Xaa-Pro dipeptidase

Overview
NameXaa-Pro dipeptidase
Smed IDSMED30001419
Length (bp)1641
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Xaa-Pro dipeptidase (SMED30001419) t-SNE clustered cells

Violin plots show distribution of expression levels for Xaa-Pro dipeptidase (SMED30001419) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Xaa-Pro dipeptidase (SMED30001419) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Xaa-Pro dipeptidase (SMED30001419) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001419

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001419SMESG000068156.1 SMESG000043474.1 SMESG000010609.1 SMESG000076470.1 SMESG000073857.1 SMESG000062429.1 SMESG000058575.1 SMESG000053533.1 SMESG000020635.1 SMESG000015751.1 SMESG000005260.1 Contig244GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001419SMESG000012999.1 Contig244GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30001419SMESG000012999.1 dd_Smed_v4_1297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30001419SMESG000012999.1 dd_Smed_v4_1297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001419SMESG000012999.1 dd_Smed_v4_1297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30001419SMESG000012999.1 dd_Smed_v4_1297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30001419SMESG000012999.1 dd_Smed_v4_1297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001419SMESG000012999.1 dd_Smed_v4_1297_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Xaa-Pro dipeptidase vs. Ensembl Human
Match: PEPD (peptidase D [Source:HGNC Symbol;Acc:HGNC:8840])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 276/480 (57.50%), Postives = 349/480 (72.71%), Query Frame = 3
Query:   57 TVPIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVD 1493
            T P + LG + L VP+ L   NR RL  R++     +  S ++L+GG E     +D+ ++FRQES+FHW FGV EP  YG+ID+D+GKS LF+PRL   +AT+MG++ + +  K KYAVD V YVDEIA VL +   SV+ TL G+NTDS +   EASF GI+ F V+N++LH EI +CRV KTD ELEVLRY NK SS+AHRE+M++V  GM EY++ESLF H+CY  G MR+ +Y+ I  +G N +VLHYGHAGAPNDR I++GDMCLFDMGGEYYC+ SDITCSFP NG+FT DQ+ VYEAVL +S AV  A KPGV W DMH LA+R  L  L   G+L G VD M+   LG++FMPHGLGH +GIDVHDVGGY E  V R + PGL+SLRT R L+  MVLT+EPG YFI+ LL+ A+ +P  + FL  + + RFRGFGGVRIE+DV++TD GIE +T VPRT EEIE  M+G D
Sbjct:    5 TGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPE-GVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCD 483          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Human
Match: PEPD (peptidase D [Source:HGNC Symbol;Acc:HGNC:8840])

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 276/502 (54.98%), Postives = 349/502 (69.52%), Query Frame = 3
Query:   57 TVPIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKP----------------------GVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVD 1493
            T P + LG + L VP+ L   NR RL  R++     +  S ++L+GG E     +D+ ++FRQES+FHW FGV EP  YG+ID+D+GKS LF+PRL   +AT+MG++ + +  K KYAVD V YVDEIA VL +   SV+ TL G+NTDS +   EASF GI+ F V+N++LH EI +CRV KTD ELEVLRY NK SS+AHRE+M++V  GM EY++ESLF H+CY  G MR+ +Y+ I  +G N +VLHYGHAGAPNDR I++GDMCLFDMGGEYYC+ SDITCSFP NG+FT DQ+ VYEAVL +S AV  A KP                      GV W DMH LA+R  L  L   G+L G VD M+   LG++FMPHGLGH +GIDVHDVGGY E  V R + PGL+SLRT R L+  MVLT+EPG YFI+ LL+ A+ +P  + FL  + + RFRGFGGVRIE+DV++TD GIE +T VPRT EEIE  M+G D
Sbjct:    2 TGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGARTGRTVFSVGTMSTPPAGRNGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPE-GVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCD 502          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Human
Match: PEPD (peptidase D [Source:HGNC Symbol;Acc:HGNC:8840])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 276/510 (54.12%), Postives = 349/510 (68.43%), Query Frame = 3
Query:   57 TVPIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGG------------------------------VRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVD 1493
            T P + LG + L VP+ L   NR RL  R++     +  S ++L+GG E     +D+ ++FRQES+FHW FGV EP  YG+ID+D+GKS LF+PRL   +AT+MG++ + +  K KYAVD V YVDEIA VL +   SV+ TL G+NTDS +   EASF GI+ F V+N++LH EI +CRV KTD ELEVLRY NK SS+AHRE+M++V  GM EY++ESLF H+CY  G MR+ +Y+ I  +G N +VLHYGHAGAPNDR I++GDMCLFDMGGEYYC+ SDITCSFP NG+FT DQ+ VYEAVL +S AV  A KPGV W DMH LA+R  L  L   G+L G VD M+   LG++FMPHGLGH +GIDVHDVGGY E  V R + PGL+SLRT R L+  MVLT+EPG YFI+ LL+ A+ +P  + FL  + + RFRGFGG                              VRIE+DV++TD GIE +T VPRT EEIE  M+G D
Sbjct:    4 TGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPE-GVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGDGASPLSRNRQRSCKTPARSRGSHPPGKDRVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCD 512          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Human
Match: PEPD (peptidase D [Source:HGNC Symbol;Acc:HGNC:8840])

HSP 1 Score: 488.034 bits (1255), Expect = 4.437e-169
Identity = 248/480 (51.67%), Postives = 315/480 (65.62%), Query Frame = 3
Query:   57 TVPIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVD 1493
            T P + LG + L VP+ L   NR RL  R++     +  S ++L+GG E     +D+ ++FRQES+FHW FGV EP  YG+ID+D+GKS LF+PRL   +AT+MG++ + +  K KYAVD V YVDEIA VL +   SV+ TL G+NTDS +   EASF GI+ F V+N++LH EI +C                                         LF H+CY  G MR+ +Y+ I  +G N +VLHYGHAGAPNDR I++GDMCLFDMGGEYYC+ SDITCSFP NG+FT DQ+ VYEAVL +S AV  A KPGV W DMH LA+R  L  L   G+L G VD M+   LG++FMPHGLGH +GIDVHDVGGY E  V R + PGL+SLRT R L+  MVLT+EPG YFI+ LL+ A+ +P  + FL  + + RFRGFGGVRIE+DV++TD GIE +T VPRT EEIE  M+G D
Sbjct:    5 TGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVEC-----------------------------------------LFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPE-GVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCD 442          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Human
Match: PEPD (peptidase D [Source:HGNC Symbol;Acc:HGNC:8840])

HSP 1 Score: 446.047 bits (1146), Expect = 5.458e-153
Identity = 218/366 (59.56%), Postives = 269/366 (73.50%), Query Frame = 3
Query:  396 HKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVD 1493
             +Y  D      +IA VL +   SV+ TL G+NTDS +   EASF GI+ F V+N++LH EI +CRV KTD ELEVLRY NK SS+AHRE+M++V  GM EY++ESLF H+CY  G MR+ +Y+ I  +G N +VLHYGHAGAPNDR I++GDMCLFDMGGEYYC+ SDITCSFP NG+FT DQ+ VYEAVL +S AV  A KPGV W DMH LA+R  L  L   G+L G VD M+   LG++FMPHGLGH +GIDVHDVGGY E  V R + PGL+SLRT R L+  MVLT+EPG YFI+ LL+ A+ +P  + FL  + + RFRGFGGVRIE+DV++TD GIE +T VPRT EEIE  M+G D
Sbjct:   55 QRYCTDTGVLFRQIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPE-GVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCD 419          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Celegans
Match: K12C11.1 (pep chromosome:WBcel235:I:1341218:1344692:-1 gene:WBGene00019673.1 transcript:K12C11.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K12C11.1)

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 266/478 (55.65%), Postives = 345/478 (72.18%), Query Frame = 3
Query:   69 YQLGDG-LPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSA-LIFRQESYFHWTFGVLEPDFYGLIDIDSG-KSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDE---IADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            +QL +    VP+ L  +NR RL++ +KSK     NS +LL+GG E     +D+A L FRQESYF WTFGV E +FYG ID+ SG K+ LF PRL   YA + G++      K KYAVD V + D+   IA+ LK L+   ++ L   NTDS +   E  F G  +F +D  +L+ E+ + RV+KT++E+ V+RYA+K +S+AHR  M+ + PG+YEYQ+ESLF H  Y+HG  R++AY+ I ATGCN SVLHYGHA APND+ I+DGDMCLFDMG EY CY SDIT SFP NG+FT+ Q+IVY AVLAA+ AV  A KPGV W DMH L+E+ IL HLK AGL+ GD+DK +  R+G++FMPHGLGHL+G+DVHD GGY+ DA PRS LPGLKSLRTTR L + M +TIEPGCYFI+FLL  A+ +P+ SEFL+  EI+++RG GGVRIEDDVII   G E ++++PRT EEIE +M+
Sbjct:    3 FQLSEKTFKVPVDLFTENRHRLVDALKSKV--PANSVVLLQGGVEKNRYNTDAADLPFRQESYFFWTFGVNESEFYGAIDVRSGGKTTLFAPRLDPSYAIWDGKINNEQFFKEKYAVDEVVFNDKTTTIAEKLKELSAKHVYLLRAENTDSGDVLAEPKFAGSGDFQLDTELLYKEMAELRVVKTEKEIGVMRYASKIASEAHRAAMKHMRPGLYEYQLESLFRHTSYYHGGCRHLAYTCIAATGCNGSVLHYGHANAPNDKFIKDGDMCLFDMGPEYNCYASDITTSFPSNGKFTEKQKIVYNAVLAANLAVLKAAKPGVRWTDMHILSEKVILEHLKQAGLIVGDIDKAVEARVGAVFMPHGLGHLIGLDVHDCGGYMGDATPRSTLPGLKSLRTTRTLMERMAITIEPGCYFIDFLLNEALADPKKSEFLVKSEIDKYRGSGGVRIEDDVIIRASGNENLSDLPRTVEEIENFMA 478          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Celegans
Match: K12C11.1 (pep chromosome:WBcel235:I:1341220:1342696:-1 gene:WBGene00019673.1 transcript:K12C11.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K12C11.1)

HSP 1 Score: 293.123 bits (749), Expect = 1.594e-96
Identity = 136/210 (64.76%), Postives = 167/210 (79.52%), Query Frame = 3
Query:  855 MCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            MCLFDMG EY CY SDIT SFP NG+FT+ Q+IVY AVLAA+ AV  A KPGV W DMH L+E+ IL HLK AGL+ GD+DK +  R+G++FMPHGLGHL+G+DVHD GGY+ DA PRS LPGLKSLRTTR L + M +TIEPGCYFI+FLL  A+ +P+ SEFL+  EI+++RG GGVRIEDDVII   G E ++++PRT EEIE +M+
Sbjct:    1 MCLFDMGPEYNCYASDITTSFPSNGKFTEKQKIVYNAVLAANLAVLKAAKPGVRWTDMHILSEKVILEHLKQAGLIVGDIDKAVEARVGAVFMPHGLGHLIGLDVHDCGGYMGDATPRSTLPGLKSLRTTRTLMERMAITIEPGCYFIDFLLNEALADPKKSEFLVKSEIDKYRGSGGVRIEDDVIIRASGNENLSDLPRTVEEIENFMA 210          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Celegans
Match: R119.2 (pep chromosome:WBcel235:I:368370:373445:-1 gene:WBGene00020088.1 transcript:R119.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R119.2)

HSP 1 Score: 91.2781 bits (225), Expect = 2.204e-19
Identity = 122/490 (24.90%), Postives = 188/490 (38.37%), Query Frame = 3
Query:   78 GDGLP-----VPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFY-----GLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYT-IEA---SFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNV---AYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERS---ILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITD-DGIECMT-EVPRTCEEIELWM 1481
            G  LP     +P   +   R+ L+N +K +        +++  G+   +   D    FRQ+S+F +  G+  PD Y     G+ +     + LF  R S     + G L T  + +             I   L+ +        +   +D   Y  ++A   S   IN+F          I   RVIK+  E+  +R      ++     M S+  G  +   E+       F G  R     AY  + A G   + +HY  A   ND  +   +  L D G +   YVSD+T  FP++G ++  Q  +YEA+L     +       +  + +  L  R    +       GL+R    K M +       PH + H +G+DVHD      D     +LP             N+  TIEPG Y         M  P          +  FRG  G RIEDDV  ++  GIE +T  VPR   EI+  M
Sbjct:    5 GRSLPMWPSRIPNEEYAMRRTNLMNLLKKEVKTGEKQVVVVMKGARKSYIAPDVPHAFRQKSHFRYLNGITTPDCYYIMQSGISESSKETNILFADRRSAYDELWEGALPTESEWEKTAKFTECVPTSRILQTLEKVCDKGTAVFFDSTSDDLLYKFVQAKANSVREINHF----------IERRRVIKSPSEMSSMRDVCNVGAQT----MSSMISGSRDLHNENAICGLLEFEGRRRGSEMQAYPPVIAGGVRANTIHYLDAN--ND--LNPRECVLVDAGCDLNGYVSDVTRCFPISGFWSDAQLSLYEALLYVHEELLTYAH-SMEKVRLSALFRRMNELLAASFTELGLIRSTDHKEM-IHQAEKLCPHHVSHYLGMDVHDCPTVSRDI----DLP------------PNVPFTIEPGVYV-------PMDWP----------VKEFRGI-GYRIEDDVATSEAGGIELLTAAVPRDPIEIQRLM 440          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Fly
Match: Dip-C (gene:FBgn0000455 transcript:FBtr0344982)

HSP 1 Score: 467.233 bits (1201), Expect = 1.068e-160
Identity = 230/481 (47.82%), Postives = 313/481 (65.07%), Query Frame = 3
Query:   69 YQLGDGLPVPMTLHQQNRSR-----LINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDID----SGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            +Q+G G  VPMTL + NR R     L   +     N  N  +LL+GG +     +D   +FRQESYF + FGV EP  YG++ ID    + KS LF+PR  + Y T+MGEL  + + K  Y VD V+YVDE++  L+  +  +I TL G N+DS        F G   +  D ++L+  +++CRVIK+ +E+EVLRY  K SS AH ++MR + PG  E++ ESLFLHH Y  G  R+ +Y+ I  +G N S+LHYGHAGAPN + ++DGD+CLFDMG  Y  Y +DITC+FP NG+FT DQ+ +Y AVL A +AV  + + GVSW+DMH LA R +L  LK  G+L+GDV++M+   +  +F PHGLGHL+G+DVHDVGGY+     R   P L  LR  RILK  M +TIEPGCYFIN+L++ A+ +P  ++F+  +  NRFR FGGVRIEDDV+IT  G+E    VPRT E+IE  M+
Sbjct:    4 FQMGSGYAVPMTLFRNNRDRAGKAILKELLPGLKFNDGNLLVLLEGGKDQSLYNTDVDYVFRQESYFQYLFGVKEPGCYGILTIDVKTGAQKSVLFVPRFPDEYGTWMGELLGLQEFKAMYEVDEVFYVDEMSVYLEGASPKLILTLSGTNSDSGLTLQPPDFAGKEKYVTDCNLLYPILSECRVIKSPEEIEVLRYVAKVSSDAHIKVMRFMRPGRMEFEGESLFLHHAYSVGGCRHASYTCICGSGTNSSILHYGHAGAPNSKPVQDGDLCLFDMGANYCGYAADITCTFPANGKFTDDQKFIYNAVLDARNAVTESARDGVSWVDMHKLAGRVLLQRLKEGGMLKGDVEEMLEAGVSGVFQPHGLGHLIGLDVHDVGGYLPKEPKRPSEPWLSKLRFARILKAGMYVTIEPGCYFINWLMDRALADPNIAKFINAEMFNRFRNFGGVRIEDDVLITKTGVENFAIVPRTVEDIEATMT 484          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Fly
Match: Dip-C (gene:FBgn0000455 transcript:FBtr0082597)

HSP 1 Score: 467.233 bits (1201), Expect = 1.068e-160
Identity = 230/481 (47.82%), Postives = 313/481 (65.07%), Query Frame = 3
Query:   69 YQLGDGLPVPMTLHQQNRSR-----LINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDID----SGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            +Q+G G  VPMTL + NR R     L   +     N  N  +LL+GG +     +D   +FRQESYF + FGV EP  YG++ ID    + KS LF+PR  + Y T+MGEL  + + K  Y VD V+YVDE++  L+  +  +I TL G N+DS        F G   +  D ++L+  +++CRVIK+ +E+EVLRY  K SS AH ++MR + PG  E++ ESLFLHH Y  G  R+ +Y+ I  +G N S+LHYGHAGAPN + ++DGD+CLFDMG  Y  Y +DITC+FP NG+FT DQ+ +Y AVL A +AV  + + GVSW+DMH LA R +L  LK  G+L+GDV++M+   +  +F PHGLGHL+G+DVHDVGGY+     R   P L  LR  RILK  M +TIEPGCYFIN+L++ A+ +P  ++F+  +  NRFR FGGVRIEDDV+IT  G+E    VPRT E+IE  M+
Sbjct:    4 FQMGSGYAVPMTLFRNNRDRAGKAILKELLPGLKFNDGNLLVLLEGGKDQSLYNTDVDYVFRQESYFQYLFGVKEPGCYGILTIDVKTGAQKSVLFVPRFPDEYGTWMGELLGLQEFKAMYEVDEVFYVDEMSVYLEGASPKLILTLSGTNSDSGLTLQPPDFAGKEKYVTDCNLLYPILSECRVIKSPEEIEVLRYVAKVSSDAHIKVMRFMRPGRMEFEGESLFLHHAYSVGGCRHASYTCICGSGTNSSILHYGHAGAPNSKPVQDGDLCLFDMGANYCGYAADITCTFPANGKFTDDQKFIYNAVLDARNAVTESARDGVSWVDMHKLAGRVLLQRLKEGGMLKGDVEEMLEAGVSGVFQPHGLGHLIGLDVHDVGGYLPKEPKRPSEPWLSKLRFARILKAGMYVTIEPGCYFINWLMDRALADPNIAKFINAEMFNRFRNFGGVRIEDDVLITKTGVENFAIVPRTVEDIEATMT 484          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Fly
Match: CG9581 (gene:FBgn0031093 transcript:FBtr0070026)

HSP 1 Score: 126.716 bits (317), Expect = 8.780e-31
Identity = 126/501 (25.15%), Postives = 215/501 (42.91%), Query Frame = 3
Query:   93 VPMTLHQQNRSRLINRMKSK--------NNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSF------------------------LFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAV-LAASSAVKNACKPGVSWLDMHCLAERS---ILTHLKGAGLLRGDVDKMMA-VRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDG-IECMTEV----PRTCEEI 1469
            V +T  ++ RS+L+  +++         N +  + ++L+ G +   +       +FRQ S F++  G LEPD   L+ ID  ++                         L +P      A  + +LE V   +      H+++  +  D+      S+   +  L+ + Q   + A               +  +   R++K+  E++++R     +S++  E+M    PG  E+ + +   + C    A   +AY  + A G N +V+HY      N + +   D+ L D G EY  Y SDIT ++P +G FT+ QR +Y+ +       + N  KPG   LD   L E +   +  +L+  GL+     +    V  G  F PH + H +G+DVHD        VPR+          TRI+   MV T+EPG Y      +     PE            FRG  G+RIEDD++I ++G +E +TE     PR  +E+
Sbjct:   88 VELTEIKERRSQLMQNIRAYARSFGGEFNGHSSSCHMLVLGAASKKYMSGKIPYVFRQNSDFYYLTGCLEPDAVLLLTIDEAQNVQSELFMRPKDPHAELWDGPRTGPELAVPLFGVTEAHPLSQLEAVLAKRAGALKPHIWFDQKSTDL-----PSLAENMLRLSGNQQRPLLPA---------------YTFLEAMRLLKSRDEMQLMRRTCDIASRSFNEVMAETRPGQSEHHLFAAIDYKCRMRNA-SYLAYPPVVAAGKNATVIHY----VANSQLLGQQDLVLMDAGCEYGGYTSDITRTWPASGVFTEPQRTLYDMLHQLQEEIIGNVMKPGGETLDQ--LFETTCYKLGKYLQEIGLVGKSFSEYKELVSQGYRFCPHHVSHYLGMDVHDT-----PHVPRN----------TRIV-PGMVFTVEPGIYIGQ---DCGDVPPE------------FRGI-GIRIEDDLLINENGHVEVLTEACVKDPRALQEL 529          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Zebrafish
Match: pepd (peptidase D [Source:ZFIN;Acc:ZDB-GENE-030131-9444])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 274/482 (56.85%), Postives = 347/482 (71.99%), Query Frame = 3
Query:   42 MAVRRTVPIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            MA  +   +Y LG D L V   L   NR RL   +K+  + +  S ++L+GG +     +D+   FRQES+FHW+FGV E D YG ID+DS KS LF+P+L E YAT+MGE+      K KYAVD V++  +IADVL  +  SV+ TL GLNTDS +   EASF GI+ F V+NS+LH  I +CR++KTD ELEVLRY N+ SS+AH+E+MR V PG+ EY++ESLF H+CY  G MR+ +Y+ I  +G N S+LHYGHAGAPND+ I+DGDMCLFDMGGEYYCY SDITCSFP NG+FT DQR +YEAVL +S AV  A KPGV W DMH LA+R  L  L   G+L GDV++M+ V LGS+FMPHGLGHL+GIDVHDVGGY E  V R + PGLKSLR  R++++ MVLT+EPG YFIN LL+ A+ +P    F+    + RFRGFGGVRIEDD+ +T DG+E +T VPRT EEIE +M+
Sbjct:    1 MASSQQKAVYWLGNDTLRVSAALFALNRERLCVGLKALPDLQAGSVVVLQGGEQKQRYCTDTDETFRQESFFHWSFGVTEADCYGAIDVDSKKSLLFVPKLPESYATWMGEIFPPGHFKEKYAVDEVHFTTDIADVLAKMKPSVLLTLRGLNTDSGSTCREASFEGISRFEVNNSLLHPVIVECRLLKTDMELEVLRYTNRISSEAHKEVMRRVKPGLKEYEMESLFQHYCYSRGGMRHTSYTCICGSGNNSSILHYGHAGAPNDKTIQDGDMCLFDMGGEYYCYSSDITCSFPANGKFTADQRAIYEAVLKSSRAVMAAIKPGVKWTDMHRLADRVHLEELLKIGILHGDVEEMLKVHLGSVFMPHGLGHLLGIDVHDVGGYPE-GVERVDEPGLKSLRMGRVVQERMVLTVEPGIYFINHLLDKALASPAQCGFINTAVLTRFRGFGGVRIEDDIAVTADGVELLTCVPRTVEEIEAFMA 481          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Zebrafish
Match: xpnpep3 (X-prolyl aminopeptidase 3, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-040426-2076])

HSP 1 Score: 159.458 bits (402), Expect = 3.071e-42
Identity = 136/475 (28.63%), Postives = 216/475 (45.47%), Query Frame = 3
Query:  105 LHQQNRSRLIN----RMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPD----FYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASF--PGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDG---------IECMTEVPRTCEEIE 1472
            L +Q  + LI     R      +  +S+I++     + +  +D    F Q   F +  G+ EPD     YG    D  ++ LF+PR       + G     D       ++ V+  +E+  VLK++      T++  N+   +  +  +   P +    +  S L       R IK+  E+ +++ A + +++A ++ M      + E  + + F + C  HGA   +AY  + A G   + LHY +    N++ ++DG+M L D G EY+ YVSDIT ++PVNG+F+  QR +YEAVL    A  + C PGVS   ++      +   LK  G+L        A++    F PH +GH +G+DVHD                   L  ++ L+  MV+TIEPG Y    + E     PE           RFRG  GVRIEDDV+I D G          + ++EV RTC   E
Sbjct:   78 LRRQRLASLIEIQAERQTGSGASSNSSHIVIILSHPIRYMSNDIPYPFHQNQDFLYLTGITEPDSALVMYGSSKPD--QAVLFVPRRDPARELWDGPRSGKDGAAALTGLERVHSTEELGVVLKSIKGG---TVWYDNSQPCHPRLHQTHVRPLLEGGQLVKS-LRPLTHSLRAIKSPAEVALMKEAGRITAQAFKKTMAMSRGNIDEAVLYAKFDYECRAHGA-NFLAYPPVVAGGNRANTLHYIN----NNQIVKDGEMVLLDGGCEYFGYVSDITRTWPVNGKFSAAQRELYEAVLEVQLACLSQCSPGVSLDYIYSTMLTLLARQLKELGILPSHASDTDAMKAARQFCPHHVGHYLGMDVHDT----------------PELSRSQPLQPGMVITIEPGLY----ISEDNRSCPE-----------RFRGL-GVRIEDDVVIRDHGGPLILSANTPKTISEVERTCAHAE 509          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Xenopus
Match: zc3h15 (zinc finger CCCH-type containing 15 [Source:Xenbase;Acc:XB-GENE-5800360])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 267/475 (56.21%), Postives = 345/475 (72.63%), Query Frame = 3
Query:   63 PIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            P Y LG + L VP  L   NR RL +R+K   +    S +LL+GG E     +D+ ++FRQES+FHWTFGV E   YG +D+D GKS LFIP+L E YA +MG++   +  K KYA+D +Y+  +I+ VLK    SV+ TL G+NTDS +   EASF GI+ ++V+N++LH EI +CRV KTD ELEVLRY N+ SS+AH+E+M++   GM EY++ES+FLH+CY  G MR+ +Y+ I  +G N SVLHYGHAGAPND+ + DG+MCLFDMGGEYYCY SDITCSFP NG+FT DQR VYEAVL +S AV  A KPGV+W DMH LA+R  L  L   G+L+G+VD M+   +G++FMPHGLGH +GIDVHDVGGY E  V R +LPGLKSLRT R L++ MVLTIEPG YFI+ +L+ A+ NP  S F+    + RFRGFGGVRIEDD+ +  +G+E +T VPRT EEIE +M+
Sbjct:    7 PSYWLGNETLRVPAALFALNRKRLCDRLKQNKDVPKGSIVLLQGGEETQRYCTDTGILFRQESFFHWTFGVTESGCYGAVDVDKGKSILFIPKLPESYAVWMGKIHPPEHFKEKYAIDEIYFTCDISSVLKAKTPSVLLTLRGVNTDSGSVCKEASFEGISEYSVNNTLLHPEIVECRVFKTDMELEVLRYTNRISSEAHKEVMKAARIGMKEYELESVFLHYCYARGGMRHTSYTCICGSGENSSVLHYGHAGAPNDKTLMDGNMCLFDMGGEYYCYSSDITCSFPANGKFTPDQRAVYEAVLKSSRAVMKAVKPGVAWPDMHRLADRVHLEELTKIGILKGNVDDMIKAHMGAVFMPHGLGHFLGIDVHDVGGYPE-GVDRVDLPGLKSLRTARTLQERMVLTIEPGIYFIDHVLDEALANPSQSCFINNAVLQRFRGFGGVRIEDDIAVAANGMELLTCVPRTVEEIESFMA 480          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Xenopus
Match: zc3h15 (zinc finger CCCH-type containing 15 [Source:Xenbase;Acc:XB-GENE-5800360])

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 261/475 (54.95%), Postives = 335/475 (70.53%), Query Frame = 3
Query:   63 PIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            P Y LG + L VP  L   NR RL +R+K   +    S +LL+GG E     +D+ ++FRQES+FHWTFGV E   YG +D+D GKS LFIP+L E YA +MG++   +  K KYA+D +Y+  +I+ VLK    SV+ TL G+NTDS +   EASF GI+    +   +     D RV KTD ELEVLRY N+ SS+AH+E+M++   GM EY++ES+FLH+CY  G MR+ +Y+ I  +G N SVLHYGHAGAPND+ + DG+MCLFDMGGEYYCY SDITCSFP NG+FT DQR VYEAVL +S AV  A KPGV+W DMH LA+R  L  L   G+L+G+VD M+   +G++FMPHGLGH +GIDVHDVGGY E  V R +LPGLKSLRT R L++ MVLTIEPG YFI+ +L+ A+ NP  S F+    + RFRGFGGVRIEDD+ +  +G+E +T VPRT EEIE +M+
Sbjct:   13 PSYWLGNETLRVPAALFALNRKRLCDRLKQNKDVPKGSIVLLQGGEETQRYCTDTGILFRQESFFHWTFGVTESGCYGAVDVDKGKSILFIPKLPESYAVWMGKIHPPEHFKEKYAIDEIYFTCDISSVLKAKTPSVLLTLRGVNTDSGSVCKEASFEGISE---NIYFISFTFFDSRVFKTDMELEVLRYTNRISSEAHKEVMKAARIGMKEYELESVFLHYCYARGGMRHTSYTCICGSGENSSVLHYGHAGAPNDKTLMDGNMCLFDMGGEYYCYSSDITCSFPANGKFTPDQRAVYEAVLKSSRAVMKAVKPGVAWPDMHRLADRVHLEELTKIGILKGNVDDMIKAHMGAVFMPHGLGHFLGIDVHDVGGYPE-GVDRVDLPGLKSLRTARTLQERMVLTIEPGIYFIDHVLDEALANPSQSCFINNAVLQRFRGFGGVRIEDDIAVAANGMELLTCVPRTVEEIESFMA 483          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Xenopus
Match: zc3h15 (zinc finger CCCH-type containing 15 [Source:Xenbase;Acc:XB-GENE-5800360])

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 262/475 (55.16%), Postives = 338/475 (71.16%), Query Frame = 3
Query:   63 PIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            P Y LG + L VP  L   NR RL +R+K   +    S +LL+GG E     +D+ ++FRQES+FHWTFGV E   YG +D+D GKS LFIP+L E YA +MG++   +  K KYA+D +Y+  +I+ VLK    SV+ TL G+NTDS +   EASF GI+ ++V+N++LH EI +CRV KTD ELEVLRY N+ SS+AH+E+ R      + +   S+FLH+CY  G MR+ +Y+ I  +G N SVLHYGHAGAPND+ + DG+MCLFDMGGEYYCY SDITCSFP NG+FT DQR VYEAVL +S AV  A KPGV+W DMH LA+R  L  L   G+L+G+VD M+   +G++FMPHGLGH +GIDVHDVGGY E  V R +LPGLKSLRT R L++ MVLTIEPG YFI+ +L+ A+ NP  S F+    + RFRGFGGVRIEDD+ +  +G+E +T VPRT EEIE +M+
Sbjct:   13 PSYWLGNETLRVPAALFALNRKRLCDRLKQNKDVPKGSIVLLQGGEETQRYCTDTGILFRQESFFHWTFGVTESGCYGAVDVDKGKSILFIPKLPESYAVWMGKIHPPEHFKEKYAIDEIYFTCDISSVLKAKTPSVLLTLRGVNTDSGSVCKEASFEGISEYSVNNTLLHPEIVECRVFKTDMELEVLRYTNRISSEAHKEVNRFFK-MSFFFVFCSVFLHYCYARGGMRHTSYTCICGSGENSSVLHYGHAGAPNDKTLMDGNMCLFDMGGEYYCYSSDITCSFPANGKFTPDQRAVYEAVLKSSRAVMKAVKPGVAWPDMHRLADRVHLEELTKIGILKGNVDDMIKAHMGAVFMPHGLGHFLGIDVHDVGGYPE-GVDRVDLPGLKSLRTARTLQERMVLTIEPGIYFIDHVLDEALANPSQSCFINNAVLQRFRGFGGVRIEDDIAVAANGMELLTCVPRTVEEIESFMA 485          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Xenopus
Match: zc3h15 (zinc finger CCCH-type containing 15 [Source:Xenbase;Acc:XB-GENE-5800360])

HSP 1 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 262/475 (55.16%), Postives = 338/475 (71.16%), Query Frame = 3
Query:   63 PIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            P Y LG + L VP  L   NR RL +R+K   +    S +LL+GG E     +D+ ++FRQES+FHWTFGV E   YG +D+D GKS LFIP+L E YA +MG++   +  K KYA+D +Y+  +I+ VLK    SV+ TL G+NTDS +   EASF GI+ ++V+N++LH EI +CRV KTD ELEVLRY N+ SS+AH+E+ R      + +   S+FLH+CY  G MR+ +Y+ I  +G N SVLHYGHAGAPND+ + DG+MCLFDMGGEYYCY SDITCSFP NG+FT DQR VYEAVL +S AV  A KPGV+W DMH LA+R  L  L   G+L+G+VD M+   +G++FMPHGLGH +GIDVHDVGGY E  V R +LPGLKSLRT R L++ MVLTIEPG YFI+ +L+ A+ NP  S F+    + RFRGFGGVRIEDD+ +  +G+E +T VPRT EEIE +M+
Sbjct:   12 PSYWLGNETLRVPAALFALNRKRLCDRLKQNKDVPKGSIVLLQGGEETQRYCTDTGILFRQESFFHWTFGVTESGCYGAVDVDKGKSILFIPKLPESYAVWMGKIHPPEHFKEKYAIDEIYFTCDISSVLKAKTPSVLLTLRGVNTDSGSVCKEASFEGISEYSVNNTLLHPEIVECRVFKTDMELEVLRYTNRISSEAHKEVNRFFK-MSFFFVFCSVFLHYCYARGGMRHTSYTCICGSGENSSVLHYGHAGAPNDKTLMDGNMCLFDMGGEYYCYSSDITCSFPANGKFTPDQRAVYEAVLKSSRAVMKAVKPGVAWPDMHRLADRVHLEELTKIGILKGNVDDMIKAHMGAVFMPHGLGHFLGIDVHDVGGYPE-GVDRVDLPGLKSLRTARTLQERMVLTIEPGIYFIDHVLDEALANPSQSCFINNAVLQRFRGFGGVRIEDDIAVAANGMELLTCVPRTVEEIESFMA 484          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Xenopus
Match: zc3h15 (zinc finger CCCH-type containing 15 [Source:Xenbase;Acc:XB-GENE-5800360])

HSP 1 Score: 510.76 bits (1314), Expect = 1.280e-177
Identity = 254/476 (53.36%), Postives = 331/476 (69.54%), Query Frame = 3
Query:   60 VPIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            +P Y LG + L VP  L   NR RL +R+K   +    S +LL+GG E     +D+ ++FRQES+FHWTFGV E   YG +D+D GKS LFIP+L E YA +MG++   +  K KYA+D +Y+  ++             +  G+NTDS +   EASF GI+ ++V+N++LH EI +CRV KTD ELEVLRY N+ SS+AH+E+ R      + +   S+FLH+CY  G MR+ +Y+ I  +G N SVLHYGHAGAPND+ + DG+MCLFDMGGEYYCY SDITCSFP NG+FT DQR VYEAVL +S AV  A KPGV+W DMH LA+R  L  L   G+L+G+VD M+   +G++FMPHGLGH +GIDVHDVGGY E  V R +LPGLKSLRT R L++ MVLTIEPG YFI+ +L+ A+ NP  S F+    + RFRGFGGVRIEDD+ +  +G+E +T VPRT EEIE +M+
Sbjct:    1 IPSYWLGNETLRVPAALFALNRKRLCDRLKQNKDVPKGSIVLLQGGEETQRYCTDTGILFRQESFFHWTFGVTESGCYGAVDVDKGKSILFIPKLPESYAVWMGKIHPPEHFKEKYAIDEIYFTCDV-------------STRGVNTDSGSVCKEASFEGISEYSVNNTLLHPEIVECRVFKTDMELEVLRYTNRISSEAHKEVNRFFK-MSFFFVFCSVFLHYCYARGGMRHTSYTCICGSGENSSVLHYGHAGAPNDKTLMDGNMCLFDMGGEYYCYSSDITCSFPANGKFTPDQRAVYEAVLKSSRAVMKAVKPGVAWPDMHRLADRVHLEELTKIGILKGNVDDMIKAHMGAVFMPHGLGHFLGIDVHDVGGYPE-GVDRVDLPGLKSLRTARTLQERMVLTIEPGIYFIDHVLDEALANPSQSCFINNAVLQRFRGFGGVRIEDDIAVAANGMELLTCVPRTVEEIESFMA 461          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Mouse
Match: Pepd (peptidase D [Source:MGI Symbol;Acc:MGI:97542])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 270/478 (56.49%), Postives = 349/478 (73.01%), Query Frame = 3
Query:   63 PIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVD 1493
            P + LG + L VP+ L   NR RL  R++     +  S ++L+GG EM    +D+++IFRQES+FHW FGV+E   YG+ID+D+GKS LF+PRL + YAT+MG++ + +  K KYAVD V Y DEIA VL + N SV+ TL G+NTDS +   EASF GI+ F V+N++LH EI +CRV KTD ELEVLRY N+ SS+AHRE+M++V  GM EY++ESLF H+CY  G MR+ +Y+ I  +G N +VLHYGHAGAPNDR I+DGD+CLFDMGGEYYC+ SDITCSFP NG+FT+DQ+ +YEAVL +   V +  KPGV W DMH LA+R  L  L   GLL G VD M+ V LG++FMPHGLGH +G+DVHDVGGY E  V R + PGL+SLRT R L+  MVLT+EPG YFI+ LL+ A+ +P  + F   + + RFR FGGVRIE+DV++TD G+E +T VPRT EEIE  M+G D
Sbjct:    7 PSFSLGNETLKVPLALFALNRQRLCERLRKNGAVQAASAVVLQGGEEMQRYCTDTSIIFRQESFFHWAFGVVESGCYGVIDVDTGKSTLFVPRLPDSYATWMGKIHSKEYFKEKYAVDDVQYTDEIASVLTSRNPSVLLTLRGVNTDSGSVCREASFEGISKFNVNNTILHPEIVECRVFKTDMELEVLRYTNRISSEAHREVMKAVKVGMKEYEMESLFQHYCYSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGEYYCFASDITCSFPANGKFTEDQKAIYEAVLRSCRTVMSTMKPGVWWPDMHRLADRIHLEELARIGLLSGSVDAMLQVHLGAVFMPHGLGHFLGLDVHDVGGYPE-GVERIDEPGLRSLRTARHLEPGMVLTVEPGIYFIDHLLDQALADPAQACFFNQEVLQRFRNFGGVRIEEDVVVTDSGMELLTCVPRTVEEIEACMAGCD 483          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Mouse
Match: Xpnpep3 (X-prolyl aminopeptidase 3, mitochondrial [Source:MGI Symbol;Acc:MGI:2445217])

HSP 1 Score: 159.073 bits (401), Expect = 3.473e-42
Identity = 133/438 (30.37%), Postives = 195/438 (44.52%), Query Frame = 3
Query:  204 YHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGK------SFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYG--------LNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMT-EVPRTCEEIE 1472
            Y+  +D    F Q++ F +  G  EPD   ++   SGK      + LF+PR       + G     D       VD  Y ++E   +L  L        Y         L++D      EA     N        +   I   R++K+  E++ ++ A K +S+A  E M +    + E  + + F   C   GA   +AY  + A G   + LHY      N++ I+DG+M L D G E  CYVSDIT ++PVNGRFT  Q  +YEAVL    A    C PG S  +++ +    I   LK  G+ +    K  A +    + PH +GH +G+DVHD        +PRS LP          L+  MV+T+EPG Y            PE       D   +FRG  GVRIEDDV++T D    ++ + P+   +IE
Sbjct:  105 YYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSFSGKQLPSHKAMLFVPRRDPGRELWDGPRSGTDGAIALTGVDEAYPLEEFQHLLPKLRAETNMVWYDWMKPSHAQLHSDYMQPLTEAKARSKNKV----RSVQQLIQRLRLVKSPSEIKRMQIAGKLTSEAFIETMFASKAPIDEAFLYAKFEFECRARGA-DILAYPPVVAGGNRSNTLHY----VKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRACLTLCSPGTSLENIYSMMLTLIGQKLKDLGITK--TSKESAFKAARKYCPHHVGHYLGMDVHDTPD-----MPRS-LP----------LQPGMVITVEPGIYI-----------PEDDR----DAPEKFRGL-GVRIEDDVVVTQDSPLILSADCPKEMNDIE 499          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Mouse
Match: Pepd (peptidase D [Source:MGI Symbol;Acc:MGI:97542])

HSP 1 Score: 98.5969 bits (244), Expect = 1.083e-24
Identity = 45/75 (60.00%), Postives = 59/75 (78.67%), Query Frame = 3
Query:  486 GLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVE 710
            G+NTDS +   EASF GI+ F V+N++LH EI +CRV KTD ELEVLRY N+ SS+AHRE+M++V  GM EY++E
Sbjct:    2 GVNTDSGSVCREASFEGISKFNVNNTILHPEIVECRVFKTDMELEVLRYTNRISSEAHREVMKAVKVGMKEYEME 76          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Mouse
Match: Xpnpep3 (X-prolyl aminopeptidase 3, mitochondrial [Source:MGI Symbol;Acc:MGI:2445217])

HSP 1 Score: 88.9669 bits (219), Expect = 1.195e-18
Identity = 74/269 (27.51%), Postives = 117/269 (43.49%), Query Frame = 3
Query:  204 YHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGK------SFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLY--------GLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAV 968
            Y+  +D    F Q++ F +  G  EPD   ++   SGK      + LF+PR       + G     D       VD  Y ++E   +L  L        Y         L++D      EA     N        +   I   R++K+  E++ ++ A K +S+A  E M +    + E  + + F   C   GA   +AY  + A G   + LHY      N++ I+DG+M L D G E  CYVSDIT ++PVNGR  ++  ++  A+
Sbjct:  105 YYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSFSGKQLPSHKAMLFVPRRDPGRELWDGPRSGTDGAIALTGVDEAYPLEEFQHLLPKLRAETNMVWYDWMKPSHAQLHSDYMQPLTEAKARSKNKV----RSVQQLIQRLRLVKSPSEIKRMQIAGKLTSEAFIETMFASKAPIDEAFLYAKFEFECRARGA-DILAYPPVVAGGNRSNTLHY----VKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRLLENTALIMLAI 364          
BLAST of Xaa-Pro dipeptidase vs. UniProt/SwissProt
Match: sp|P12955|PEPD_HUMAN (Xaa-Pro dipeptidase OS=Homo sapiens OX=9606 GN=PEPD PE=1 SV=3)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 276/480 (57.50%), Postives = 349/480 (72.71%), Query Frame = 3
Query:   57 TVPIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVD 1493
            T P + LG + L VP+ L   NR RL  R++     +  S ++L+GG E     +D+ ++FRQES+FHW FGV EP  YG+ID+D+GKS LF+PRL   +AT+MG++ + +  K KYAVD V YVDEIA VL +   SV+ TL G+NTDS +   EASF GI+ F V+N++LH EI +CRV KTD ELEVLRY NK SS+AHRE+M++V  GM EY++ESLF H+CY  G MR+ +Y+ I  +G N +VLHYGHAGAPNDR I++GDMCLFDMGGEYYC+ SDITCSFP NG+FT DQ+ VYEAVL +S AV  A KPGV W DMH LA+R  L  L   G+L G VD M+   LG++FMPHGLGH +GIDVHDVGGY E  V R + PGL+SLRT R L+  MVLT+EPG YFI+ LL+ A+ +P  + FL  + + RFRGFGGVRIE+DV++TD GIE +T VPRT EEIE  M+G D
Sbjct:    5 TGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPE-GVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCD 483          
BLAST of Xaa-Pro dipeptidase vs. UniProt/SwissProt
Match: sp|Q5I0D7|PEPD_RAT (Xaa-Pro dipeptidase OS=Rattus norvegicus OX=10116 GN=Pepd PE=2 SV=1)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 272/478 (56.90%), Postives = 348/478 (72.80%), Query Frame = 3
Query:   63 PIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVD 1493
            P + LG + L VP+ L   NR RL  R++     +  S ++L+GG EM    +D+++IFRQES+FHW FGV+E   YG+ID+D+GKS LF+PRL   YAT+MG++ + +  K KYAVD V Y DEIA VL + N SV+ TL G+NTDS N   EASF GI+ FTV+N++LH EI +CRV KTD ELEVLRY N+ SS+AHRE+M++V  GM EY++ESLF H+CY  G MR+ +Y+ I  +G N +VLHYGHAGAPNDR I+DGD+CLFDMGGEYYC+ SDITCSFP NG+FT DQ+ +YEAVL +   V +  KPGV W DMH LA+R  L  L   GLL G VD M+ V LG++FMPHGLGH +G+DVHDVGGY E  V R + PGL+SLRT R L+  MVLT+EPG YFI+ LL+ A+ +P  + F   + + RFR FGGVRIE+DV++TD G+E +T VPRT EEIE  M+G D
Sbjct:    7 PSFSLGNETLKVPLALFALNRQRLCERLRKNGAVQAGSAVVLQGGEEMQRYCTDTSIIFRQESFFHWAFGVIESGCYGVIDVDTGKSTLFVPRLPASYATWMGKIHSKEHFKEKYAVDDVQYADEIASVLTSRNPSVLLTLRGVNTDSGNVCREASFEGISKFTVNNTILHPEIVECRVFKTDMELEVLRYTNRISSEAHREVMKAVKVGMKEYEMESLFQHYCYSKGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGEYYCFASDITCSFPANGKFTDDQKAIYEAVLRSCRTVMSTMKPGVWWPDMHRLADRIHLEELTRIGLLSGSVDAMLQVHLGAVFMPHGLGHFLGLDVHDVGGYPE-GVERIDEPGLRSLRTARHLEPGMVLTVEPGIYFIDHLLDQALADPAQACFFNQEVLQRFRNFGGVRIEEDVVVTDSGMELLTCVPRTVEEIEACMAGCD 483          
BLAST of Xaa-Pro dipeptidase vs. UniProt/SwissProt
Match: sp|Q11136|PEPD_MOUSE (Xaa-Pro dipeptidase OS=Mus musculus OX=10090 GN=Pepd PE=1 SV=3)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 270/478 (56.49%), Postives = 349/478 (73.01%), Query Frame = 3
Query:   63 PIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVD 1493
            P + LG + L VP+ L   NR RL  R++     +  S ++L+GG EM    +D+++IFRQES+FHW FGV+E   YG+ID+D+GKS LF+PRL + YAT+MG++ + +  K KYAVD V Y DEIA VL + N SV+ TL G+NTDS +   EASF GI+ F V+N++LH EI +CRV KTD ELEVLRY N+ SS+AHRE+M++V  GM EY++ESLF H+CY  G MR+ +Y+ I  +G N +VLHYGHAGAPNDR I+DGD+CLFDMGGEYYC+ SDITCSFP NG+FT+DQ+ +YEAVL +   V +  KPGV W DMH LA+R  L  L   GLL G VD M+ V LG++FMPHGLGH +G+DVHDVGGY E  V R + PGL+SLRT R L+  MVLT+EPG YFI+ LL+ A+ +P  + F   + + RFR FGGVRIE+DV++TD G+E +T VPRT EEIE  M+G D
Sbjct:    7 PSFSLGNETLKVPLALFALNRQRLCERLRKNGAVQAASAVVLQGGEEMQRYCTDTSIIFRQESFFHWAFGVVESGCYGVIDVDTGKSTLFVPRLPDSYATWMGKIHSKEYFKEKYAVDDVQYTDEIASVLTSRNPSVLLTLRGVNTDSGSVCREASFEGISKFNVNNTILHPEIVECRVFKTDMELEVLRYTNRISSEAHREVMKAVKVGMKEYEMESLFQHYCYSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGEYYCFASDITCSFPANGKFTEDQKAIYEAVLRSCRTVMSTMKPGVWWPDMHRLADRIHLEELARIGLLSGSVDAMLQVHLGAVFMPHGLGHFLGLDVHDVGGYPE-GVERIDEPGLRSLRTARHLEPGMVLTVEPGIYFIDHLLDQALADPAQACFFNQEVLQRFRNFGGVRIEEDVVVTDSGMELLTCVPRTVEEIEACMAGCD 483          
BLAST of Xaa-Pro dipeptidase vs. UniProt/SwissProt
Match: sp|Q5RFB3|PEPD_PONAB (Xaa-Pro dipeptidase OS=Pongo abelii OX=9601 GN=PEPD PE=2 SV=1)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 271/480 (56.46%), Postives = 345/480 (71.88%), Query Frame = 3
Query:   57 TVPIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVD 1493
            T P + LG + L VP+ L   NR RL  R++     +  S ++L+GG E     +D+ ++FRQES+FHW FGV EP  YG+ID+D+GKS LF+PRL   YAT+MG++ + +  K KYA+D V Y DEI  VL +   SV+ TL G+NTDS +   EASF GI+ F V+N++LH EI +CRV KTD ELEVLRY NK SS+AHRE+M++V  GM EY++ESLF H+CY  G MR+ +Y+ I  +G N +VLHYGHAGAPNDR I++GDMCLFDMGGEYYC+ SDITCSFP NG+FT DQ+ VYEAVL +S AV  A KPGV W DM  LA+R  L  L   G+L G VD M+   LG++ MPHGLGH +GIDVHDVGGY E  V R + PGL+SLRT R L+  MVLT+EPG YFI+ LL+ A+ +P H+ F   + + RFRGFGGVRIE+DV++TD G+E +T VPRT EEIE  M+G D
Sbjct:    5 TGPSFWLGNETLKVPVALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETLRYCTDTEVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASYATWMGKIHSKEHFKEKYAMDDVQYTDEIDSVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMRRLADRIHLEELAHTGILSGSVDAMVQAHLGAVSMPHGLGHFLGIDVHDVGGYPE-GVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPAHACFFNREVLQRFRGFGGVRIEEDVVVTDSGMELLTCVPRTVEEIEACMAGCD 483          
BLAST of Xaa-Pro dipeptidase vs. UniProt/SwissProt
Match: sp|Q55E60|PEPD_DICDI (Xaa-Pro dipeptidase OS=Dictyostelium discoideum OX=44689 GN=pepd PE=1 SV=1)

HSP 1 Score: 477.248 bits (1227), Expect = 2.170e-163
Identity = 236/477 (49.48%), Postives = 324/477 (67.92%), Query Frame = 3
Query:   69 YQLGDG-LPVPMTLHQQNRSRLINRMKSKNNN--KPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDID-SGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGI-NNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTE-VPRTCEEIELWM 1481
            Y LG+  L VP+ LH++NR RL++++ SK+ +  K NS+ILL+ G       +D   +F+QE YF WTFG   PD +G++ +D    S L IP+L   YAT+MGE+ + +  K  + VD V YVDE+ D LK+ N S I+T+ G NTDS +  +E  +PG+   F V+N++L  EI +CRVIK+ +E+EV+RY   AS  AH+ +MR V  G+ EYQ ES FLHH Y     RNV Y+ I A   N +VLHYGHAG PN   I +   CLFDMG EY+ Y +DITCSFP  G+F+ +QR+VY+AVL AS AV  A +PGVSW+DMH LAER IL  L  AG+L GD+  ++A ++GS+F PHGLGH +G+D HDVGGY+ D  P+     + SLRTTR LK  MV+T EPGCYFIN LL  A+ NPE ++F  + E++++R  GGVRIEDD+++T+ G + +++ +PRT +EIE +M
Sbjct:   28 YWLGNNTLKVPLVLHKENRQRLVSQILSKHKDQVKENSFILLESGKSTMQYDTDHEPLFKQERYFFWTFGSDIPDCFGIVGLDEQATSILCIPKLPAEYATWMGEIRSKEYYKSIFLVDQVLYVDEMMDYLKSKNASTIYTILGTNTDSGSTFVEPQYPGLRETFNVNNTLLFPEIAECRVIKSPKEVEVIRYCVDASVSAHKHVMRKVKVGLKEYQCESEFLHHVYNEWGCRNVGYTCICAANKNSAVLHYGHAGEPNSATISENGFCLFDMGAEYHSYTADITCSFPATGKFSPEQRVVYQAVLDASVAVMEAMRPGVSWVDMHKLAERCILAALLKAGILVGDLQDLIANKIGSVFFPHGLGHFLGLDTHDVGGYLGDCQPK-----VHSLRTTRTLKAGMVITSEPGCYFINHLLTQALSNPETAKFFNLTELDKYRNIGGVRIEDDILVTETGCDNLSKNLPRTIDEIEAFM 499          
BLAST of Xaa-Pro dipeptidase vs. TrEMBL
Match: A0A4E0RIJ6 (Peptidase D OS=Fasciola hepatica OX=6192 GN=D915_003212 PE=3 SV=1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 288/492 (58.54%), Postives = 370/492 (75.20%), Query Frame = 3
Query:   45 AVRRTVPIYQLGDG-LPVPMTLHQQNRSRLINRMKSK------NNNKPNS-----YILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            A  RT P YQLG   L + M LH  NR RL  R++ K       N  P       +ILL+GGS+ YHG SD+A +FRQES+FHW FG LEPD+YG I+I + ++ LF+PR+ +  A + G+  T  ++  KY+ +  +Y DE+ D LK  + +++ TL G+NTDS   T+EASFPGI +F V+N +LH EI +CR+ KT  ELEVLRYAN+ SS AHR +MR V PGM+E++ ES+FLH+CYFHG MR+VAY+ IGA+GCNC++LHYGHAG+PN+R IEDGDMCLFDMGGEYYCY SDITCS+PVNGRFT DQ+I+YEAVLAAS AV NA KPG  W+ +H LAE +IL+ L  AGLLRGD+ KMM  RLG++FMPHGLGHLMG DVHDVGGY +D+  R    GL++LRT RIL+ NMV+T+EPGCYFI+ LL+ A+++P+ S FL+ + + RFR FGGVRIED+++IT+ G E +T+VPRT EEIE WMS
Sbjct:    5 AAARTGPFYQLGKKCLGISMELHVVNRQRLCRRLQDKWERLISQNAAPTPTLKGVFILLQGGSDTYHGDSDAANVFRQESFFHWAFGALEPDWYGAIEISTARTILFVPRIPDAVALYDGKPATPSEVAKKYSTEGCFYADELVDRLKQWDTTLLLTLRGMNTDSGRMTVEASFPGIEHFKVNNELLHPEIVECRLYKTKMELEVLRYANRISSAAHRHLMRCVKPGMHEFEAESIFLHYCYFHGGMRHVAYTCIGASGCNCAILHYGHAGSPNERLIEDGDMCLFDMGGEYYCYTSDITCSYPVNGRFTSDQKIIYEAVLAASRAVLNAAKPGADWVKLHQLAEENILSRLLQAGLLRGDLAKMMKERLGAVFMPHGLGHLMGCDVHDVGGYTQDSPARPTAVGLRNLRTARILQPNMVITVEPGCYFIDQLLDEALQSPKLSPFLVPEALQRFRKFGGVRIEDNIVITEAGNELLTDVPRTIEEIEQWMS 496          
BLAST of Xaa-Pro dipeptidase vs. TrEMBL
Match: A0A0R3W2X3 (AMP_N domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4213 PE=3 SV=2)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 291/482 (60.37%), Postives = 370/482 (76.76%), Query Frame = 3
Query:   63 PIYQLGD-GLPVPMTLHQQNRSRLINRMKS-KNNNKPNS------YILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            P+++LG  GL VPM LH+ NRSRL  R++S  ++  P +      Y+LL+GGS++ HGGSD  ++FRQESYFHWTFG LEP +YG I++ + ++ LFIP++SE  A +MGE+ ++  +  +Y VD  YY  EI       N S++ TL+GLNTDS  YT+EASF GI+ F VDN++LH+E+ +CR+IK+  ELEV+RYA   SS AHR +MR V PGMY++Q ES+F H+CYF+G MR+VAY+ I ATGC+C+VLHYGHAGAPND +I DGDMCLFDMGGEYYCY SDITCSFPVNG+FT DQR++YEAVLAA  AV +  +PGVSWL+MH LAER+IL HLK  GLL+G V+ MM+  LG+IFMPHGLGHLMG DVHDVGGY + A  RS  PGLK+LRT R +  NMVLT+EPGCYFI  L++ A  +PE S+FLI + I RF  FGGVRIE+DV++TDDG E +++VPRT EEIE WMS
Sbjct:    3 PVFKLGKRGLAVPMELHKMNRSRLCERLRSLWSSGAPPTPTLDGVYVLLQGGSDVPHGGSDVEIVFRQESYFHWTFGGLEPYWYGAIEVATQRAILFIPQISENSAVYMGEIPSLCDVIIRYGVDETYYTHEIERYFCEKNPSLLLTLHGLNTDSGRYTLEASFDGIDKFKVDNNILHHEMAECRLIKSPLELEVIRYAVSVSSAAHRHLMRKVKPGMYQFQAESIFQHYCYFYGGMRHVAYTCIAATGCDCAVLHYGHAGAPNDNQIRDGDMCLFDMGGEYYCYCSDITCSFPVNGKFTSDQRLIYEAVLAAVRAVTSHLRPGVSWLEMHKLAERTILEHLKVGGLLQGSVETMMSAHLGAIFMPHGLGHLMGCDVHDVGGYNKGAPSRSTEPGLKNLRTARYVLPNMVLTVEPGCYFIKRLIKKAQSSPELSQFLIPEAIGRFADFGGVRIEEDVLVTDDGCEVLSDVPRTVEEIESWMS 484          
BLAST of Xaa-Pro dipeptidase vs. TrEMBL
Match: A0A4Z2DPD6 (Xaa-Pro dipeptidase OS=Schistosoma japonicum OX=6182 GN=EWB00_010202 PE=3 SV=1)

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 285/490 (58.16%), Postives = 363/490 (74.08%), Query Frame = 3
Query:   45 AVRRTVPIYQLGDGLPVPMTLHQQNRSRLINRMKSK----NNNKP------NSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            A  RT PI+QLG  L +PM LH  NR RL NR++ K    +  +P        YI+L+GG++ + G SD+   FRQES+FHWTFGVLEPD YG I++ +G+S LFIP+L E  A + GE  + +Q   KY VD  +Y DEI   L + N +++ TL G+NTDS   T+EA F GI  F V+  +LH+EI  CR+IKT+ EL+V+RY N+ SS AHR +MRSV PGMY+YQ ES+F H+CYFHG MR+++Y+ I ATGC+C+VLHYGHAGAPN+ +I +G+MCLFDMGGEYYCY SDITCSFPVNGRFT DQ+++Y AVL AS AV N  KPG  W+ +H LAER IL HLK  GLL GD+++MM  RLG+IFMPHGLGHL+G DVHDVGGY  DA PRS LPGL++LRT+R+L+ NMV+T+EPGCYFI  LL  A+ +    +F+  D+I RFR FGGVRIED++I+T+ G E +T+VPRT EEIE WMS
Sbjct:    5 AASRTAPIFQLGKCLAIPMQLHVTNRQRLCNRIRDKLSLLDTGRPLMQNFSGVYIVLQGGTDTFLGDSDATNEFRQESFFHWTFGVLEPDCYGTIEVSTGRSALFIPKLPEEAAIYDGESASCEQFSKKYGVDETHYTDEIVSCLNSWNATLLLTLCGMNTDSHRPTVEAKFNGIEKFQVNRDILHHEIVSCRLIKTNMELDVIRYTNRISSAAHRHLMRSVKPGMYQYQAESIFRHYCYFHGGMRHMSYTCIAATGCDCAVLHYGHAGAPNEHQITNGEMCLFDMGGEYYCYASDITCSFPVNGRFTDDQKLIYNAVLRASRAVLNEIKPGADWVQLHQLAEREILIHLKDGGLLIGDINEMMTSRLGAIFMPHGLGHLLGCDVHDVGGYSNDAPPRSTLPGLRNLRTSRLLQANMVMTVEPGCYFIERLLNQALSSDTLGKFIDRDQIERFRKFGGVRIEDNIIVTEVGYELLTDVPRTVEEIEEWMS 494          
BLAST of Xaa-Pro dipeptidase vs. TrEMBL
Match: Q5DFD6 (SJCHGC06332 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 284/490 (57.96%), Postives = 363/490 (74.08%), Query Frame = 3
Query:   45 AVRRTVPIYQLGDGLPVPMTLHQQNRSRLINRMKSK----NNNKP------NSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            A  RT PI+QLG  L +PM LH  NR RL NR++ K    +  +P        Y++L+GG++ + G SD+   FRQES+FHWTFGVLEPD YG I++ +G+S LFIP+L E  A + GE  + +Q   KY VD  +Y DEI   L + N +++ TL G+NTDS   T+EA F GI  F V+  +LH+EI  CR+IKT+ EL+V+RY N+ SS AHR +MRSV PGMY+YQ ES+F H+CYFHG MR+++Y+ I ATGC+C+VLHYGHAGAPN+ +I +G+MCLFDMGGEYYCY SDITCSFPVNGRFT DQ+++Y AVL AS AV N  KPG  W+ +H LAER IL HLK  GLL GD+++MM  RLG+IFMPHGLGHL+G DVHDVGGY  DA PRS LPGL++LRT+R+L+ NMV+T+EPGCYFI  LL  A+ +    +F+  D+I RFR FGGVRIED++I+T+ G E +T+VPRT EEIE WMS
Sbjct:    5 AASRTAPIFQLGKCLAIPMQLHVTNRQRLCNRIRDKLSLLDTGRPLMKNFSGVYVVLQGGTDTFLGDSDATNEFRQESFFHWTFGVLEPDCYGTIEVSTGRSALFIPKLPEEAAIYDGESASCEQFSKKYGVDETHYTDEIVSCLSSWNATLLLTLCGMNTDSHRPTVEAKFNGIEKFQVNRDILHHEIVSCRLIKTNMELDVIRYTNRISSAAHRHLMRSVKPGMYQYQAESIFRHYCYFHGGMRHMSYTCIAATGCDCAVLHYGHAGAPNEHQITNGEMCLFDMGGEYYCYASDITCSFPVNGRFTDDQKLIYNAVLRASRAVLNEIKPGADWVQLHQLAEREILIHLKDGGLLIGDINEMMTSRLGAIFMPHGLGHLLGCDVHDVGGYSNDAPPRSTLPGLRNLRTSRLLQANMVMTVEPGCYFIERLLNQALSSDILGKFIDRDQIERFRKFGGVRIEDNIIVTEVGYELLTDVPRTVEEIEEWMS 494          
BLAST of Xaa-Pro dipeptidase vs. TrEMBL
Match: A0A094ZPS3 (Xaa-Pro dipeptidase OS=Schistosoma haematobium OX=6185 GN=MS3_05016 PE=3 SV=1)

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 285/492 (57.93%), Postives = 363/492 (73.78%), Query Frame = 3
Query:   39 SMAVRRTVPIYQLGDGLPVPMTLHQQNRSRLINRMKSK----------NNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            S AV RT PI+QLG  L VPM LH  NR RL NR++ K           +N    +++L+GG++ + G SD+A +FRQES+FHWTFGVLEPD YG I++ +G+S LFIP++ E    + GEL +++Q   KY VD  +Y DEIA  L   N +++ TL G+NTDS   T EA F GI  F V+  +LH+EI  CR+IKTD EL+V+RY N+ SS AHR +MRS+ PGMY+YQ ES+F H+CYFHG MR+++Y+ I ATGC+C+VLHYGHAG PN+ +I DG+MCLFDMGGEYYCY SDITCSFPVNGRFT DQ+++Y AVL AS AV N  KPG  W+ +H LAER ILTHL+  GLL GD+++MM  RLG+IFMPHGLGHL+G DVHDVGGY+ D   RS  PGLK+LRT R+L+ NMV+T+EPGCYFI  LL  A+ +   S+F+   +I RFR FGGVRIED++I+T+ G E +T+VPRT EEIE WMS
Sbjct:    3 SGAVSRTAPIFQLGKCLAVPMQLHVANRQRLCNRIRDKISSLDTSKSLTHNLSGVFVVLQGGTDTFLGDSDAANVFRQESFFHWTFGVLEPDCYGTIEVATGRSTLFIPKIPEEATIYDGELASLEQFSKKYNVDETHYTDEIASYLSLWNATLLLTLCGVNTDSHRPTPEAKFYGIERFQVNRDILHHEIVSCRLIKTDMELDVIRYTNRISSAAHRHLMRSIKPGMYQYQAESIFRHYCYFHGGMRHMSYTCIAATGCDCAVLHYGHAGKPNEHQILDGEMCLFDMGGEYYCYSSDITCSFPVNGRFTDDQKLIYNAVLCASRAVLNEIKPGADWVQLHQLAEREILTHLREGGLLLGDINEMMKSRLGAIFMPHGLGHLLGCDVHDVGGYLNDTPSRSSQPGLKNLRTARLLQTNMVMTVEPGCYFIERLLNQALSSDILSKFIDRGQIERFRKFGGVRIEDNIIVTETGYELLTDVPRTIEEIEAWMS 494          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Cavefish
Match: pepd (peptidase D [Source:ZFIN;Acc:ZDB-GENE-030131-9444])

HSP 1 Score: 493.041 bits (1268), Expect = 2.357e-171
Identity = 245/482 (50.83%), Postives = 317/482 (65.77%), Query Frame = 3
Query:   42 MAVRRTVPIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            MA      +Y +G D L V   L  +NR RL   +K +   +P S +LL+GG +     +D+ ++FRQES+FHWTFGV E D YG +D+D+GKS LF+P+L E YAT+MGE+   +  K KYAVD V+Y  +++ ++                                               R+IKTD ELEVLRY N+ SS+AH+E+M++V PG  EY++ESLF H+CY  G MR+ +Y+ I  +G N SVLHYGHAGAPND+ IEDGDMCLFDMGGEYYCY SDITCSFP NG+FT DQ+ +YEAVL +S AV  A KPGV W DMH LA+R  L  L   G++ G+V+ M+ V LGS+FMPHGLGHL+GID HDVGGY E    R + PGLKSLR  R++ K MVLT+EPG YFIN +L+ A+ + E   F+  D + RFRGFGGVRIEDD+ +T+DG+E +T VPRT EEIE +M+
Sbjct:    1 MAAAGGKAVYWMGKDTLQVSAALFAENRRRLCAGLKGRQGLQPKSLVLLQGGEQKQRYCTDTDILFRQESFFHWTFGVTEADCYGAVDVDTGKSLLFVPKLPESYATWMGEIYPKEHFKEKYAVDEVHYTSDVSCLV-----------------------------------------------RLIKTDMELEVLRYTNRISSEAHKEVMKTVKPGHKEYEMESLFSHYCYSRGGMRHTSYTCICGSGNNSSVLHYGHAGAPNDKTIEDGDMCLFDMGGEYYCYTSDITCSFPANGKFTPDQKAIYEAVLKSSRAVMAAIKPGVKWTDMHRLADRVHLEELVKIGIVHGNVEDMLKVHLGSVFMPHGLGHLLGIDTHDVGGYPE-GTERVDEPGLKSLRMGRVVLKGMVLTVEPGIYFINHVLDKALASQEQCGFINNDVLARFRGFGGVRIEDDIAVTEDGMELLTCVPRTVEEIEAFMA 434          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Cavefish
Match: xpnpep3 (X-prolyl aminopeptidase 3, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-040426-2076])

HSP 1 Score: 149.828 bits (377), Expect = 4.813e-39
Identity = 136/475 (28.63%), Postives = 214/475 (45.05%), Query Frame = 3
Query:  105 LHQQNRSRLIN----RMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGK---SFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVL---HNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDG---------IECMTEVPRTCEEIE 1472
            L +Q  + LI     R+   +    +S+I++       +  +D    F Q   F +  GVLEPD   L+   SG+   + LF+PR       + G     D       ++ V+ ++E+  VLK+L    +        DS     +   P ++   V        H+       IK+  E+E+++ A + +++A ++ M      + E  + + F   C  HGA   +AY  + A G   + LHY +    N++ I+DG+M L D G EYY YVSD+T ++PVNG+F++ QR +YEAVL       + C PGVS   ++      +   L+   +L    D   A++    F PH +GH +G+DVHD                   L  ++ L+  M +TIEPG YF     E     PE           RFRG  GVRIEDDV+I ++G          +   +V RTC + E
Sbjct:   74 LRRQRLASLIEAHSVRLSGPSRASDSSHIVIVLSHPTRYMTNDIPYPFHQNQDFLYLTGVLEPD-SALVMFGSGRPDHAALFVPRRDPARELWDGPRSGRDGAAALTGLERVHCIEELGTVLKSLKGGTVWY------DSS----QPCHPRLHQSHVRPPAGGWGHS-------IKSPAEVELMKEAGRITAQAFKKTMALCRGDIDEALIYAKFDFECRAHGA-NFLAYPPVVAGGNRANTLHYIN----NNQIIKDGEMVLLDGGCEYYGYVSDVTRTWPVNGKFSEAQRELYEAVLEVQLGCLSLCSPGVSLDHIYTTMLTLLAKQLRQLRVLPHSADDADAIKAARRFCPHHVGHYLGMDVHDT----------------PELSRSQPLQPGMAITIEPGLYFS----EEDESCPE-----------RFRGL-GVRIEDDVVIREEGGPLILSEHTPKTAADVERTCAQRE 493          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Cavefish
Match: xpnpep2 (X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound [Source:ZFIN;Acc:ZDB-GENE-040426-1151])

HSP 1 Score: 49.6766 bits (117), Expect = 6.606e-6
Identity = 79/385 (20.52%), Postives = 148/385 (38.44%), Query Frame = 3
Query:  192 GSEMYHGGSDSALIFRQESYFHWTFGV------LEPDFYGLIDIDSGKSFLFI--PRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIM----RSVHPGMYEYQVESLFLHHCYFHGAM-RNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKP-GVSWLDMHCLAERSI----LTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCY 1292
            G  M +  + +AL+        W F +        P FY    +   K +LF+   R++E   T++            Y V  + Y    + ++K L  + +    G       YT +A +  I          ++ +   + +K   E ++L+ A+   + A  +++    RSV  G       + F++ C       R  ++ +I A+G N ++ HY  + +   RK+   +M L D GG+Y    +DIT +    G+ T  Q+  +  VL  +  +     P G   +++  L  R++    L +  G G                    HG+G+  G+    V G+  + +P                ++ M  +IEPG Y
Sbjct:  223 GQMMDNPYNPTALLLSALDETAWLFNLRGNDIPFNPFFYSYTLLTFDKIWLFVHTERVTEELRTYLN-----SSCSDSYCVQLLQYDSVRSHLMKYLEEAGVRVWVG-----TEYTNQALYELITPEEKLLESTYSPVLTTKAVKDQTERKILKAAHIRDAVAVMQLLHHLERSVPEGRETELTAAEFVNECRSKQQYSRGPSFETISASGPNAALAHYSPS-SETSRKLSVDEMYLVDSGGQYLDGTTDITRTVHW-GKPTDRQKEAFTRVLMGNIEISRTIFPAGTRGVNIEMLGRRALWEVGLNYGHGTG--------------------HGVGNYFGVHEWPV-GFQSNNIP---------------FQEGMFTSIEPGYY 559          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Cavefish
Match: xpnpep2 (X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound [Source:ZFIN;Acc:ZDB-GENE-040426-1151])

HSP 1 Score: 49.6766 bits (117), Expect = 6.939e-6
Identity = 80/388 (20.62%), Postives = 148/388 (38.14%), Query Frame = 3
Query:  192 GSEMYHGGSDSALIFRQESYFHWTFGV------LEPDFYGLIDIDSGKSFLFI--PRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIM----RSVHPGMYEYQVESLFLHHCYFHGAM-RNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKP-GVSWLDMHCLAERSI----LTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFIN 1301
            G  M +  + +AL+        W F +        P FY    +   K +LF+   R++E   T++            Y V  + Y    + ++K L  + +    G       YT +A +  I          ++ +   + +K   E ++L+ A+   + A  +++    RSV  G       + F++ C       R  ++ +I A+G N ++ HY  +     RK+   +M L D GG+Y    +DIT +    G+ T  Q+  +  VL  +  +     P G   +++  L  R++    L +  G G                    HG+G+  G+    V G+  + +P                ++ M  +IEPG Y  N
Sbjct:  286 GQMMDNPYNPTALLLSALDETAWLFNLRGNDIPFNPFFYSYTLLTFDKIWLFVHTERVTEELRTYLN-----SSCSDSYCVQLLQYDSVRSHLMKYLEEAGVRVWVG-----TEYTNQALYELITPEEKLLESTYSPVLTTKAVKDQTERKILKAAHIRDAVAVMQLLHHLERSVPEGRETELTAAEFVNECRSKQQYSRGPSFETISASGPNAALAHYSPSSE-TSRKLSVDEMYLVDSGGQYLDGTTDITRTVHW-GKPTDRQKEAFTRVLMGNIEISRTIFPAGTRGVNIEMLGRRALWEVGLNYGHGTG--------------------HGVGNYFGVHEWPV-GFQSNNIP---------------FQEGMFTSIEPGYYKEN 625          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Sea Lamprey
Match: xpnpep3 (X-prolyl aminopeptidase 3, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-040426-2076])

HSP 1 Score: 134.806 bits (338), Expect = 2.196e-34
Identity = 118/445 (26.52%), Postives = 188/445 (42.25%), Query Frame = 3
Query:  117 NRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSG-------KSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASF-PGINNFTVDNSV--LHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITD 1421
             R RL+  +++++   P S +L+          +D    F Q S   +  G  EPD   L+    G       K+ L +P        + G     D       VD  + + E+A VL +         Y           E    P +        V  L   +   R++K+  E+ V+  A + +++A  E MR+  P + E  + + F   C   GA   +AY  + A G   ++LHY      N++ I+DG+M L D G E + Y SD+T ++PV+G F+  Q  +YEAVL         C+ G +   ++ L    +   L+  G+L GD+    A +    + PH +GH +G+DVHD                   +  +  L+  M +TIEPG Y            P   E + +    RFRG  GVR+EDDV+IT+
Sbjct:   80 RRHRLMAAVQAES---PGSVVLVPSNPTCIMT-NDIPYPFHQHSDLLYLTGFQEPDSLLLLLPRRGGATAATHKAVLLVPPRDATRELWDGPRSGPDGAVALTGVDEAFPLQELARVLAHAGEPPAWWYYPHGDPPHPEMHERHVGPMLAPAAAQGRVRSLRKHVAALRLVKSQAEVRVMGAAAEITAQAMVETMRASSPPVDEAFLYAKFEFECRARGA-EILAYPPVVAGGNRANILHY----VKNNQIIQDGEMVLLDGGCELHGYASDVTRTWPVSGCFSGPQAELYEAVLDVQKLCLRGCRAGSTMEGLYSLMLLQLGQRLQELGILGGDLSPGAAAKAARQYCPHHVGHYLGMDVHDT----------------PDVSRSIALQPGMAITIEPGLYI-----------PRADESVPV----RFRGL-GVRVEDDVVITE 483          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Yeast
Match: YFR006W_mRNA (Putative X-Pro aminopeptidase; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; YFR006W is not an essential gene [Source:SGD;Acc:S000001902])

HSP 1 Score: 223.016 bits (567), Expect = 2.168e-66
Identity = 139/421 (33.02%), Postives = 209/421 (49.64%), Query Frame = 3
Query:  219 DSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDV--DKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAM-RNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIE 1472
            D+   FRQ  YF+   GV  P    L +  + K  LF+P + E    + G   ++D+    + +D   Y+ ++    K L    I T    N   +N    +  P   NF          + + R IK   E+E +R A + S K+H  +M ++   + E Q+++ F +H    G  R++ Y  I  +G  C  LHY      N   I+     L D G E+  Y SDIT  FP +G+FT + R VYE VL   +      KPG  W D+H L  + ++ H    G+ + +   D++   R    F PHGLGH++G+DVHDVGG      P    P  + LR  R LK+NMV+T EPGCYF  FL++  + ++PE  E + +  + R+   GGVRIEDD+++T DG E +T +    +EIE
Sbjct:  113 DTNKDFRQNRYFYHLSGVDIPASAILFNCSTDKLTLFLPNIDEEDVIWSGMPLSLDEAMRVFDIDEALYISDLGKKFKELQDFAIFTTDLDNVHDENIA-RSLIPSDPNFFY-------AMDETRAIKDWYEIESIRKACQISDKSHLAVMSALPIELNELQIQAEFEYHATRQGG-RSLGYDPICCSGPACGTLHY----VKNSEDIKGKHSILIDAGAEWRQYTSDITRCFPTSGKFTAEHREVYETVLDMQNQAMERIKPGAKWDDLHALTHKVLIKHFLSMGIFKKEFSEDEIFKRRASCAFYPHGLGHMLGLDVHDVGGNPNYDDPD---PMFRYLRIRRPLKENMVITNEPGCYFNQFLIKEFLEKHPERLEVVDMSVLKRYMYVGGVRIEDDILVTKDGYENLTGITSDPDEIE 517          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Yeast
Match: ICP55 (Mitochondrial aminopeptidase; cleaves the N termini of at least 38 imported proteins after cleavage by the mitochondrial processing peptidase (MPP), thereby increasing their stability; member of the aminopeptidase P family [Source:SGD;Acc:S000000880])

HSP 1 Score: 107.071 bits (266), Expect = 3.862e-25
Identity = 121/458 (26.42%), Postives = 196/458 (42.79%), Query Frame = 3
Query:  165 PNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLID--IDSGKSFLF---IPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNL----NVSVIHTLYGLNTDSQNYT-IEASFPGINNFTVD-NSV-------LHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSIL---THLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMT-EVPRTCEEIE 1472
            P S ++L G    +  G+     F+QE+   +  G  EP+   +++   DS    +F   +P        + G    V  ++  +  D    +++++  L  +    +      L   N  S N+  I++   G  N     NS+       +   I + R IK+ QEL ++R A + S ++  +          E  ++S FLH+ +  G     AY  + ATG N   +HY      ND  + D +M L D  G    Y +DI+ ++P +G+FT  QR +YEAVL         CK   ++  +H + E+SI      LK  G     +DK+    +  ++ PH +GH +G+DVHDV       V R E            LK   V+TIEPG Y            P    F      + FR   G+RIEDD+ I +D    +T E  +  +++E
Sbjct:   83 PKSCVILAGNDIQFASGA-VFYPFQQENDLFYLSGWNEPNSVMILEKPTDSLSDTIFHMLVPPKDAFAEKWEGFRSGVYGVQEIFNADESASINDLSKYLPKIINRNDFIYFDMLSTSNPSSSNFKHIKSLLDGSGNSNRSLNSIANKTIKPISKRIAEFRKIKSPQELRIMRRAGQISGRSFNQAFAKRFRN--ERTLDS-FLHYKFISGGCDKDAYIPVVATGSNSLCIHYTR----NDDVMFDDEMVLVDAAGSLGGYCADISRTWPNSGKFTDAQRDLYEAVLNVQRDCIKLCKASNNY-SLHDIHEKSITLMKQELKNLG-----IDKVSGWNVEKLY-PHYIGHNLGLDVHDV-----PKVSRYE-----------PLKVGQVITIEPGLYI-----------PNEESF-----PSYFRNV-GIRIEDDIAIGEDTYTNLTVEAVKEIDDLE 492          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Nematostella
Match: EDO49339 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHF5])

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 261/473 (55.18%), Postives = 338/473 (71.46%), Query Frame = 3
Query:   69 YQLGD-GLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            +QLG   L V +++   NR RL  R+K        + ++L GG +     +D+ ++FRQES+FHWTFGVLE D +G +++D+GKS LFIP+L + YA +MG++   +  K KY VD VY+V EIA+ L+  N S++ TL G NTDS     EA+F GI+ F VDN++LH +I +CRV KT QELE+LRY N+ SS+AH+++M  + PGM ++Q+ESLF H+CY  G  R+ +Y+ IGATG  C+ LHYGHAGAPND++I DGDMCLFDMGGEYYCY +DITCS+P NG+FT  Q+++Y  VL +S AV    KPGVSW DMH L+ R IL  L  AG LRG+VD+M+   +G +FMPHGLGH MGIDVHDVGGY E  V RS LPGL+SLR  R+L++NMVLTIEPG YFI  +LE A  NPE S F   + I  F  FGGVRIEDD+++T DG+E MT VPRT EEIE  M+
Sbjct:    9 HQLGSHTLAVSVSMFATNRRRLCERLKKNEKVPKGAIVVLLGGEQNTRYCTDTDVVFRQESFFHWTFGVLEADCFGAVEVDTGKSILFIPKLPQEYAIWMGKIHPKEHYKEKYDVDEVYFVSEIAETLEKKNPSLLLTLRGQNTDSGKTCREAAFDGISKFKVDNAILHPDIVECRVFKTPQELELLRYVNQVSSEAHKQLMMRIKPGMSQFQMESLFQHYCYSEGGCRHTSYTCIGATGPCCATLHYGHAGAPNDQEIRDGDMCLFDMGGEYYCYGADITCSYPANGKFTDKQKLIYNIVLKSSRAVMAQVKPGVSWPDMHRLSVRVILEELTAAGFLRGEVDEMVKHHIGYLFMPHGLGHFMGIDVHDVGGYPE-GVERSSLPGLRSLRCGRVLEQNMVLTIEPGIYFIRPVLEPAFTNPEISHFFNREMIEDFLDFGGVRIEDDIVVTSDGMELMTCVPRTVEEIEALMA 480          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Nematostella
Match: EDO29537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3C5])

HSP 1 Score: 244.973 bits (624), Expect = 3.714e-78
Identity = 114/208 (54.81%), Postives = 150/208 (72.12%), Query Frame = 3
Query:  861 LFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            +FDMG EYYCY SD+TCS+P NG+FT  Q+++Y  V  +S AV    KPGV+W DMHCLA R I+  LK  G L+GD++++++  +G +FMPHG+GH +G+DVHDVGG+ E AV RS  PGL  LR  R+L++NMVLTIEPG YF   +LE A++NPE S FL    I  F  FGG+R  DD+++T DG+E M+ VPRT EEIE  M+
Sbjct:    1 MFDMGAEYYCYGSDVTCSYPANGKFTDKQKLIYNIVFKSSRAVMAHVKPGVTWTDMHCLAMRVIVEELKAVGFLQGDIEELISHGVGYLFMPHGVGHCLGVDVHDVGGFPEGAV-RSSTPGLDKLRCVRVLEENMVLTIEPGIYFNGSILEPALKNPEISRFLNRAMIEDFLDFGGLRFADDIVVTSDGMELMSGVPRTVEEIEALMA 207          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Nematostella
Match: EDO29991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T220])

HSP 1 Score: 193.356 bits (490), Expect = 1.680e-58
Identity = 91/210 (43.33%), Postives = 138/210 (65.71%), Query Frame = 3
Query:   81 DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVE 710
            + L V ++L   NR RL  R++  +     + +LL+GG +     +D+ ++FRQES+FHW FGVLEP+ +G I++D+GKS LF P+L E YA ++G +  V              +  I++VL++   SV+ TL GLNTDS   + +A+FPGI++F VDN+VLH E+ +CR+ KT QELEVLRY ++ SS+AH+++M  V PGM +Y+ E
Sbjct:    6 NTLSVSVSLFSTNRKRLCERLRKNDKVAKGAMVLLQGGEQERRYCTDTDILFRQESFFHWAFGVLEPECFGAIEVDTGKSILFFPKLPEDYAIWLGNIWDV--------------MGSISEVLQSKAASVLLTLKGLNTDSGKTSRQATFPGISDFKVDNTVLHREMVECRLRKTPQELEVLRYVSRVSSEAHKQVMMRVRPGMMQYETE 201          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Nematostella
Match: EDO34095 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQA6])

HSP 1 Score: 156.762 bits (395), Expect = 1.631e-41
Identity = 121/434 (27.88%), Postives = 208/434 (47.93%), Query Frame = 3
Query:  216 SDSALIFRQESYFHWTFGVLEPDFYGLIDIDSG------KSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGI----NNFTVDNSV-LHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMT-EVPRTCEEIELWM 1481
            +D    FRQ + F +  G  EPD   L++   G      +S LF+    +    + G    +    + +  D  Y V++++ +L+       + ++  +  + N  + A   G+      FT    + L +++   R+IK+  E+ +LR +   ++++  ++M++  PGM E +  +L  + C   GA R +AY  + A G   + LHY +    N + + DGD+ L D G EY+ Y SDIT ++PVNG FT  QR +Y+ VL       + C   ++   +H +    +   L  AG+L  ++ +    ++     PH +GH +G+DVHD        V RS             ++  MV+TIEPG Y              +S   IID+  R+ G  G+RIEDD++IT++G E ++ E P+  +EIE  M
Sbjct:  163 TDIPYPFRQNTDFLYLTGFQEPDAVLLLESKDGLSMPYHESLLFVRPRDKKREMWEGSRAGIQGAINIFGADEAYSVNDLSSILQERYGGKGYCIWYDHIRTTNPLLHAEISGVLFKTPEFTFKRLLSLGHKLHMLRLIKSPAEIALLRKSASVAAQSITKVMQNTRPGMEESRAHALMEYECRMQGADR-LAYPPVVAGGALANTLHYIN----NTQVLRDGDLVLMDSGCEYHGYASDITRTWPVNGTFTGPQRELYDIVLEVQKTCISLCHKDITLDYLHTVMLTLLAEGLVKAGILPNNLTESQTKQVAVELCPHHVGHYLGMDVHDT-----HLVSRS-----------LSMQPGMVVTIEPGLYI-------------NSNNKIIDK--RYHGI-GIRIEDDILITEEGQEVLSAECPKDPKEIEKLM 559          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Nematostella
Match: EDO25350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWR0])

HSP 1 Score: 128.642 bits (322), Expect = 1.474e-34
Identity = 80/209 (38.28%), Postives = 118/209 (56.46%), Query Frame = 3
Query:  858 CLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLA----ASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDV--DKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDA-----VPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNP--EHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTE 1445
             L D G  ++ YV+DIT       R       V++A++A    A   +    KPGVS++D+H     +I T LK  G++RG+V  D+   VR+ S F PHGLGHL+GI VHD+GG+   A      P SE P    LR TR+L++  V+TIEPG YFI  LL+   +    +  ++ ++D +     +GG+RIED++ +T +GIE  T 
Sbjct:    1 LLVDAGAVHHGYVADIT-------RTIAQGSSVFDALIAGLDQAQQTLMQTIKPGVSFVDLHRAMHHAIYTLLKTHGIVRGNVSHDEADQVRISSAFFPHGLGHLLGIQVHDIGGWQHSAGGEIIAPPSEHP---YLRLTRVLEQGFVVTIEPGLYFIPALLQPLKKTALGKDLDWTLVDALTP---WGGIRIEDNICVTAEGIENYTR 196          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Medaka
Match: pepd (peptidase D [Source:NCBI gene;Acc:101159424])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 277/475 (58.32%), Postives = 347/475 (73.05%), Query Frame = 3
Query:   63 PIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            P+Y LG D L V   L  +NR RL   ++ K    P S ++L+GG +     +D+ ++FRQES+FHW+FGV E D YG ID+DSGKS LF+P+L E YAT+MGE+   +  K KYAVD V+Y  +IADVL  +  +V+ TL GLNTDS +   EASF GI+ FTV+NS+LH  I +CR++KTD ELEVLRY N+ SS+AH+ IM++V PG  EY++ESLF H+CY  G MR+ +Y+ I  +G N SVLHYGHAGAPND+ I+DGDMCLFDMGGEYYCY SDITCSFP NG+FT DQ+ +YEAVL +S AV  A KPGV W DMH LA+R  L  L   GLL G VD MM V LGS+FMPHGLGHL+GIDVHDVGGY E  V R + PGL+SLR  R++++ MVLT+EPG YFIN LL+ A+ NP    F+    + RFRGFGGVRIEDD+ +T DG+E +T VPRT EEIE +M+
Sbjct:    7 PVYWLGNDTLRVSAALFAENRRRLCQGLQGKEGMLPKSVVVLQGGEQQQRYCTDTDVVFRQESFFHWSFGVTEADCYGAIDVDSGKSILFVPKLPESYATWMGEIFPKEHFKEKYAVDEVHYTADIADVLSRMTPAVLLTLRGLNTDSGSVCREASFEGISRFTVNNSLLHPVIVECRLLKTDMELEVLRYTNRISSEAHKMIMKNVKPGQKEYEMESLFQHYCYTKGGMRHTSYTCICGSGNNSSVLHYGHAGAPNDKTIQDGDMCLFDMGGEYYCYSSDITCSFPANGKFTPDQKAIYEAVLKSSRAVLAAIKPGVKWTDMHRLADRIHLEELVKLGLLHGGVDDMMKVHLGSVFMPHGLGHLLGIDVHDVGGYPE-GVDRIDEPGLRSLRMARLVQERMVLTVEPGIYFINHLLDQALSNPAQRCFINDHMLARFRGFGGVRIEDDIAVTADGVELLTCVPRTVEEIEAFMA 480          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Medaka
Match: pepd (peptidase D [Source:NCBI gene;Acc:101159424])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 264/440 (60.00%), Postives = 330/440 (75.00%), Query Frame = 3
Query:  165 PNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            P S ++L+GG +     +D+ ++FRQES+FHW+FGV E D YG ID+DSGKS LF+P+L E YAT+MGE+   +  K KYAVD V+Y  +IADVL  +  +V+ TL GLNTDS +   EASF GI+ FTV+NS+LH  I +CR++KTD ELEVLRY N+ SS+AH+ IM++V PG  EY++ESLF H+CY  G MR+ +Y+ I  +G N SVLHYGHAGAPND+ I+DGDMCLFDMGGEYYCY SDITCSFP NG+FT DQ+ +YEAVL +S AV  A KPGV W DMH LA+R  L  L   GLL G VD MM V LGS+FMPHGLGHL+GIDVHDVGGY E  V R + PGL+SLR  R++++ MVLT+EPG YFIN LL+ A+ NP    F+    + RFRGFGGVRIEDD+ +T DG+E +T VPRT EEIE +M+
Sbjct:    3 PKSVVVLQGGEQQQRYCTDTDVVFRQESFFHWSFGVTEADCYGAIDVDSGKSILFVPKLPESYATWMGEIFPKEHFKEKYAVDEVHYTADIADVLSRMTPAVLLTLRGLNTDSGSVCREASFEGISRFTVNNSLLHPVIVECRLLKTDMELEVLRYTNRISSEAHKMIMKNVKPGQKEYEMESLFQHYCYTKGGMRHTSYTCICGSGNNSSVLHYGHAGAPNDKTIQDGDMCLFDMGGEYYCYSSDITCSFPANGKFTPDQKAIYEAVLKSSRAVLAAIKPGVKWTDMHRLADRIHLEELVKLGLLHGGVDDMMKVHLGSVFMPHGLGHLLGIDVHDVGGYPE-GVDRIDEPGLRSLRMARLVQERMVLTVEPGIYFINHLLDQALSNPAQRCFINDHMLARFRGFGGVRIEDDIAVTADGVELLTCVPRTVEEIEAFMA 441          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Medaka
Match: pepd (peptidase D [Source:NCBI gene;Acc:101159424])

HSP 1 Score: 335.495 bits (859), Expect = 8.387e-110
Identity = 161/254 (63.39%), Postives = 192/254 (75.59%), Query Frame = 3
Query:  723 HHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMS 1484
            H+CY  G MR+ +Y+ I  +G N SVLHYGHAGAPND+ I+DGDMCLFDMGGEYYCY SDITCSFP NG+FT DQ+ +YEAVL +S AV  A KPGV W DMH LA+R  L  L   GLL G VD MM V LGS+FMPHGLGHL+GIDVHDVGGY E  V R + PGL+SLR  R++++ MVLT+EPG YFIN LL+ A+ NP    F+    + RFRGFGGVRIEDD+ +T DG+E +T VPRT EEIE +M+
Sbjct:  176 HYCYTKGGMRHTSYTCICGSGNNSSVLHYGHAGAPNDKTIQDGDMCLFDMGGEYYCYSSDITCSFPANGKFTPDQKAIYEAVLKSSRAVLAAIKPGVKWTDMHRLADRIHLEELVKLGLLHGGVDDMMKVHLGSVFMPHGLGHLLGIDVHDVGGYPE-GVDRIDEPGLRSLRMARLVQERMVLTVEPGIYFINHLLDQALSNPAQRCFINDHMLARFRGFGGVRIEDDIAVTADGVELLTCVPRTVEEIEAFMA 428          

HSP 2 Score: 144.05 bits (362), Expect = 2.167e-37
Identity = 78/160 (48.75%), Postives = 102/160 (63.75%), Query Frame = 3
Query:   63 PIYQLG-DGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGI 539
            P+Y LG D L V   L  +NR RL   ++ K    P S ++L+GG +     +D+ ++FRQES+FHW+FGV E D YG ID+DSGKS LF+P+L E YAT+MGE+   +  K KYAVD V+Y    ADV   L  S ++ L GLNTDS +   EASF GI
Sbjct:    7 PVYWLGNDTLRVSAALFAENRRRLCQGLQGKEGMLPKSVVVLQGGEQQQRYCTDTDVVFRQESFFHWSFGVTEADCYGAIDVDSGKSILFVPKLPESYATWMGEIFPKEHFKEKYAVDEVHYT---ADVSAALCRSDLY-LRGLNTDSGSVCREASFEGI 162          
BLAST of Xaa-Pro dipeptidase vs. Ensembl Medaka
Match: xpnpep3 (X-prolyl aminopeptidase 3 [Source:NCBI gene;Acc:101172335])

HSP 1 Score: 141.739 bits (356), Expect = 4.685e-36
Identity = 118/420 (28.10%), Postives = 194/420 (46.19%), Query Frame = 3
Query:  234 FRQESYFHWTFGVLEPDFYGLIDIDSGKS---FLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEAS--FPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECM--TEVPRTCEEIE 1472
            F Q   F +  G LEPD   L+   +G+     LF+PR       + G     D       ++ V++ +E+   LK+L  S    L+  ++   +  +  S   P +       + L   +   R +K+  E+ +++ A + +++A R  M      + E  + + F      +GA   +AY  + A G   + LHY +    N++ I+DG+M L D G E++ YVSDIT ++PVNG+F   Q  +YEAVL    +  + C PGVS   ++      +   LK  G+L+       A++    + PH +GH +G+DVHD                   L  ++ L+  MV+TIEPG Y    + E     P+H           FRG  GVRIEDDV+I D G   +  ++ P++  ++E
Sbjct:  121 FHQNQDFLYLTGFLEPD-SALVLHGTGRPDQPILFVPRRDPGRELWDGARSGKDGATALTGIERVHHTEELGLFLKSLKGS---QLWYDSSPPAHPRLHQSHVLPTLEGGPTVRT-LRPLVHSLRALKSSAEVALMQEAGRITTQAFRRTMALCGGEVDEAVLFAKFDFENRINGA-NFLAYPPVVAGGNRANTLHYIN----NNQIIKDGEMVLLDGGCEFFGYVSDITRTWPVNGKFNPIQAELYEAVLEVQHSCLSLCSPGVSLDHIYSTMLALLGRQLKRLGILKAGASDADALKAARRYCPHHVGHYLGMDVHDT----------------PELSRSQPLQPGMVITIEPGLY----ISEENEEAPKH-----------FRGL-GVRIEDDVVIRDKGGPLILSSDAPKSIADVE 498          
BLAST of Xaa-Pro dipeptidase vs. Planmine SMEST
Match: SMESG000012999.1 (SMESG000012999.1)

HSP 1 Score: 1008.05 bits (2605), Expect = 0.000e+0
Identity = 482/486 (99.18%), Postives = 485/486 (99.79%), Query Frame = 3
Query:   42 MAVRRTVPIYQLGDGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVDYI 1499
            MAVRRTVPIYQLGDGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKT+QELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAAS AVKNAC+PGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIID+INRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVDYI
Sbjct:    1 MAVRRTVPIYQLGDGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKGGSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTNQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASRAVKNACRPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDQINRFRGFGGVRIEDDVIITDDGIECMTEVPRTCEEIELWMSGVDYI 486          
BLAST of Xaa-Pro dipeptidase vs. Planmine SMEST
Match: SMESG000073371.1 (SMESG000073371.1)

HSP 1 Score: 129.798 bits (325), Expect = 1.713e-32
Identity = 112/421 (26.60%), Postives = 193/421 (45.84%), Query Frame = 3
Query:  234 FRQESYFHWTFGVLEPDFYGLIDIDSG--KSFLFIPRLSEVYATFMGELETVDQIKHKYAVDHVYYVDEIAD-VLKNLNVSVIHTLYGLNTDSQNYTIEASFPGINNFT--VDNSVLHNEITDCRVIKTDQELEVLRYANKASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMR--NVAYSSIGATGCNCSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTKDQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGDVDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRTTRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGVRIEDDVIITDDGIECMTE-VPRTCEEIE 1472
            + Q++ F++  G +  +   L++I++   K+ LFI   S+ Y  + G     D  K    +D++ Y  +  + VL +++      L+   T+S N TI      I N    +    L + I   +VIKT  E+E++R A   +S+A +       P M E Q+    L   +F   MR   +AY  + A G   +++HY  +    ++ IED ++ L D+G     Y SDIT ++P+NG F+K+Q  +Y+ +          C P  S  DMH    + +  +L   G+++        ++    + PH +GH +G+D+HD                  S+ T   L    V  +EPG Y       +   +P            R+RG  G+R+EDD ++T+ GI+C+   +PR+  EIE
Sbjct:   54 YHQDTAFYYYTGFVNKNSVLLMNINNSTIKTTLFIDNPSKEYFLWNGAYPNKDSAKSVTGIDNIEYNKDFTNLVLSSISNKENSILWI--TNSANLTIFNE--EIYNLAKIIKPMNLSSIIDKQKVIKTPSEIEIMRQAANITSEAIQSTFSFTRPSMNEQQI----LAKLFFEINMRGAKLAYPPVIAGGSRANIIHYLDS----NQNIEDNELVLVDVGANVLGYFSDITRTWPINGYFSKEQGTLYDILHRIHLDCIEICYPDKSLNDMHGFMIKQLEKYLTEEGIVKN-------LKSAFEYCPHHIGHYLGLDIHDT----------------PSISTHSPLLPGTVFPLEPGLYISK---NNGFVDP------------RYRGI-GMRLEDDFVMTETGIDCLNNGLPRSRVEIE 423          
The following BLAST results are available for this feature:
BLAST of Xaa-Pro dipeptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PEPD0.000e+057.50peptidase D [Source:HGNC Symbol;Acc:HGNC:8840][more]
PEPD0.000e+054.98peptidase D [Source:HGNC Symbol;Acc:HGNC:8840][more]
PEPD0.000e+054.12peptidase D [Source:HGNC Symbol;Acc:HGNC:8840][more]
PEPD4.437e-16951.67peptidase D [Source:HGNC Symbol;Acc:HGNC:8840][more]
PEPD5.458e-15359.56peptidase D [Source:HGNC Symbol;Acc:HGNC:8840][more]
back to top
BLAST of Xaa-Pro dipeptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
K12C11.10.000e+055.65pep chromosome:WBcel235:I:1341218:1344692:-1 gene:... [more]
K12C11.11.594e-9664.76pep chromosome:WBcel235:I:1341220:1342696:-1 gene:... [more]
R119.22.204e-1924.90pep chromosome:WBcel235:I:368370:373445:-1 gene:WB... [more]
back to top
BLAST of Xaa-Pro dipeptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Dip-C1.068e-16047.82gene:FBgn0000455 transcript:FBtr0344982[more]
Dip-C1.068e-16047.82gene:FBgn0000455 transcript:FBtr0082597[more]
CG95818.780e-3125.15gene:FBgn0031093 transcript:FBtr0070026[more]
back to top
BLAST of Xaa-Pro dipeptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pepd0.000e+056.85peptidase D [Source:ZFIN;Acc:ZDB-GENE-030131-9444][more]
xpnpep33.071e-4228.63X-prolyl aminopeptidase 3, mitochondrial [Source:Z... [more]
back to top
BLAST of Xaa-Pro dipeptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zc3h150.000e+056.21zinc finger CCCH-type containing 15 [Source:Xenbas... [more]
zc3h150.000e+054.95zinc finger CCCH-type containing 15 [Source:Xenbas... [more]
zc3h150.000e+055.16zinc finger CCCH-type containing 15 [Source:Xenbas... [more]
zc3h150.000e+055.16zinc finger CCCH-type containing 15 [Source:Xenbas... [more]
zc3h151.280e-17753.36zinc finger CCCH-type containing 15 [Source:Xenbas... [more]
back to top
BLAST of Xaa-Pro dipeptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Pepd0.000e+056.49peptidase D [Source:MGI Symbol;Acc:MGI:97542][more]
Xpnpep33.473e-4230.37X-prolyl aminopeptidase 3, mitochondrial [Source:M... [more]
Pepd1.083e-2460.00peptidase D [Source:MGI Symbol;Acc:MGI:97542][more]
Xpnpep31.195e-1827.51X-prolyl aminopeptidase 3, mitochondrial [Source:M... [more]
back to top
BLAST of Xaa-Pro dipeptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P12955|PEPD_HUMAN0.000e+057.50Xaa-Pro dipeptidase OS=Homo sapiens OX=9606 GN=PEP... [more]
sp|Q5I0D7|PEPD_RAT0.000e+056.90Xaa-Pro dipeptidase OS=Rattus norvegicus OX=10116 ... [more]
sp|Q11136|PEPD_MOUSE0.000e+056.49Xaa-Pro dipeptidase OS=Mus musculus OX=10090 GN=Pe... [more]
sp|Q5RFB3|PEPD_PONAB0.000e+056.46Xaa-Pro dipeptidase OS=Pongo abelii OX=9601 GN=PEP... [more]
sp|Q55E60|PEPD_DICDI2.170e-16349.48Xaa-Pro dipeptidase OS=Dictyostelium discoideum OX... [more]
back to top
BLAST of Xaa-Pro dipeptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RIJ60.000e+058.54Peptidase D OS=Fasciola hepatica OX=6192 GN=D915_0... [more]
A0A0R3W2X30.000e+060.37AMP_N domain-containing protein OS=Taenia asiatica... [more]
A0A4Z2DPD60.000e+058.16Xaa-Pro dipeptidase OS=Schistosoma japonicum OX=61... [more]
Q5DFD60.000e+057.96SJCHGC06332 protein OS=Schistosoma japonicum OX=61... [more]
A0A094ZPS30.000e+057.93Xaa-Pro dipeptidase OS=Schistosoma haematobium OX=... [more]
back to top
BLAST of Xaa-Pro dipeptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pepd2.357e-17150.83peptidase D [Source:ZFIN;Acc:ZDB-GENE-030131-9444][more]
xpnpep34.813e-3928.63X-prolyl aminopeptidase 3, mitochondrial [Source:Z... [more]
xpnpep26.606e-620.52X-prolyl aminopeptidase (aminopeptidase P) 2, memb... [more]
xpnpep26.939e-620.62X-prolyl aminopeptidase (aminopeptidase P) 2, memb... [more]
back to top
BLAST of Xaa-Pro dipeptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xpnpep32.196e-3426.52X-prolyl aminopeptidase 3, mitochondrial [Source:Z... [more]
back to top
BLAST of Xaa-Pro dipeptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YFR006W_mRNA2.168e-6633.02Putative X-Pro aminopeptidase; green fluorescent p... [more]
ICP553.862e-2526.42Mitochondrial aminopeptidase; cleaves the N termin... [more]
back to top
BLAST of Xaa-Pro dipeptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493390.000e+055.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295373.714e-7854.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299911.680e-5843.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340951.631e-4127.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO253501.474e-3438.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Xaa-Pro dipeptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pepd0.000e+058.32peptidase D [Source:NCBI gene;Acc:101159424][more]
pepd0.000e+060.00peptidase D [Source:NCBI gene;Acc:101159424][more]
pepd8.387e-11063.39peptidase D [Source:NCBI gene;Acc:101159424][more]
xpnpep34.685e-3628.10X-prolyl aminopeptidase 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Xaa-Pro dipeptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000012999.10.000e+099.18SMESG000012999.1[more]
SMESG000073371.11.713e-3226.60SMESG000073371.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001419 ID=SMED30001419|Name=Xaa-Pro dipeptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1641bp
CGATCTATTTTTTTTAATATTTTCGGAATATTTTCAATTCTATGGCTGTT
CGTCGTACTGTTCCAATTTATCAATTGGGTGATGGTTTACCCGTCCCTAT
GACTTTACACCAACAAAATCGAAGTCGCTTGATAAATAGAATGAAATCTA
AAAATAATAATAAACCAAACTCTTATATTTTGCTTAAAGGAGGATCTGAA
ATGTATCACGGTGGATCAGATTCTGCATTAATATTTCGACAGGAGTCCTA
TTTTCATTGGACATTTGGAGTGTTGGAACCAGACTTTTACGGATTGATTG
ATATTGATTCTGGAAAATCATTTTTATTTATACCACGCTTAAGTGAAGTG
TATGCTACTTTTATGGGCGAGTTAGAGACAGTGGATCAAATTAAACATAA
ATATGCCGTCGATCATGTTTATTATGTTGATGAAATAGCAGATGTTTTGA
AAAATCTAAATGTATCTGTGATACATACTTTGTATGGACTCAACACAGAC
AGTCAAAACTATACAATCGAGGCATCGTTTCCAGGCATTAATAATTTCAC
AGTAGACAACTCTGTTTTACACAATGAAATTACTGACTGTCGAGTTATTA
AAACTGATCAAGAATTGGAAGTACTAAGGTATGCCAATAAGGCTAGCAGT
AAAGCGCATCGAGAAATTATGCGTTCAGTACATCCCGGAATGTATGAATA
TCAAGTGGAAAGTTTATTTTTACACCATTGTTACTTTCACGGCGCTATGA
GAAATGTTGCGTATTCGTCAATCGGTGCTACAGGTTGTAATTGTTCGGTT
TTACATTATGGGCATGCTGGTGCTCCTAATGATAGAAAAATTGAAGATGG
TGACATGTGTCTTTTCGATATGGGTGGCGAGTATTACTGTTATGTTAGTG
ACATAACATGCAGTTTTCCTGTTAATGGCCGTTTTACAAAAGATCAAAGA
ATTGTTTATGAAGCAGTGCTAGCGGCCTCCAGTGCAGTTAAAAATGCTTG
CAAGCCCGGTGTCAGTTGGCTTGATATGCATTGTTTGGCAGAAAGGTCCA
TTTTAACTCATTTAAAAGGAGCTGGCCTTTTACGTGGTGATGTGGATAAA
ATGATGGCGGTACGATTAGGATCAATATTTATGCCACACGGTCTCGGTCA
TTTAATGGGAATTGATGTTCATGATGTTGGTGGATACATTGAGGATGCTG
TTCCAAGATCAGAATTACCTGGACTTAAATCATTGAGAACAACAAGAATA
TTAAAGAAAAACATGGTTCTGACCATTGAACCTGGGTGCTATTTCATAAA
TTTCTTACTAGAGTCTGCAATGAGAAATCCAGAACACTCAGAATTTTTAA
TAATCGATGAAATAAATAGATTTAGAGGATTTGGAGGGGTTAGAATTGAG
GATGATGTTATAATCACTGATGATGGAATTGAATGTATGACCGAAGTTCC
AAGAACCTGTGAAGAAATTGAATTATGGATGTCTGGGGTTGATTACATAT
AATTACTTATAATCTAGAAATGACAAAGTTTTGATTCTTGCTTTTTAATT
GTTGCCTTAAATTTTTATACGTACTTTTGATCTTAATCACTTTAACCATC
AATTAATTGAAATTTATTGTCATTTAATAAAAATCCGAAGC
back to top

protein sequence of SMED30001419-orf-1

>SMED30001419-orf-1 ID=SMED30001419-orf-1|Name=SMED30001419-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MAVRRTVPIYQLGDGLPVPMTLHQQNRSRLINRMKSKNNNKPNSYILLKG
GSEMYHGGSDSALIFRQESYFHWTFGVLEPDFYGLIDIDSGKSFLFIPRL
SEVYATFMGELETVDQIKHKYAVDHVYYVDEIADVLKNLNVSVIHTLYGL
NTDSQNYTIEASFPGINNFTVDNSVLHNEITDCRVIKTDQELEVLRYANK
ASSKAHREIMRSVHPGMYEYQVESLFLHHCYFHGAMRNVAYSSIGATGCN
CSVLHYGHAGAPNDRKIEDGDMCLFDMGGEYYCYVSDITCSFPVNGRFTK
DQRIVYEAVLAASSAVKNACKPGVSWLDMHCLAERSILTHLKGAGLLRGD
VDKMMAVRLGSIFMPHGLGHLMGIDVHDVGGYIEDAVPRSELPGLKSLRT
TRILKKNMVLTIEPGCYFINFLLESAMRNPEHSEFLIIDEINRFRGFGGV
RIEDDVIITDDGIECMTEVPRTCEEIELWMSGVDYI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036005Creatinase/aminopeptidase-like
IPR007865Aminopep_P_N
IPR029149Creatin/AminoP/Spt16_NTD
IPR000994Pept_M24
IPR028980Creatinase/Aminopeptidase_P_N
Vocabulary: molecular function
TermDefinition
GO:0030145manganese ion binding
GO:0004177aminopeptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007865Aminopeptidase P, N-terminalSMARTSM01011AMP_N_2coord: 18..155
e-value: 3.6E-27
score: 106.3
IPR007865Aminopeptidase P, N-terminalPFAMPF05195AMP_Ncoord: 23..140
e-value: 4.6E-26
score: 91.0
IPR036005Creatinase/aminopeptidase-likeGENE3DG3DSA:3.90.230.10coord: 186..485
e-value: 9.9E-108
score: 361.6
IPR036005Creatinase/aminopeptidase-likeSUPERFAMILYSSF55920Creatinase/aminopeptidasecoord: 188..481
IPR000994Peptidase M24PFAMPF00557Peptidase_M24coord: 195..460
e-value: 2.4E-53
score: 181.0
IPR029149Creatinase/Aminopeptidase P/Spt16, N-terminalGENE3DG3DSA:3.40.350.10coord: 1..185
e-value: 5.1E-71
score: 240.1
IPR029149Creatinase/Aminopeptidase P/Spt16, N-terminalSUPERFAMILYSSF53092Creatinase/prolidase N-terminal domaincoord: 18..187
NoneNo IPR availablePANTHERPTHR43226:SF1XAA-PRO DIPEPTIDASEcoord: 16..484
NoneNo IPR availablePANTHERPTHR43226FAMILY NOT NAMEDcoord: 16..484
NoneNo IPR availableCDDcd01087Prolidasecoord: 192..468
e-value: 2.76808E-119
score: 347.638