ +L   +    D  + AN + +        PP N
Sbjct:  398 GMMLVVFVKKEHK----NHIRDVAAETVGTGLMNKMGNKGGVAVRFVFHNTSFCIVNSHLAAHVEDFERRNQDYKDICARMSFHLMEHPPLSIVKH-----DVVIWLGDLNYRLFVYDAAEVKKLIAENELRKLQEC---DQLNIQRHTKRAFTDFMEGEINFVPTYKYDAKSDRWDSSGKCRVPAWCDRILWRGNNVKQLHYRSHMELKTSDHKPVSALFSIGVKMVNELRYKKVFEEIVRDMDRMENDFLPSLLLTRREFTFENVKFRQLQRQSFLITNDGQVPCTFAFIPKLTDSQYCKPWLRAEPSDGLLDPNETMEIMLEVYVSKDSVTLLNSGEDKIE-DILVLHLDRGKDYFITVSGNYLPCCFGTSLETLCRMKKPIREIPITKLIDLGEDSYMEKEKTRMNFLLESTNTEDKPLKIPKEIWLLVNHL-FTKACQQEELFQTPGLQDELQNIIDCLD--TSIPDSIPGCNHSVA-----EALLIFLEALPEPVVCYELYQKCLECSHDSRLCKQLISQLPRAHRNVFRYLMAFLRELLKHSIDNNLTANLLATLFASLLIRPPPN 949          
BLAST of SMED30001437 vs. Ensembl Cavefish
Match: inpp5b (inositol polyphosphate-5-phosphatase B [Source:NCBI gene;Acc:103029810])

HSP 1 Score: 140.969 bits (354), Expect = 2.413e-34
Identity = 128/527 (24.29%), Postives = 223/527 (42.31%), Query Frame = -1
Query:  169 YLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLD--RIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTN-------ILFLRRLL 1677
            Y+ K  A H+S +   TV  G +G M NKGA+++ FR     IC +N HL A  E  ERR    + +  ++   Q + T    +  ++  I  V   GDLN+R+ +L    V   I     K    L   D+L    + +A++  F E +I+F PTYK+   SD +++    RVP++CDRILW G +   + Y+S+     SDHKP+S    I I+  +     K  +             IP + +      F DV FM++      + N G V  +  F + +        W T  PS   L    S  +   +F++       +   ++    I+   +  G D  ++    Y  + FG  +  L  +  PI    P E +   S  +    +       LD  + +++++  +  +    ED + + P  ++   E I+   DT   D T P    + +     E +++F+ +L +P++ F+   +     +       ++  LP+ +         FLR LL
Sbjct:  336 YVKKEHAEHISEVETETVGTGIMGRMGNKGAVAVRFRFHNSDICVVNSHLAAHVEEYERRNQDYKDICSRILFRQQDPTLPP-LTIMKHSI--VLWLGDLNYRISDLEVDHVKGLILK---KDFETLYNHDQLKRQMDEEAVFVGFLEGEIEFQPTYKYDTGSDQWDTSEKCRVPAWCDRILWRGKNITQLYYKSHMSLRTSDHKPVSSVMQIGIKVVNEEAYKKTLEEIVRSLDKLENECIPSVTLSQREFHFNDVKFMQHRAETLTVHNDGQVPCQFKFIQKLDEPAYCKPWLTANPSNGFLAQGDSVVIDLEVFVNRSTAPELSSGQQQLE-DILVLHLERGKDYFVSITGSYLPSCFGSSIHTLCQLREPIQE-MPLETVHKLSLTSPSEISSPDMEKALDIPKELWMMVDHLYRNASKQED-LFQLP-GLHSEFEEIRDCLDTCTPD-TLPGGNHSVA-----EALLLFLDALSEPVVTFLQYQQCLECCSSSGQCKKIISMLPQCHKNVFNYVTAFLRELL 846          
BLAST of SMED30001437 vs. Ensembl Cavefish
Match: inpp5b (inositol polyphosphate-5-phosphatase B [Source:NCBI gene;Acc:103029810])

HSP 1 Score: 140.584 bits (353), Expect = 3.169e-34
Identity = 128/527 (24.29%), Postives = 223/527 (42.31%), Query Frame = -1
Query:  169 YLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLD--RIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTN-------ILFLRRLL 1677
            Y+ K  A H+S +   TV  G +G M NKGA+++ FR     IC +N HL A  E  ERR    + +  ++   Q + T    +  ++  I  V   GDLN+R+ +L    V   I     K    L   D+L    + +A++  F E +I+F PTYK+   SD +++    RVP++CDRILW G +   + Y+S+     SDHKP+S    I I+  +     K  +             IP + +      F DV FM++      + N G V  +  F + +        W T  PS   L    S  +   +F++       +   ++    I+   +  G D  ++    Y  + FG  +  L  +  PI    P E +   S  +    +       LD  + +++++  +  +    ED + + P  ++   E I+   DT   D T P    + +     E +++F+ +L +P++ F+   +     +       ++  LP+ +         FLR LL
Sbjct:  232 YVKKEHAEHISEVETETVGTGIMGRMGNKGAVAVRFRFHNSDICVVNSHLAAHVEEYERRNQDYKDICSRILFRQQDPTLPP-LTIMKHSI--VLWLGDLNYRISDLEVDHVKGLILK---KDFETLYNHDQLKRQMDEEAVFVGFLEGEIEFQPTYKYDTGSDQWDTSEKCRVPAWCDRILWRGKNITQLYYKSHMSLRTSDHKPVSSVMQIGIKVVNEEAYKKTLEEIVRSLDKLENECIPSVTLSQREFHFNDVKFMQHRAETLTVHNDGQVPCQFKFIQKLDEPAYCKPWLTANPSNGFLAQGDSVVIDLEVFVNRSTAPELSSGQQQLE-DILVLHLERGKDYFVSITGSYLPSCFGSSIHTLCQLREPIQE-MPLETVHKLSLTSPSEISSPDMEKALDIPKELWMMVDHLYRNASKQED-LFQLP-GLHSEFEEIRDCLDTCTPD-TLPGGNHSVA-----EALLLFLDALSEPVVTFLQYQQCLECCSSSGQCKKIISMLPQCHKNVFNYVTAFLRELL 742          
BLAST of SMED30001437 vs. Ensembl Cavefish
Match: ENSAMXT00000036573.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000126.1:14588:25933:1 gene:ENSAMXG00000035124.1 transcript:ENSAMXT00000036573.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 4.200e-28
Identity = 81/260 (31.15%), Postives = 125/260 (48.08%), Query Frame = -1
Query: 1051 GLISFC--------AGLSLFVFLRKY-LNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYES---KRVPSYCDRILW----MGNSCLNIS------------------YQSYPEFLFSDHKPISGDFLI 1728
            GL S C         G+ L +F + Y L  +      N   G   I      NKG +S    +   +ICF+NCHLPA  EN ++R    ++++Q+ Q           +  L  D DVVF FGDLNFR+++L    +  +I  NK+  + E    D+L + ++++ + + F E  + F PTYKF + +D Y++   KR P++ DRILW    M     N+S                  Y+S+ E+  SDHKP+S  F +
Sbjct:   23 GLFSLCLQVTSQRMQGVLLLIFAKYYHLPFIRGVQTENTRTGLGGI----WGNKGGVSARMNVFGHSICFLNCHLPAHMENSDQRMEDFESILQQQQFEG-----QAAMGVL--DHDVVFWFGDLNFRIEDLEMQVIKTAIDNNKLPLLWEK---DQLNLAKDSETVLEGFEEGPLKFPPTYKFDVGTDTYDTSGKKRKPAWTDRILWRLRPMAPPSNNMSKRSSVSGLTSGTRVTQHFYRSHMEYTVSDHKPVSSIFTL 268          
BLAST of SMED30001437 vs. Ensembl Sea Lamprey
Match: synj1 (synaptojanin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9180])

HSP 1 Score: 95.9005 bits (237), Expect = 2.272e-21
Identity = 64/206 (31.07%), Postives = 102/206 (49.51%), Query Frame = -1
Query: 1141 LLLIKDGLISFCAGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGM-ANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILW 1746
            +LL  + L+  C    LFVFLR +     A HV ++ V TV  G  G   NKG ++I  ++   ++CF+  H  AG+ +   R      + +KL         S          D VF  GD N+R+ +L+   V E ++    K    L + D+L+  R   A+++ F E + +F PTYK+ I SD Y++    R+P++ DR+LW
Sbjct:  632 ILLTSEQLVGVC----LFVFLRPHH----APHVRDVAVDTVKTGMGGATGNKGGVAIRLQMYSSSLCFVCSHFAAGQSHTRERNEDYAEIARKLSFPMGRGLFSH---------DYVFWCGDFNYRI-DLSGDEVKELVRQ---KNWETLQQADQLVQQRNLGAVFRGFHEGRTNFPPTYKYDIFSDDYDTSEKCRIPAWTDRVLW 816          

HSP 2 Score: 24.6386 bits (52), Expect = 2.272e-21
Identity = 25/97 (25.77%), Postives = 41/97 (42.27%), Query Frame = -3
Query: 1727 TLTETQYENTFLGTFLVRVCSYNVNCKFS------KNEMYEKWLKD------------EKSP-DIIAIGFQELYFKLVDIVAPDTIQNVDIAPHKRW 1960
            +L E   E T      V + ++NVN   +      K++    WL D            + +P D+ AIGFQE    +V++ A + + +      KRW
Sbjct:  526 SLCERHGEYTHPKRLRVAIATWNVNGGKTTRSIAFKHQTLSDWLLDNHKQAAISQFQADDTPVDVFAIGFQE----MVELNAGNIV-SASTENQKRW 617          
BLAST of SMED30001437 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008151.1 (pep scaffold:Pmarinus_7.0:GL492242:1419:4886:1 gene:ENSPMAG00000007370.1 transcript:ENSPMAT00000008151.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 5.455e-16
Identity = 47/178 (26.40%), Postives = 85/178 (47.75%), Query Frame = -1
Query: 1177 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYES 1707
            G+ L VF R+      A+ +S +   TV  G +G M NKG +++ F +   ++C +N HL A  E +ERR    + ++ +L   Q + T  +       + D++   GDLN+RL  +    V   I+    + + +    D+L + R     +  + E  + F PTYK+   S  +++
Sbjct:    5 GMMLLVFAREEH----ASFISEVEAETVGTGIMGKMGNKGGVAVRFLLHSSSVCVVNAHLAAHTEEVERRNQDYRDIVSRLSFPQIDATLPR---LSIPNHDIILWLGDLNYRLTEVDVEKVKLLIEDQDFQTLQQ---HDQLSLQRGKKLAFSGYSEGAVTFQPTYKYDTGSSKWDT 172          
BLAST of SMED30001437 vs. Ensembl Yeast
Match: INP53 (Polyphosphatidylinositol phosphatase; dephosphorylates multiple phosphatidylinositol phosphates; involved in trans Golgi network-to-early endosome pathway; hyperosmotic stress causes translocation to actin patches; contains Sac1 and 5-ptase domains; INP53 has a paralog, INP52, that arose from the whole genome duplication [Source:SGD;Acc:S000005635])

HSP 1 Score: 116.316 bits (290), Expect = 2.674e-27
Identity = 73/221 (33.03%), Postives = 117/221 (52.94%), Query Frame = -1
Query: 1015 ANHVSNLLVGTVPIGTLGMA-NKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYES---KRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIR--DASRRLSNK 1659
            A +V  +   T   G  GMA NKGA+SI F  G  + CF+N HL AG  N+E R+   +++++ +       TR+K I       D +F  GD+N+R+ NL    V   +   +   I++L+ FD+L +   + ++++ F E  + F PTYK+   +  Y+S   +R PS+ DRI++ G + L +SY   P  + SDH+P+   +   I   D   RLS K
Sbjct:  663 AKYVKQVEGATKKTGFRGMAGNKGAVSIRFEYGATSFCFVNSHLAAGATNVEERRSDYESIVRGITF-----TRTKMI----PHHDSIFWLGDMNYRI-NLPNEDVRRELLNQEEGYIDKLLHFDQLTLGINSGSVFEGFKEPTLKFRPTYKYDPGTGTYDSSEKERTPSWTDRIIYKGENLLPLSYSDAP-IMISDHRPVYAAYRAKITFVDDKERLSLK 872          
BLAST of SMED30001437 vs. Ensembl Yeast
Match: INP52 (Polyphosphatidylinositol phosphatase; dephosphorylates a number of phosphatidylinositol phosphates (PtdInsPs, PIPs) to PI; involved in endocytosis; hyperosmotic stress causes translocation to actin patches; synaptojanin-like protein with a Sac1 domain; INP52 has a paralog, INP53, that arose from the whole genome duplication [Source:SGD;Acc:S000005050])

HSP 1 Score: 102.449 bits (254), Expect = 7.119e-23
Identity = 59/190 (31.05%), Postives = 96/190 (50.53%), Query Frame = -1
Query: 1042 ANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAY---ESKRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIR 1602
             NKGA++I F  G  + CF+N HL AG  N++ R+     + + +        RSK I       D +F  GDLN+R+  LT   V   ++  K   I+ L+++D+L        +++ F E  + F PTYK+   +D Y   E  R PS+ DRI++ G +   ++Y   P    SDHKP+   +  +++
Sbjct:  708 GNKGAVAIRFDYGATSFCFVNTHLSAGASNIDERRNDYNNIYRNITF-----PRSKTI----PHHDSLFWLGDLNYRI-TLTNDEVRRELRAQKDGYIDRLLQYDQLTQEINEGVVFQGFKEPTLQFRPTYKYDYGTDNYDTSEKARTPSWTDRIIYKGENLHPLAYSDAP-LKISDHKPVYAAYRANVK 886          
BLAST of SMED30001437 vs. Ensembl Yeast
Match: INP51 (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase; synaptojanin-like protein with an N-terminal Sac1 domain, plays a role in phosphatidylinositol 4,5-bisphosphate homeostasis and in endocytosis; null mutation confers cold-tolerant growth [Source:SGD;Acc:S000001264])

HSP 1 Score: 93.2041 bits (230), Expect = 4.582e-20
Identity = 65/216 (30.09%), Postives = 105/216 (48.61%), Query Frame = -1
Query: 1069 VFLRKYLNKVIANHVSNLLVGTVPIGTLGMA-NKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEA----DIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKF---VINSDAYESKRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPI 1692
            + L  ++N+   + V ++       G  GMA NKGA+++SF+      C +  HL AG EN+E+R             H   KT +K I F +     D D +   GD N+R+  ++   V   I + +  ++ E  + ++ ++  E+   +  F E  IDF PTYKF     N D  E  R+P++ DRIL  G     + Y+   + LFSDH+P+
Sbjct:  618 ILLLLFMNETEYSKVKHIEGDVKKTGFGGMASNKGAVAVSFKYSATRFCVLVSHLAAGLENVEQR-------------HNDYKTIAKSIRFSKGLRIKDHDAIIWMGDFNYRIL-MSNEDVRRKIVSKEYASLFEKDQLNQQMIAGES---FPYFHEMAIDFPPTYKFDPGTKNYDTSEKMRIPAWTDRILSRGEVLEQLEYKCCEDILFSDHRPV 816          
BLAST of SMED30001437 vs. Ensembl Yeast
Match: INP54 (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase; role in secretion; localizes to the endoplasmic reticulum via the C-terminal tail; lacks the Sac1 domain and proline-rich region found in the other 3 INP proteins [Source:SGD;Acc:S000005426])

HSP 1 Score: 71.633 bits (174), Expect = 8.827e-14
Identity = 65/200 (32.50%), Postives = 91/200 (45.50%), Query Frame = -1
Query: 1066 GTLGMANKGALSISF---RIGEFT---ICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLR--ETDALYKNFFEAQIDFLPTYKF-VINSDAYESKRVPSYCDRILWMGNSCLNIS----YQSYPE---FLFSDHKPIS 1617
            G  G   KG   ISF   R GE       +I  HL A      R Q          ++  Y +  S+  +   A  D  F  GDLNFR+ + T         T  ++ +  L   +EL +LR  E + L K F E +I F PTYKF +   + Y +KR+PS+CDRIL+   +    +    Y S P     LFSDH+P++
Sbjct:  131 GWFGTHLKGGTLISFQMTRNGEENWERFSYICAHLNANEGVNNRNQ----------RIDDYKRIMSEVCDSEVAKSDHFFFLGDLNFRVTS-TYDPTTNYSSTTTLRRL--LENHEELNLLRKGEDEPLCKGFQELKITFPPTYKFKLFEKETYNTKRIPSWCDRILYKSYAVPTFAQEGTYHSVPRSNALLFSDHQPVN 317          
BLAST of SMED30001437 vs. Ensembl Nematostella
Match: EDO32085 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW33])

HSP 1 Score: 177.563 bits (449), Expect = 2.321e-47
Identity = 130/493 (26.37%), Postives = 236/493 (47.87%), Query Frame = -1
Query:  274 VFLRKYLNKVIANHVSNLLVGTVPIGTLGM-ANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKF---VINSDAYESKRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKM-PTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIE-----SSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPF 1692
            +FL  Y   +   H+ ++    V  G +GM  NKG ++I       T+CF+N HL A +E  ERR    + ++ KL     N TR  ++  +  D DV F  GDLN+R+ N+        I   +   + EL+K D+LI  +E    +  F E  I F PTYK+     N D+ E  R P++CDR+L+ G+    I+Y+S+P    SDHKP+SG F + ++  +R    ++++            ++P++++ +T + F +V F++  +   EI N G V V+ +F   +        W +I P+   + P+ +K V+   +++       N   +K    I+   +  G D  +T    Y  ++FG  L  L  +  PI       +I +E     S+    S      +  + + +++L+  + + + + E+ IL+      +++++       T +D T    K   S+ +  E ++IF+++LP P+IPF
Sbjct:  102 IFLLVYTKTLHMPHIKDVAAEYVATGIMGMMGNKGGVAIRMSFHNSTLCFVNSHLAAHQEEYERRNQDYRDILSKL-----NFTRVSEVLTI-LDHDVTFWLGDLNYRV-NMECELSKGLIDQGR---LEELLKCDQLIKQKEVKKCFSGFHEPPITFRPTYKYDPGTDNWDSSEKGRAPAWCDRVLYRGHGVKQIAYRSHPSLKVSDHKPVSGLFSVGVKVVNREKEKQVYEEVVRSLDRQENESLPQVKLGTTEIKFKNVQFLEKTSKILEIENTGQVVVQFSFIPKLDDNHFCKPWLSIKPNMGVIMPENTKQVKVSAYVNKETAGALNSGEDKME-DILVLHLEGGKDFFITVTGSYCPSVFGSSLEALVHMYGPIREVPVANLIDLEHGQDSSASGPASQRRAKEALEIPKELWLLVDHL-YKYGASEENILKQSGFEQEIQQI------RTHLD-TGSTGKMPGSIHSVAEALLIFLEALPVPVIPF 575          
BLAST of SMED30001437 vs. Ensembl Nematostella
Match: EDO33968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQQ5])

HSP 1 Score: 87.0409 bits (214), Expect = 1.546e-17
Identity = 61/206 (29.61%), Postives = 100/206 (48.54%), Query Frame = -1
Query: 1141 LLLIKDGLISFCAGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMA-NKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAY---ESKRVPSYCDRILW 1746
            +LL  + L+  C    LFVF R +L      ++ ++ V TV  G  G A NKG ++I   +   +ICFI  HL AG+  ++ R      +  +         RS          D VF  GD N+R+ ++    V   I+   +K  + L + D+L   R+   +++ + E ++ F PTYK+ + SD Y   E  R+P++ DR+LW
Sbjct:  626 VLLTCEQLVGVC----LFVFARPHL----VPYIRDVAVSTVKTGLGGSAGNKGGVAIRLLLHATSICFICSHLAAGQSGVQDRNNDYLDIATRTAFPMGRTIRSH---------DYVFWCGDFNYRI-DMPMDEVKSLIQ---LKDWDALAQNDQLNKQRQEHKVFRGYVEGELRFAPTYKYDLFSDDYDTSEKMRIPAWTDRVLW 810          
BLAST of SMED30001437 vs. Ensembl Nematostella
Match: EDO43425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYV8])

HSP 1 Score: 80.4925 bits (197), Expect = 2.442e-16
Identity = 63/236 (26.69%), Postives = 106/236 (44.92%), Query Frame = -1
Query: 1021 LSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFR--LQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMG---NSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLS 1704
            L L +F+R+ L     + V+   + T P G + +  KG L++ F +   +  FIN HL +       R      + + L L    K        +    D VF  GD NFR  ++      +I + +  +     EL+K D+L  L   + ++  F E  I F PTYK  I +D Y++    RVPS+ DR+L+     N+   + Y +      SDH+P+ G + + ++     +S
Sbjct:   92 LHLAIFVRREL-VWFCSAVTQESIATRP-GHM-IKTKGGLAVGFSLFGTSFLFINSHLTSDEGKARDRVNDYNKIRKSLNLQGEEKPWVDNSPDVTDRFDRVFWLGDFNFRVDMERTEVDKLIATYQEQESPDYKELLKKDQLSRLMSKEEVFIGFSEHPISFAPTYKLDIQTDDYDTSSKMRVPSWTDRVLYKSRTENTVNVVRYDACTSVKTSDHRPVFGIYEVTLKPCKESVS 324          
BLAST of SMED30001437 vs. Ensembl Nematostella
Match: EDO29183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4D0])

HSP 1 Score: 69.3218 bits (168), Expect = 2.324e-12
Identity = 56/229 (24.45%), Postives = 113/229 (49.34%), Query Frame = -1
Query: 1012 TVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQF-GLQA-VIQKLQLHQYNKTRSKKINFLE-ADIDVV-FLFGDLNFRLQNLTA----------SAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK----RVPSYCDRILWM-----GNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKL 1629
            T  +G LG   KGA+S+ F + + + CFIN H  A  E  E R   GL   V+   + + ++     ++ F    D ++  +  GD +   +N  A             + +  + K++AI  + +  EL+  ++    + +F E  + F PTYK+   S  ++++    R P++ DR+LW       ++   I+Y+S+ +++ SDH+P+S    +D+ D++ ++ + +
Sbjct:  141 TAFLGLLG--TKGAVSLRFTLYDQSFCFINSHFAAHAEYTEYRNSDGLCVYVVSNYKTYSWDWIGLYRVGFHHIWDYEMYEWAVGDGDEYGENGCAVLFDCLPEEPGHYVMAYYSYKMEAIISVSEAFELLQSKDAKLSFIDFKEGPLVFKPTYKYNPGSSDWDTESGKYRKPAWTDRVLWREKPEKADTAQLITYKSHDQYMTSDHRPVSALLSLDLPDSALKIEDPI 367          
BLAST of SMED30001437 vs. Ensembl Nematostella
Match: EDO26303 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCD0])

HSP 1 Score: 55.4546 bits (132), Expect = 5.205e-10
Identity = 31/77 (40.26%), Postives = 41/77 (53.25%), Query Frame = -1
Query: 1369 NKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRL 1599
            NKGA+ ISF  G  + CFINCHL A    + RR     ++++ L L Q      K +  L      VF FGDLN+R+
Sbjct:    1 NKGAVGISFLFGATSFCFINCHLAARASRVLRRNQNFHSILKGLNLGQ------KNVFDLTNQFHHVFWFGDLNYRI 71          
BLAST of SMED30001437 vs. Ensembl Medaka
Match: ocrl (OCRL inositol polyphosphate-5-phosphatase [Source:NCBI gene;Acc:101162611])

HSP 1 Score: 171.785 bits (434), Expect = 2.423e-44
Identity = 155/572 (27.10%), Postives = 265/572 (46.33%), Query Frame = -1
Query:   79 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRT----------IPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYV-----LMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTN-------ILFLRRLLHYLHGFILKPSDIEIIANFVVSCI---PPSNPS 1707
            G+ L V ++K   + I   V++  VGT  +G +G  NKG +++ F     + CF+N HL A  E  ERR    + +  ++    +N   S  ++ ++ D  VV   GDLN+RL N     V   I   K+K   +L+KFD+L + R+T   + +F E +I+F+PTYK+   +D ++S    RVP++CDRILW GN    I Y+S+ E   SDHKP+S  F I ++    +   K+F+             +P + +  T   F DV F +       ITN G V     F       +   +W    PS   LEPK++  +   +++    V+  N   E     I+   +  G D  LT +  Y  + FG  L  L  + +PI      ++I +E SK    F I   +   DR + +     +M    +     ++ + + P    +++ +I+ ++  T I  + P    + +     E ++IF+++LP+P++ + +  R     +D      ++  LP+ +       + FL+ LL + H   L  S   +IA    S +   PPS+ S
Sbjct:  392 GMMLVVAVKKIHVRSIT-EVASDHVGTGILGKMG--NKGGVAVRFVFHNTSFCFVNSHLAAKLEETERRNQDYKDICARMI---FNMPGSPSLSIVKHD--VVIWLGDLNYRLFNKDCGDVKRMISEGKLK---QLLKFDQLSIQRQTKRAFSDFIEGEINFIPTYKYEPKTDFWDSSSKNRVPAWCDRILWRGNKVELIEYRSHMELKTSDHKPVSSIFSIGVKVGDDQRFKKVFEETVRQIDRMENDFLPSVSLSKTEFFFIDVKFRQLQRERFLITNDGQVPCHFAFIPKCNQSQYCKSWLRAEPSDGFLEPKETLEIYLEVYVSKDSVTMLNSG-EDIIEDILILHLDRGKDFFLTISGNYLPSCFGTSLETLTRMKKPIREIPITKLIDLEKSK--VKFLIGDGAANEDRPLKIPKEVWIMVNHLYTKSCDQEDLFQTPGLQEELQHIIECLD--TSIPDSIPGCNHSVA-----EALLIFLEALPEPVVCYELYQRCLECAHDSRLCKQLISLLPRAHRNVFRYLLAFLKELLKHSHNNNLTAS---LIATLFASLLIRPPPSSAS 939          
BLAST of SMED30001437 vs. Ensembl Medaka
Match: ocrl (OCRL inositol polyphosphate-5-phosphatase [Source:NCBI gene;Acc:101162611])

HSP 1 Score: 168.318 bits (425), Expect = 3.374e-43
Identity = 154/578 (26.64%), Postives = 265/578 (45.85%), Query Frame = -1
Query:   79 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRT----------IPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTF-KTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQI------ESSKNIKSFTIFITSTLLDRIIYV-----LMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTN-------ILFLRRLLHYLHGFILKPSDIEIIANFVVSCI---PPSNPS 1707
            G+ L V ++K   + I   V++  VGT  +G +G  NKG +++ F     + CF+N HL A  E  ERR    + +  ++    +N   S  ++ ++ D  VV   GDLN+RL N     V   I   K+K   +L+KFD+L + R+T   + +F E +I+F+PTYK+   +D ++S    RVP++CDRILW GN    I Y+S+ E   SDHKP+S  F I ++    +   K+F+             +P + +  T   F DV F +       ITN G V     F       +   +W    PS   LEPK++  +   +++    V+  N   E     I+   +  G D  LT +  Y  + FG  L  L  + +PI      ++I +      E  K+   F I   +   DR + +     +M    +     ++ + + P    +++ +I+ ++  T I  + P    + +     E ++IF+++LP+P++ + +  R     +D      ++  LP+ +       + FL+ LL + H   L  S   +IA    S +   PPS+ S
Sbjct:  392 GMMLVVAVKKIHVRSIT-EVASDHVGTGILGKMG--NKGGVAVRFVFHNTSFCFVNSHLAAKLEETERRNQDYKDICARMI---FNMPGSPSLSIVKHD--VVIWLGDLNYRLFNKDCGDVKRMISEGKLK---QLLKFDQLSIQRQTKRAFSDFIEGEINFIPTYKYEPKTDFWDSSSKNRVPAWCDRILWRGNKVELIEYRSHMELKTSDHKPVSSIFSIGVKVGDDQRFKKVFEETVRQIDRMENDFLPSVSLSKTEFFFIDVKFRQLQRERFLITNDGQVPCHFAFIPKCNQSQYCKSWLRAEPSDGFLEPKETLEIYLEVYVSKDSVTMLNSG-EDIIEDILILHLDRGKDFFLTISGNYLPSCFGTSLETLTRMKKPIREIPITKLIDLGEDSYMEQEKSKVKFLIGDGAANEDRPLKIPKEVWIMVNHLYTKSCDQEDLFQTPGLQEELQHIIECLD--TSIPDSIPGCNHSVA-----EALLIFLEALPEPVVCYELYQRCLECAHDSRLCKQLISLLPRAHRNVFRYLLAFLKELLKHSHNNNLTAS---LIATLFASLLIRPPPSSAS 947          
BLAST of SMED30001437 vs. Ensembl Medaka
Match: inpp5b (inositol polyphosphate-5-phosphatase B [Source:NCBI gene;Acc:101170302])

HSP 1 Score: 162.54 bits (410), Expect = 2.570e-41
Identity = 135/537 (25.14%), Postives = 238/537 (44.32%), Query Frame = -1
Query:  130 YLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESK---RVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKP----------RTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKM---PTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHN-LPKTNILFLRRLLHYLHGF---ILKPSDI 1677
            Y+    A  +S+L   TV  G +G M NKGA++I FR     IC +N HL A  E  ERR    + +  +LQ  Q + T+   +  ++ D  VV   GDLN+R+ +L    V E I     K    L  +D+L    + +A++  F E  I+F PTYK+   SD ++S    RVP++CDR+LW G +     YQS+     SDHKP+S  F+I I+  +     K F+             IP + +     DF D+ FM++      + N G V  +  F  I    ++     W T  P    +    S  ++  +F++     + N   E+    I+   +  G D  ++    Y  + +G  +  L  +  PI       + ++ +    ++         + + +++++  +  +    ED I + P     +R     + D     +   L  +  S++   E +++F+ +LP+P++PF V  +     ++      V+   LP+ +    R + +YL  F   +LK S+I
Sbjct:  344 YVKTEHAEFISDLEAETVGTGIMGRMGNKGAVAIRFRFHNSDICVVNSHLAAHVEEYERRNQDFKDICSRLQFRQLDLTQPP-LTIMKHD--VVLWIGDLNYRISDLDVDGVKELISK---KDFETLHSYDQLKKQIDEEAVFVGFEEGDINFQPTYKYDTGSDNWDSSEKCRVPAWCDRVLWKGKNIKQQHYQSHMALKTSDHKPVSSLFIIGIKRINDEAYKKTFEDIVRNIDKMENECIPSVTLSKREFDFKDIKFMEHQAQTLRLFNDGQVPCQFEF--IQKPNELTYCKPWLTANPPKGFIAKGGSADIELEVFVNRGTAPDLNCGREQIE-DILVLHLERGKDYFISVTGNYLQSCYGTSIYALCHLREPIRDMPQDALRELAAMSGTENTATTEKPLDIPKELWMMVDHLFRNAVKQED-IFQQP----GLRSEFAEIRDCLDTGIPDSLPGSNHSVA---EALLLFLDALPEPVVPFSVYQQCLECSSNESQCQRVISTLLPQCH----RNVFNYLAAFLRELLKSSEI 859          
BLAST of SMED30001437 vs. Ensembl Medaka
Match: inpp5jb (phosphatidylinositol 4,5-bisphosphate 5-phosphatase A [Source:NCBI gene;Acc:101173869])

HSP 1 Score: 124.405 bits (311), Expect = 3.546e-30
Identity = 81/244 (33.20%), Postives = 120/244 (49.18%), Query Frame = -1
Query: 1051 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYES---KRVPSYCDRILWM----------------------GNSCLNISYQSYPEFLFSDHKPISGDFLI 1707
            GL L VF  KY +      V      T   G  G  NKG +     +   TICF+NCHLPA  EN ++R    ++++Q+    Q+    +  +     D DVVF FGDLNFR+ +L   AV  +I  NK  A   L++ D+L + ++++ + + F E  + F PTYKF + ++ Y++   KR P++ DRILW                       G      SYQS+ E+  SDHKP+S  F +
Sbjct:   89 GLLLLVF-AKYFHLPFLRGVQTETTRTGLGGYWG--NKGGVGARMSVFGHTICFVNCHLPAHMENSDQRMEDFESILQQ---QQFEGQAASGV----LDHDVVFWFGDLNFRINDLDIQAVKSAIDNNKFSA---LLEKDQLNMAKDSETVLEGFHEGPLKFPPTYKFDVGTNTYDTSGKKRKPAWTDRILWRLRATAPAAQSSEKRGSFSGLTSGTKVTQHSYQSHMEYTISDHKPVSSIFTL 319          
BLAST of SMED30001437 vs. Ensembl Medaka
Match: inpp5jb (phosphatidylinositol 4,5-bisphosphate 5-phosphatase A [Source:NCBI gene;Acc:101173869])

HSP 1 Score: 124.02 bits (310), Expect = 5.686e-30
Identity = 81/244 (33.20%), Postives = 120/244 (49.18%), Query Frame = -1
Query: 1051 GLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYES---KRVPSYCDRILWM----------------------GNSCLNISYQSYPEFLFSDHKPISGDFLI 1707
            GL L VF  KY +      V      T   G  G  NKG +     +   TICF+NCHLPA  EN ++R    ++++Q+    Q+    +  +     D DVVF FGDLNFR+ +L   AV  +I  NK  A   L++ D+L + ++++ + + F E  + F PTYKF + ++ Y++   KR P++ DRILW                       G      SYQS+ E+  SDHKP+S  F +
Sbjct:   92 GLLLLVF-AKYFHLPFLRGVQTETTRTGLGGYWG--NKGGVGARMSVFGHTICFVNCHLPAHMENSDQRMEDFESILQQ---QQFEGQAASGV----LDHDVVFWFGDLNFRINDLDIQAVKSAIDNNKFSA---LLEKDQLNMAKDSETVLEGFHEGPLKFPPTYKFDVGTNTYDTSGKKRKPAWTDRILWRLRATAPAAQSSEKRGSFSGLTSGTKVTQHSYQSHMEYTISDHKPVSSIFTL 322          
BLAST of SMED30001437 vs. Planmine SMEST
Match: SMESG000056307.1 (SMESG000056307.1)

HSP 1 Score: 1140.95 bits (2950), Expect = 0.000e+0
Identity = 562/563 (99.82%), Postives = 562/563 (99.82%), Query Frame = -1
Query:   22 AGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESKRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCIPPSNPSLKNPLVSVIAFLTEKPNML 1710
            AGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAG ENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESKRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCIPPSNPSLKNPLVSVIAFLTEKPNML
Sbjct:  117 AGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLGMANKGALSISFRIGEFTICFINCHLPAGGENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESKRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVVSCIPPSNPSLKNPLVSVIAFLTEKPNML 679          

HSP 2 Score: 210.69 bits (535), Expect = 8.986e-59
Identity = 101/105 (96.19%), Postives = 103/105 (98.10%), Query Frame = -3
Query: 1694 MDSKVKFLNHSGSEESTLTETQYENTFLGTFLVRVCSYNVNCKFSKNEMYEKWLKDEKSPDIIAIGFQELYFKLVDIVAPDTIQNVDIAPHKRWLDFFLCWIKFI 2008
            MDSKVKFLNHSGSEESTLTETQYENTFLGTFLVRVCSYNVNCKFSKNEMYEKWLKDEKSPDIIAIGFQELYFKLVDIVAPDTIQNVD+APHKRWLDFFL  +KFI
Sbjct:    1 MDSKVKFLNHSGSEESTLTETQYENTFLGTFLVRVCSYNVNCKFSKNEMYEKWLKDEKSPDIIAIGFQELYFKLVDIVAPDTIQNVDVAPHKRWLDFFLS-LKFI 104          
BLAST of SMED30001437 vs. Planmine SMEST
Match: SMESG000022768.1 (SMESG000022768.1)

HSP 1 Score: 192.586 bits (488), Expect = 2.124e-51
Identity = 162/544 (29.78%), Postives = 257/544 (47.24%), Query Frame = -1
Query:  151 AGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAY---ESKRVPSYCDRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLID-----------IRDASRRLSNKLFKPRTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGKKMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIICASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESSKNIKSFTI---------FITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVRELIKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARLSSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGF 1710
            +G+ L +++    +  I ++   +    VP G L  M NKG + I F+     +CFINCHL AG  N  RR    + + + +    YN       N      D+VFL GDLN+RL N+ AS   E I     K I+ L+  DEL   +E++ ++ +F E  I+FLPTYKF  N+D Y   E  RVPSYCDRI+W G  C    Y S+     SDHKP+S  F I            +++A  R S  L    ++P+ +++   + F  + F +N      + N+G       FK I    K+P W T+  S   ++P +   + F IFI++ +V+  N  ++K    I+   +  G D  +T  A      FGL L +L  + +P+ T T +E+ + +    IKS ++         F T   +  ++  L+  +Q      E+ +   P    D+ ++I+   DT  ID  F       S+ +  ET++IF+ SL  PIIP  +       +N+    + V+  LP+ +    + L HYL  F
Sbjct:  387 SGILLVIYVNSKYSSFIPDY--EVFFNKVPTGMLNLMGNKGGVGIRFQAWNSNLCFINCHLAAGESNRLRRDQDFREIEKNMIFRNYNDKLITMYNH-----DLVFLMGDLNYRLVNIEASEAKEYILK---KNIDVLMANDELT--KESNFVFAHFHEGTINFLPTYKFDPNTDDYDTSEKNRVPSYCDRIMWKGEHCKLQGYTSHSSLKSSDHKPVSAWFNIGLKKIDEKKKVKVQEAIIR-SLDLIYNLSLPQAKVDRQEIHFEKIHFYENRQASISLKNIGQYEFLFKFKEIPGCPKIPDWLTVRSSEGKVKPGEEFEIIFEIFINASNVAELN--VKKEVQSILVLELQGGKDYFITITADLVPTSFGLPLSLLVTLKQPVGTMTREELFE-KCKPYIKSVSVPNQNSYANEFTTPKEVFAMLNYLLKHVQ------EEDLFSRPGYHGDI-QVIREQLDTHGIDANF----DNVSVHSVTETLIIFLNSLYFPIIPEQLIKECMGVHNNFMESVKVIGKLPQDH----KNLFHYLTSF 899          
BLAST of SMED30001437 vs. Planmine SMEST
Match: SMESG000022556.1 (SMESG000022556.1)

HSP 1 Score: 122.479 bits (306), Expect = 1.811e-28
Identity = 90/276 (32.61%), Postives = 140/276 (50.72%), Query Frame = -1
Query:  964 LIKDGLISFCAGLSLFVFLRKYLNKVIANHVSNLLVGTVPIG-TLGMANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDA--LYKNFFEAQIDFLPTYKFVINS----DAYESK-------RVPSYCDRILWMG---NSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTIL 1740
            LI     SF   L + +F R  L K    +  N+ V +V  G      NKGA+S+SF   + T CFINCHL +G EN++RR+   + +IQK+   + NK+       L +  D +F  GD NFR    T   V E++K  + + I++ +K DELI   ++    L++NF E  I  +PTY+++  S    D ++ K         PS+CDRIL+      S L I+Y +  ++  SDHKP+   FL+ +       +N    P   P +RI+  ++
Sbjct:  194 LISSKTNSFPKTLKISIFCRAALEK----YFRNISVDSVNTGFANKCGNKGAVSVSFNFQDATFCFINCHLASGVENIKRREEEFKVIIQKIHSQRDNKSSCAD---LISKQDFIFCMGDFNFR----TDLHVTEALKLLQNQHISDFLKSDELIKYHQSKPSNLFQNFLEPPITHVPTYRYLKGSKDNLDPFKQKIGTADKINSPSWCDRILYKARNPKSILPITYGTNLDYKSSDHKPVFSSFLVALPPRDYLENNTSKSP---PSLRIDEILV 455          
BLAST of SMED30001437 vs. Planmine SMEST
Match: SMESG000022556.1 (SMESG000022556.1)

HSP 1 Score: 122.479 bits (306), Expect = 2.362e-28
Identity = 90/276 (32.61%), Postives = 140/276 (50.72%), Query Frame = -1
Query:  964 LIKDGLISFCAGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDA--LYKNFFEAQIDFLPTYKFVINS----DAYESK-------RVPSYCDRILWMG---NSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTIL 1740
            LI     SF   L + +F R  L K    +  N+ V +V  G      NKGA+S+SF   + T CFINCHL +G EN++RR+   + +IQK+   + NK+       L +  D +F  GD NFR    T   V E++K  + + I++ +K DELI   ++    L++NF E  I  +PTY+++  S    D ++ K         PS+CDRIL+      S L I+Y +  ++  SDHKP+   FL+ +       +N    P   P +RI+  ++
Sbjct:  491 LISSKTNSFPKTLKISIFCRAALEK----YFRNISVDSVNTGFANKCGNKGAVSVSFNFQDATFCFINCHLASGVENIKRREEEFKVIIQKIHSQRDNKSSCAD---LISKQDFIFCMGDFNFR----TDLHVTEALKLLQNQHISDFLKSDELIKYHQSKPSNLFQNFLEPPITHVPTYRYLKGSKDNLDPFKQKIGTADKINSPSWCDRILYKARNPKSILPITYGTNLDYKSSDHKPVFSSFLVALPPRDYLENNTSKSP---PSLRIDEILV 752          
BLAST of SMED30001437 vs. Planmine SMEST
Match: SMESG000022556.1 (SMESG000022556.1)

HSP 1 Score: 122.094 bits (305), Expect = 2.639e-28
Identity = 90/276 (32.61%), Postives = 140/276 (50.72%), Query Frame = -1
Query:  964 LIKDGLISFCAGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDA--LYKNFFEAQIDFLPTYKFVINS----DAYESK-------RVPSYCDRILWMG---NSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFKPRTIPRIRIESTIL 1740
            LI     SF   L + +F R  L K    +  N+ V +V  G      NKGA+S+SF   + T CFINCHL +G EN++RR+   + +IQK+   + NK+       L +  D +F  GD NFR    T   V E++K  + + I++ +K DELI   ++    L++NF E  I  +PTY+++  S    D ++ K         PS+CDRIL+      S L I+Y +  ++  SDHKP+   FL+ +       +N    P   P +RI+  ++
Sbjct:  491 LISSKTNSFPKTLKISIFCRAALEK----YFRNISVDSVNTGFANKCGNKGAVSVSFNFQDATFCFINCHLASGVENIKRREEEFKVIIQKIHSQRDNKSSCAD---LISKQDFIFCMGDFNFR----TDLHVTEALKLLQNQHISDFLKSDELIKYHQSKPSNLFQNFLEPPITHVPTYRYLKGSKDNLDPFKQKIGTADKINSPSWCDRILYKARNPKSILPITYGTNLDYKSSDHKPVFSSFLVALPPRDYLENNTSKSP---PSLRIDEILV 752          
The following BLAST results are available for this feature:
BLAST of SMED30001437 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OCRL4.541e-4325.96OCRL inositol polyphosphate-5-phosphatase [Source:... [more]
OCRL3.674e-4226.14OCRL inositol polyphosphate-5-phosphatase [Source:... [more]
INPP5B2.586e-3624.44inositol polyphosphate-5-phosphatase B [Source:HGN... [more]
INPP5B4.216e-3624.44inositol polyphosphate-5-phosphatase B [Source:HGN... [more]
INPP5B1.119e-3524.44inositol polyphosphate-5-phosphatase B [Source:HGN... [more]
back to top
BLAST of SMED30001437 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ocrl-11.142e-2324.33OCRL (Lowe's oculocerebrorenal syndrome protein) h... [more]
unc-264.716e-1929.44Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5E... [more]
unc-264.756e-1929.44Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5E... [more]
inpp-16.331e-1730.09INositol Polyphosphate-5-Phosphatase [Source:UniP... [more]
inpp-16.703e-1730.09INositol Polyphosphate-5-Phosphatase [Source:UniP... [more]
back to top
BLAST of SMED30001437 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ocrl2.336e-3825.95gene:FBgn0023508 transcript:FBtr0070317[more]
Ocrl2.336e-3825.95gene:FBgn0023508 transcript:FBtr0332586[more]
CG97844.294e-2330.12gene:FBgn0030761 transcript:FBtr0074289[more]
CG97844.294e-2330.12gene:FBgn0030761 transcript:FBtr0310319[more]
CG97844.368e-2330.12gene:FBgn0030761 transcript:FBtr0330409[more]
back to top
BLAST of SMED30001437 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inpp5b1.792e-4525.52inositol polyphosphate-5-phosphatase B [Source:ZFI... [more]
ocrl2.491e-3623.42OCRL inositol polyphosphate-5-phosphatase [Source:... [more]
ocrl2.491e-3623.42OCRL inositol polyphosphate-5-phosphatase [Source:... [more]
ocrl3.496e-3623.42OCRL inositol polyphosphate-5-phosphatase [Source:... [more]
ocrl1.970e-3523.42OCRL inositol polyphosphate-5-phosphatase [Source:... [more]
back to top
BLAST of SMED30001437 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hes5.21.031e-4525.48hairy and enhancer of split 5, gene 2 [Source:Xenb... [more]
hes5.21.045e-4526.00hairy and enhancer of split 5, gene 2 [Source:Xenb... [more]
hes5.22.583e-4525.61hairy and enhancer of split 5, gene 2 [Source:Xenb... [more]
hes5.22.919e-4525.61hairy and enhancer of split 5, gene 2 [Source:Xenb... [more]
hes5.23.219e-4525.61hairy and enhancer of split 5, gene 2 [Source:Xenb... [more]
back to top
BLAST of SMED30001437 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ocrl1.722e-4526.78OCRL, inositol polyphosphate-5-phosphatase [Source... [more]
Ocrl5.307e-3930.08OCRL, inositol polyphosphate-5-phosphatase [Source... [more]
Inpp5b4.221e-3624.95inositol polyphosphate-5-phosphatase B [Source:MGI... [more]
Inpp5b3.129e-3427.15inositol polyphosphate-5-phosphatase B [Source:MGI... [more]
Inpp5j5.165e-2628.04inositol polyphosphate 5-phosphatase J [Source:MGI... [more]
back to top
BLAST of SMED30001437 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NVF0|OCRL_MOUSE1.204e-4426.78Inositol polyphosphate 5-phosphatase OCRL OS=Mus m... [more]
sp|D3ZGS3|OCRL_RAT2.187e-4326.22Inositol polyphosphate 5-phosphatase OCRL OS=Rattu... [more]
sp|Q01968|OCRL_HUMAN2.181e-4225.96Inositol polyphosphate 5-phosphatase OCRL OS=Homo ... [more]
sp|Q8K337|I5P2_MOUSE2.952e-3524.95Type II inositol 1,4,5-trisphosphate 5-phosphatase... [more]
sp|P32019|I5P2_HUMAN5.373e-3524.44Type II inositol 1,4,5-trisphosphate 5-phosphatase... [more]
back to top
BLAST of SMED30001437 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VG343.722e-5529.93Putative ocrl type II inositol 5-phosphatase OS=Sc... [more]
A0A183LDZ25.589e-5429.70Rho-GAP domain-containing protein OS=Schistosoma m... [more]
A0A0X3PEY35.686e-5429.11Type II inositol 1,4,5-trisphosphate 5-phosphatase... [more]
A0A0X3P2F36.585e-5429.11Type II inositol 1,4,5-trisphosphate 5-phosphatase... [more]
A0A5K4FAM29.421e-5329.47Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of SMED30001437 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ocrl4.425e-4224.69OCRL inositol polyphosphate-5-phosphatase [Source:... [more]
ocrl1.845e-4124.61OCRL inositol polyphosphate-5-phosphatase [Source:... [more]
inpp5b2.413e-3424.29inositol polyphosphate-5-phosphatase B [Source:NCB... [more]
inpp5b3.169e-3424.29inositol polyphosphate-5-phosphatase B [Source:NCB... [more]
ENSAMXT00000036573.14.200e-2831.15pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30001437 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
synj12.272e-2131.07synaptojanin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-91... [more]
ENSPMAT00000008151.15.455e-1626.40pep scaffold:Pmarinus_7.0:GL492242:1419:4886:1 gen... [more]
back to top
BLAST of SMED30001437 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
INP532.674e-2733.03Polyphosphatidylinositol phosphatase; dephosphoryl... [more]
INP527.119e-2331.05Polyphosphatidylinositol phosphatase; dephosphoryl... [more]
INP514.582e-2030.09Phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
INP548.827e-1432.50Phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
back to top
BLAST of SMED30001437 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320852.321e-4726.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339681.546e-1729.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434252.442e-1626.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291832.324e-1224.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263035.205e-1040.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30001437 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ocrl2.423e-4427.10OCRL inositol polyphosphate-5-phosphatase [Source:... [more]
ocrl3.374e-4326.64OCRL inositol polyphosphate-5-phosphatase [Source:... [more]
inpp5b2.570e-4125.14inositol polyphosphate-5-phosphatase B [Source:NCB... [more]
inpp5jb3.546e-3033.20phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
inpp5jb5.686e-3033.20phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
back to top
BLAST of SMED30001437 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056307.18.986e-5999.82SMESG000056307.1[more]
SMESG000022768.12.124e-5129.78SMESG000022768.1[more]
SMESG000022556.11.811e-2832.61SMESG000022556.1[more]
SMESG000022556.12.362e-2832.61SMESG000022556.1[more]
SMESG000022556.12.639e-2832.61SMESG000022556.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001437 ID=SMED30001437|Name=SMED30001437|organism=Schmidtea mediterranea sexual|type=transcript|length=2043bp
TCATTGGATTCAATATTTTTAAAGCATATTGGGCTTTTCAGTCAAAAAGG
CAATAACACTAACTAATGGGTTTTTTAAACTTGGATTCGAAGGAGGAATG
CATGAAACAACGAAATTTGCAATTATTTCAATATCTGAAGGTTTCAAGAT
AAATCCATGCAGGTAATGAAGCAAACGCCGTAGAAACAGGATATTCGTTT
TAGGCAAGTTGTGCAGAACATTAAGGATGTGATGCCTATCATTGTAAAAT
GAGGATAGTCTTGCTTGAACGACGAATGGGATAATTGGTTGCGGCAAACT
TTTCATAAATATCATTATTGTTTCCATGTGCGTACTGAGACTAAATGTAG
TTTTTTCCAACGGAAAAGTCAAATCAATTTTTGTAGTATCATTAACTCTT
TTTATCAATTCCCTTACATCATTAATATTGCAAGGATCTCTTAAAATTAC
GTCTTCAAAAGATTTGAAGTCAAATTGGATTTTCGGCATCAATACATATA
TTATTCGATCAAGAAGGGTGCTTGTTATGAAAATAGTGAAAGACTTTATG
TTTTTCGAAGATTCTATCTGAATTATTTCTTTTGGTGTATAAGTATCTAT
TGGACGGTCAATAAACCTTAAAACCCCCAAGTGAAGACCAAAAATGTTGA
GATGATATTTTGCGTTGAATGTCAAAGGGGTATCGGCACCATTTAAGATT
GAGGCACAAATAATTTGACAATTGAATTTTTCAATGTCTCGGTTGAAATT
ACTGACATGGTGGGAATCAATGAAAATTCTAAATTGAACTGTTTTTGATT
GTTTCGGTTCCAGAGGAATTGTTGACGGAATTATTGTAAACCAAGTCGGC
ATTTTCTTTCCGCTTACAATTGTTTTAAAAGTCACTTCCACGTGAACACT
TCCAACATTTGTTATTTCTTTTTCACAAGTGACATTTTTCATAAAAAAAA
CATCTCCAAAATCTAAAATAGTACTTTCAATTCGGATTCTAGGAATAGTT
CTTGGTTTGAAAAGTTTATTGGATAATCGCCTTGATGCATCTCGAATGTC
GATCAAAAAATCACCACTAATGGGTTTATGATCCGAGAATAGAAATTCTG
GATAACTTTGGTATGATATATTCAAGCAAGAATTCCCCATCCATAGAATC
CTGTCACAATACGACGGTACTCGTTTAGATTCATACGCATCAGAATTGAT
TACGAATTTATAAGTTGGTAGAAAATCTATTTGGGCTTCAAAAAAGTTCT
TATACAGTGCATCTGTTTCTCGCAGCACTATTAATTCATCAAATTTAATT
AATTCATTGATAGCTTTAACTTTATTTGTTTTAATACTTTCTATAACAGC
GGAAGCCGTCAAATTTTGTAACCGGAAATTCAAATCCCCAAATAAAAACA
CTACATCAATATCGGCTTCGAGAAAATTAATCTTTTTAGATCTCGTTTTG
TTGTATTGATGAAGTTGTAATTTTTGGATAACTGCTTGCAAACCAAATTG
TCGTCTTTCCAGATTTTCACGTCCAGCCGGAAGATGGCAATTTATAAAGC
ATATAGTAAATTCCCCAATCCGAAAGGAAATTGACAATGCACCTTTATTG
GCCATTCCAAGCGTGCCAATAGGAACTGTTCCAACTAATAAATTACTAAC
GTGATTGGCTATTACCTTATTCAAGTATTTTCGCAGAAATACAAATAAAC
TTAATCCAGCACAAAAAGAAATCAAGCCATCTTTTATGAGGAGCAATATC
AACATTTTGAATGGTATCTGGAGCAACTATATCCACCAGTTTAAAATACA
GTTCTTGAAAACCTATTGCAATGATGTCTGGAGATTTCTCATCTTTTAAC
CATTTTTCATACATCTCATTTTTGCTAAACTTGCAATTGACATTATAGGA
ACAAACTCTTACAAGAAATGTTCCTAAAAAAGTATTCTCATACTGAGTTT
CTGTTAAAGTGCTTTCTTCTGAACCAGAATGATTTAAAAATTTTACTTTA
GAATCCATAATAGATGCATGAAATTCTAAGATATTTATTGGAC
back to top

protein sequence of SMED30001437-orf-1

>SMED30001437-orf-1 ID=SMED30001437-orf-1|Name=SMED30001437-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MLILLLIKDGLISFCAGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG
MANKGALSISFRIGEFTICFINCHLPAGRENLERRQFGLQAVIQKLQLHQ
YNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAIN
ELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYESKRVPSYC
DRILWMGNSCLNISYQSYPEFLFSDHKPISGDFLIDIRDASRRLSNKLFK
PRTIPRIRIESTILDFGDVFFMKNVTCEKEITNVGSVHVEVTFKTIVSGK
KMPTWFTIIPSTIPLEPKQSKTVQFRIFIDSHHVSNFNRDIEKFNCQIIC
ASILNGADTPLTFNAKYHLNIFGLHLGVLRFIDRPIDTYTPKEIIQIESS
KNIKSFTIFITSTLLDRIIYVLMPKIQFDFKSFEDVILRDPCNINDVREL
IKRVNDTTKIDLTFPLEKTTFSLSTHMETIMIFMKSLPQPIIPFVVQARL
SSFYNDRHHILNVLHNLPKTNILFLRRLLHYLHGFILKPSDIEIIANFVV
SCIPPSNPSLKNPLVSVIAFLTEKPNML*
back to top

protein sequence of SMED30001437-orf-2

>SMED30001437-orf-2 ID=SMED30001437-orf-2|Name=SMED30001437-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
PINILEFHASIMDSKVKFLNHSGSEESTLTETQYENTFLGTFLVRVCSYN
VNCKFSKNEMYEKWLKDEKSPDIIAIGFQELYFKLVDIVAPDTIQNVDIA
PHKRWLDFFLCWIKFICISAKILE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR000300IPPc
IPR005135Endo/exonuclease/phosphatase
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0046856phosphatidylinositol dephosphorylation
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 17..39