Tyrosine-protein phosphatase Lar-like

Overview
NameTyrosine-protein phosphatase Lar-like
Smed IDSMED30001408
Length (bp)5798
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein phosphatase Lar-like (SMED30001408) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein phosphatase Lar-like (SMED30001408) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein phosphatase Lar-like (SMED30001408) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein phosphatase Lar-like (SMED30001408) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001408

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30001408SMESG000042151.1 SmedASXL_005102SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30001408SMESG000042151.1 SmedASXL_007424SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30001408SMESG000042151.1 dd_Smed_v4_16093_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001408SMESG000042151.1 dd_Smed_v4_16093_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30001408SMESG000042151.1 dd_Smed_v4_16093_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30001408SMESG000042151.1 dd_Smed_v4_16093_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30001408SMESG000042151.1 dd_Smed_v6_16093_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30001408SMESG000042151.1 OX_Smed_1.0.13041ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 300.056 bits (767), Expect = 1.309e-102
Identity = 166/370 (44.86%), Postives = 228/370 (61.62%), Query Frame = 2
Query: 4067 ILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSS--------NVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            +L N  ++ +H     D V +  R NF   DS   S           + S   IPI  +AE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V LQ        +YINANY+DGY  QN YIATQGPL ET  DFW+MVWEQ+S  IVM+ R EE    KC+ YWP +GT  Y  I+VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERIK ++TV++Y  +  +R QRN+MVQTE QY FI++ LLE      +E+    L + I+  +Q+     ++G E+EF++L
Sbjct: 1324 LLNNADLAPHHPK---DPVEMR-RINFQTPDSGLRSPLREPGFHFESMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFKRL 1687          

HSP 2 Score: 96.6709 bits (239), Expect = 1.309e-102
Identity = 46/103 (44.66%), Postives = 68/103 (66.02%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      +S +  CN    KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1690 SKAHTSRF------ISANLPCNK--FKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1784          

HSP 3 Score: 205.682 bits (522), Expect = 3.241e-52
Identity = 118/314 (37.58%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F +   ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1631 MVQTEDQYSFIHEALLEA---VGCGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1939          

HSP 4 Score: 100.523 bits (249), Expect = 2.695e-20
Identity = 77/310 (24.84%), Postives = 141/310 (45.48%), Query Frame = 2
Query:  824 NNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSME-NKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGM--PVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTL 1741
            N   +  +V+ Y+S+ Q      P++ I  D    + Y++  L P + Y IW++++NS+G+    +SV   T E  P   P ++ A  +S T + V+W+   + NG+++ Y + +T   + P  +W++++   S  + +  L  +  + + + A  +VG GPLS P+ + T+ G   +    RA      SI L W+ P          +  E+ ++   +  E  +  + TT   S+ + ++K +TE  F L A +  G G   PV        K       V  +   S  I+  WR P  +  N  L
Sbjct:  356 NPDPVSYYVIEYKSKSQ----DGPYQ-IKEDITTTR-YSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSPPRQESI-----IKYELLFREGDHGREVGRTFDPTT---SYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGAL 651          

HSP 5 Score: 85.8853 bits (211), Expect = 9.229e-16
Identity = 136/613 (22.19%), Postives = 245/613 (39.97%), Query Frame = 2
Query:  965 TYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYS--MENKIVN---ITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGK----AKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYRTLPIIR------SEFQIDEWKIYNF--TRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSI--------YTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIY-MSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNS------------TDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNR-MPYVFSKNLL 2677
            TY + + +  S+G   +   ++  T + +P G P ++ A A S T++ + W    + + I  KY LL+ E  D   +  R +D  + S ++  L PN  +   + A +  G G  +  V   T     S  P+  +   +   +I++ W  P P +T N   +   + Y+ PL S   E K VN    TT Q   E   +++ T+   T  A  +VG G     ++V   +    A   K   + +  T+  ++  WR P    ++  ++ ++ +         R  P I+      ++++ D+   Y    T L+P   Y I +  + + G+    +       V+ TK A    +G   L      +G  +++A WE         ++    L YR+ F  E ST   ++        YT    H          G TY F LA            +++++PE  P   P +++     S   V L+W  P    RNG ++   V +     +  +             +N ++   L P+  Y L+VR+ TR   GP+S    +  +  + + PK  +   +M T + + W    + N   PY    N L
Sbjct:  496 TYTVRVLAFTSVGDGPLSDPIQVKTQQGVP-GQPMNLRAEARSETSITLSWSPPRQESII--KYELLFRE-GDHGREVGRTFDPTT-SYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPP-PPETHNGALVGYSVRYR-PLGSEDPEPKEVNGIPPTTTQILLEA--LEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVL--WRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSK-----PKVVVTKGA---VLGRPTLSVQQTPEG--SLLARWEP-----PAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVH---------KGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGPFSPPVRYRTFLRDQVSPKNFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGL 1073          

HSP 6 Score: 84.7297 bits (208), Expect = 1.636e-15
Identity = 35/82 (42.68%), Postives = 55/82 (67.07%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  + G+ GSDYINA+Y+D Y    AYI +Q P+  T  DFWR+VW+Q  + IV++ ++EE  +++
Sbjct: 1419 KNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIK 1500          

HSP 7 Score: 78.9518 bits (193), Expect = 1.012e-13
Identity = 65/286 (22.73%), Postives = 116/286 (40.56%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVE------KINGILKKYILLWTEHSDLPHQ---------HWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYK--SPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG-MPVKLLIVSAGKAKINKNVVDIIG-CTSFTIVARWRQPNKDAKNMTL 1741
            L+ L  +T YRI   +   +G       V   T ED+P  PP  + A A++ TA+ V W+S        +I G    Y+ +    +  P +          W   D      +I++L P   + IT+ A    G G  SKP  ++TK G +   P     +    S++  W  P  T      G  L+   +  +PL ++E        ++  +    V +    VF L A ++ G G    ++L +     + +  +++  G  ++ T++ RW  P    +N  +
Sbjct:  683 LEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTK-GAVLGRPTLSVQQTPEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLE-----FPPSEDRYTASGVHKGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNGAI 962          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 299.286 bits (765), Expect = 2.084e-102
Identity = 155/323 (47.99%), Postives = 212/323 (65.63%), Query Frame = 2
Query: 4184 LKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            + S   IPI  +AE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V LQ        +YINANY+DGY  QN YIATQGPL ET  DFW+MVWEQ+S  IVM+ R EE    KC+ YWP +GT  Y  I+VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERIK ++TV++Y  +  +R QRN+MVQTE QY FI++ LLE      +E+    L + I+  +Q+     ++G E+EF++L
Sbjct: 1329 MLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFKRL 1649          

HSP 2 Score: 96.6709 bits (239), Expect = 2.084e-102
Identity = 46/103 (44.66%), Postives = 68/103 (66.02%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      +S +  CN    KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1652 SKAHTSRF------ISANLPCNK--FKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1746          

HSP 3 Score: 205.297 bits (521), Expect = 3.897e-52
Identity = 118/314 (37.58%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F +   ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1593 MVQTEDQYSFIHEALLEA---VGCGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1901          

HSP 4 Score: 100.523 bits (249), Expect = 2.634e-20
Identity = 77/310 (24.84%), Postives = 141/310 (45.48%), Query Frame = 2
Query:  824 NNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSME-NKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGM--PVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTL 1741
            N   +  +V+ Y+S+ Q      P++ I  D    + Y++  L P + Y IW++++NS+G+    +SV   T E  P   P ++ A  +S T + V+W+   + NG+++ Y + +T   + P  +W++++   S  + +  L  +  + + + A  +VG GPLS P+ + T+ G   +    RA      SI L W+ P          +  E+ ++   +  E  +  + TT   S+ + ++K +TE  F L A +  G G   PV        K       V  +   S  I+  WR P  +  N  L
Sbjct:  343 NPDPVSYYVIEYKSKSQ----DGPYQ-IKEDITTTR-YSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSPPRQESI-----IKYELLFREGDHGREVGRTFDPTT---SYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGAL 638          

HSP 5 Score: 86.6557 bits (213), Expect = 5.496e-16
Identity = 135/605 (22.31%), Postives = 241/605 (39.83%), Query Frame = 2
Query:  965 TYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYS--MENKIVN---ITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGK----AKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSI--------YTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIY-MSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNS------------TDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNR-MPYVFSKNLL 2677
            TY + + +  S+G   +   ++  T + +P G P ++ A A S T++ + W    + + I  KY LL+ E  D   +  R +D  + S ++  L PN  +   + A +  G G  +  V   T     S  P+  +   +   +I++ W  P P +T N   +   + Y+ PL S   E K VN    TT Q   E   +++ T+   T  A  +VG G     ++V   +    A   K   + +  T+  ++  WR P    ++  ++ ++ +         R  P I+     D  ++   T L+P   Y I +  + + G+    +       V+ TK A    +G   L      +G  +++A WE         ++    L YR+ F  E ST   ++        YT    H          G TY F LA            +++++PE  P   P +++     S   V L+W  P    RNG ++   V +     +  +             +N ++   L P+  Y L+VR+ TR   GP+S    +  +  + + PK  +   +M T + + W    + N   PY    N L
Sbjct:  483 TYTVRVLAFTSVGDGPLSDPIQVKTQQGVP-GQPMNLRAEARSETSITLSWSPPRQESII--KYELLFRE-GDHGREVGRTFDPTT-SYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPP-PPETHNGALVGYSVRYR-PLGSEDPEPKEVNGIPPTTTQILLEA--LEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVL--WRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQEMV-ITNLQPETAYSITVAAYTMKGDGARSK-----PKVVVTKGA---VLGRPTLSVQQTPEG--SLLARWEP-----PAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVH---------KGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGPFSPPVRYRTFLRDQVSPKNFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGL 1051          

HSP 6 Score: 84.7297 bits (208), Expect = 1.628e-15
Identity = 35/82 (42.68%), Postives = 55/82 (67.07%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  + G+ GSDYINA+Y+D Y    AYI +Q P+  T  DFWR+VW+Q  + IV++ ++EE  +++
Sbjct: 1381 KNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIK 1462          

HSP 7 Score: 79.7221 bits (195), Expect = 6.615e-14
Identity = 64/277 (23.10%), Postives = 117/277 (42.24%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVE------KINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYK--SPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG-MPVKLLIVSAGKAKINKNVVDIIG-CTSFTIVARWRQPNKDAKNMTL 1741
            L+ L  +T YRI   +   +G       V   T ED+P  PP  + A A++ TA+ V W+S        +I G    Y+ +    +  P +      A ++  +I++L P   + IT+ A    G G  SKP  ++TK G +   P     +    S++  W  P  T      G  L+   +  +PL ++E        ++  +    V +    VF L A ++ G G    ++L +     + +  +++  G  ++ T++ RW  P    +N  +
Sbjct:  670 LEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTK-GAVLGRPTLSVQQTPEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLE-----FPPSEDRYTASGVHKGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNGAI 940          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 299.286 bits (765), Expect = 4.371e-102
Identity = 163/356 (45.79%), Postives = 228/356 (64.04%), Query Frame = 2
Query: 4169 VSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            + S+ + S   IPI +LA++I  LK+ D L   QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +Y+NANYIDGY KQN YIATQG L ET  DFW+M+WEQ+S  +VM+ + EE    KC+ YWP +GT  +  ++VTL+  +  A Y +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L + I+  +QI    +++G E+EF++L     +  ++ SR I  N   NK K  L
Sbjct:  919 LHSSSMASHPPIPILELADHIERLKANDNLKFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRL----ASSKAHTSRFISANLPCNKFKNRL 1268          

HSP 2 Score: 95.9005 bits (237), Expect = 4.371e-102
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1261 CNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLRE 1341          

HSP 3 Score: 205.297 bits (521), Expect = 2.471e-52
Identity = 119/314 (37.90%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F ++  ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE QY F Y   LE+
Sbjct: 1188 MVQTEDQYIFIHDALLEA---VTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEY 1496          

HSP 4 Score: 95.9005 bits (237), Expect = 6.450e-19
Identity = 68/281 (24.20%), Postives = 130/281 (46.26%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQH---WRQYD-AKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGK 1765
            Y++  L P++ Y   + ++N++G+    + V   TSE  P   P  + A  +S+T + V+WK  E+ NG ++ Y + +T     P QH   W +++ A S+ + I +L P + + + + A  ++G GPLS  + ++T++G   +   F+A      SI+L W  P  + T+     N E+ YK   +  E +I        S+ +  +K ++   F L A +  G G     +     ++   KN   +      +++  W  P      M  ++   +GK
Sbjct:  368 YSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMD---PTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPR-SDTI----ANYELVYKDGEHGEEQRIT--IEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSMFAKN-FHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGK 637          

HSP 5 Score: 87.4261 bits (215), Expect = 2.595e-16
Identity = 36/82 (43.90%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV LS++ G+ GSDY+NA+YID Y K  AYI +Q  +  T  DFWR++W+Q  + +V++ K+EE  +V+
Sbjct:  976 KNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVK 1057          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 299.286 bits (765), Expect = 4.371e-102
Identity = 163/356 (45.79%), Postives = 228/356 (64.04%), Query Frame = 2
Query: 4169 VSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            + S+ + S   IPI +LA++I  LK+ D L   QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +Y+NANYIDGY KQN YIATQG L ET  DFW+M+WEQ+S  +VM+ + EE    KC+ YWP +GT  +  ++VTL+  +  A Y +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L + I+  +QI    +++G E+EF++L     +  ++ SR I  N   NK K  L
Sbjct:  919 LHSSSMASHPPIPILELADHIERLKANDNLKFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRL----ASSKAHTSRFISANLPCNKFKNRL 1268          

HSP 2 Score: 95.9005 bits (237), Expect = 4.371e-102
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1261 CNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLRE 1341          

HSP 3 Score: 205.297 bits (521), Expect = 2.471e-52
Identity = 119/314 (37.90%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F ++  ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE QY F Y   LE+
Sbjct: 1188 MVQTEDQYIFIHDALLEA---VTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEY 1496          

HSP 4 Score: 95.9005 bits (237), Expect = 6.450e-19
Identity = 68/281 (24.20%), Postives = 130/281 (46.26%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQH---WRQYD-AKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGK 1765
            Y++  L P++ Y   + ++N++G+    + V   TSE  P   P  + A  +S+T + V+WK  E+ NG ++ Y + +T     P QH   W +++ A S+ + I +L P + + + + A  ++G GPLS  + ++T++G   +   F+A      SI+L W  P  + T+     N E+ YK   +  E +I        S+ +  +K ++   F L A +  G G     +     ++   KN   +      +++  W  P      M  ++   +GK
Sbjct:  368 YSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMD---PTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPR-SDTI----ANYELVYKDGEHGEEQRIT--IEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSMFAKN-FHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGK 637          

HSP 5 Score: 87.4261 bits (215), Expect = 2.595e-16
Identity = 36/82 (43.90%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV LS++ G+ GSDY+NA+YID Y K  AYI +Q  +  T  DFWR++W+Q  + +V++ K+EE  +V+
Sbjct:  976 KNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVK 1057          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 298.901 bits (764), Expect = 4.557e-102
Identity = 163/356 (45.79%), Postives = 228/356 (64.04%), Query Frame = 2
Query: 4169 VSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            + S+ + S   IPI +LA++I  LK+ D L   QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +Y+NANYIDGY KQN YIATQG L ET  DFW+M+WEQ+S  +VM+ + EE    KC+ YWP +GT  +  ++VTL+  +  A Y +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L + I+  +QI    +++G E+EF++L     +  ++ SR I  N   NK K  L
Sbjct:  919 LHSSSMASHPPIPILELADHIERLKANDNLKFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRL----ASSKAHTSRFISANLPCNKFKNRL 1268          

HSP 2 Score: 95.9005 bits (237), Expect = 4.557e-102
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1261 CNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLRE 1341          

HSP 3 Score: 205.297 bits (521), Expect = 2.389e-52
Identity = 119/314 (37.90%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F ++  ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE QY F Y   LE+
Sbjct: 1188 MVQTEDQYIFIHDALLEA---VTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEY 1496          

HSP 4 Score: 95.9005 bits (237), Expect = 6.184e-19
Identity = 68/281 (24.20%), Postives = 130/281 (46.26%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQH---WRQYD-AKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGK 1765
            Y++  L P++ Y   + ++N++G+    + V   TSE  P   P  + A  +S+T + V+WK  E+ NG ++ Y + +T     P QH   W +++ A S+ + I +L P + + + + A  ++G GPLS  + ++T++G   +   F+A      SI+L W  P  + T+     N E+ YK   +  E +I        S+ +  +K ++   F L A +  G G     +     ++   KN   +      +++  W  P      M  ++   +GK
Sbjct:  368 YSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMD---PTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPR-SDTI----ANYELVYKDGEHGEEQRIT--IEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSMFAKN-FHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGK 637          

HSP 5 Score: 87.4261 bits (215), Expect = 2.617e-16
Identity = 36/82 (43.90%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV LS++ G+ GSDY+NA+YID Y K  AYI +Q  +  T  DFWR++W+Q  + +V++ K+EE  +V+
Sbjct:  976 KNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVK 1057          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 277.715 bits (709), Expect = 1.900e-91
Identity = 155/345 (44.93%), Postives = 210/345 (60.87%), Query Frame = 2
Query: 4190 SRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRIHGNATVNKQK 5224
            S   +PI +LA +I  L+  +      EFE +  ET + ++  +S+   NK KNRYAN+ AYDHS V L N       +YINANY+DGY K   YIATQGPL ET  DFW+MVWE++S  IVML   EE    KC+ YWP +GT  Y DIEVTL+  +  A+YT+R  ++K  G    R++  LQ+T WPD G+P    PFL FLK  K  + +D+GP I HCSAG+GRTG FIV+D  +ER+++D TV+IY  + A+R QR++MVQTE QY FI+D +L+      +E+    L   +   SQ    + LSG ++EF+ L     T  SN   +  N  VN+ K
Sbjct:  670 SHPAVPIAELANHIERLRMNNNAGFQSEFESI--ETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ-PSADQLSGIDMEFRHLTTLKWT--SNRCTV-ANLPVNRPK 1008          

HSP 2 Score: 80.4925 bits (197), Expect = 1.900e-91
Identity = 36/77 (46.75%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN     +P+D NRV +  + G DGSDYINAS+ID Y +  AYI +Q P   T  DFWR +W+ N  II +L +  E
Sbjct: 1008 KNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNE 1084          

HSP 3 Score: 161.77 bits (408), Expect = 1.571e-39
Identity = 94/286 (32.87%), Postives = 146/286 (51.05%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLK--SYDYLNMM-QEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWP-KKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +P  +L ++++ L   S D L+ +  EF  L            +NLP N+ KNR  +   YD + V ++     D  +YINA++IDGY ++  YIATQ P  ETA DFW+ +WE  S II MLVR  E   ++C  YWP + G ++   +   +  +  + Y+ +R+F+I        R V Q  F  WPD G P                Y +F    +GP  VHC +G GRT VFI +   ++R++ +  V+++  +K +R +R  M+Q   QY F+Y    E+
Sbjct:  957 VPASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYH-LREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGC--TGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEY 1239          

HSP 4 Score: 81.2629 bits (199), Expect = 7.376e-15
Identity = 35/82 (42.68%), Postives = 54/82 (65.85%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++  +D +RV LS++ G  G DYINA+Y+D Y K ++YI +Q P+  T  DFWR+VW++    IV+L  +EE  +V+
Sbjct:  720 KNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVK 801          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 278.1 bits (710), Expect = 2.115e-91
Identity = 155/346 (44.80%), Postives = 211/346 (60.98%), Query Frame = 2
Query: 4190 SRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRIH-GNATVNKQK 5224
            S   +PI +LA +I  L+  +      EFE +  ET + ++  +S+   NK KNRYAN+ AYDHS V L N       +YINANY+DGY K   YIATQGPL ET  DFW+MVWE++S  IVML   EE    KC+ YWP +GT  Y DIEVTL+  +  A+YT+R  ++K  G    R++  LQ+T WPD G+P    PFL FLK  K  + +D+GP I HCSAG+GRTG FIV+D  +ER+++D TV+IY  + A+R QR++MVQTE QY FI+D +L+      +E+    L   +   SQ    + LSG ++EF+ L    TT+    +R    N  VN+ K
Sbjct:  890 SHPAVPIAELANHIERLRMNNNAGFQSEFESI--ETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ-PSADQLSGIDMEFRHL----TTLKWTSNRCTVANLPVNRPK 1228          

HSP 2 Score: 79.7221 bits (195), Expect = 2.115e-91
Identity = 36/77 (46.75%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN     +P+D NRV +  + G DGSDYINAS+ID Y +  AYI +Q P   T  DFWR +W+ N  II +L +  E
Sbjct: 1228 KNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNE 1304          

HSP 3 Score: 162.155 bits (409), Expect = 1.640e-39
Identity = 94/286 (32.87%), Postives = 146/286 (51.05%), Query Frame = 2
Query: 4202 IPIDKLAEYINDL--KSYDYLNMM-QEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWP-KKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +P  +L ++++ L   S D L+ +  EF  L            +NLP N+ KNR  +   YD + V ++     D  +YINA++IDGY ++  YIATQ P  ETA DFW+ +WE  S II MLVR  E   ++C  YWP + G ++   +   +  +  + Y+ +R+F+I        R V Q  F  WPD G P                Y +F    +GP  VHC +G GRT VFI +   ++R++ +  V+++  +K +R +R  M+Q   QY F+Y    E+
Sbjct: 1177 VPASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYH-LREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGC--TGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEY 1459          

HSP 4 Score: 80.4925 bits (197), Expect = 1.283e-14
Identity = 35/82 (42.68%), Postives = 54/82 (65.85%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++  +D +RV LS++ G  G DYINA+Y+D Y K ++YI +Q P+  T  DFWR+VW++    IV+L  +EE  +V+
Sbjct:  940 KNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVK 1021          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 278.1 bits (710), Expect = 2.376e-91
Identity = 155/346 (44.80%), Postives = 211/346 (60.98%), Query Frame = 2
Query: 4190 SRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRIH-GNATVNKQK 5224
            S   +PI +LA +I  L+  +      EFE +  ET + ++  +S+   NK KNRYAN+ AYDHS V L N       +YINANY+DGY K   YIATQGPL ET  DFW+MVWE++S  IVML   EE    KC+ YWP +GT  Y DIEVTL+  +  A+YT+R  ++K  G    R++  LQ+T WPD G+P    PFL FLK  K  + +D+GP I HCSAG+GRTG FIV+D  +ER+++D TV+IY  + A+R QR++MVQTE QY FI+D +L+      +E+    L   +   SQ    + LSG ++EF+ L    TT+    +R    N  VN+ K
Sbjct:  910 SHPAVPIAELANHIERLRMNNNAGFQSEFESI--ETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ-PSADQLSGIDMEFRHL----TTLKWTSNRCTVANLPVNRPK 1248          

HSP 2 Score: 79.7221 bits (195), Expect = 2.376e-91
Identity = 36/77 (46.75%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN     +P+D NRV +  + G DGSDYINAS+ID Y +  AYI +Q P   T  DFWR +W+ N  II +L +  E
Sbjct: 1248 KNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNE 1324          

HSP 3 Score: 162.155 bits (409), Expect = 1.824e-39
Identity = 94/286 (32.87%), Postives = 146/286 (51.05%), Query Frame = 2
Query: 4202 IPIDKLAEYINDL--KSYDYLNMM-QEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWP-KKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +P  +L ++++ L   S D L+ +  EF  L            +NLP N+ KNR  +   YD + V ++     D  +YINA++IDGY ++  YIATQ P  ETA DFW+ +WE  S II MLVR  E   ++C  YWP + G ++   +   +  +  + Y+ +R+F+I        R V Q  F  WPD G P                Y +F    +GP  VHC +G GRT VFI +   ++R++ +  V+++  +K +R +R  M+Q   QY F+Y    E+
Sbjct: 1197 VPASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYH-LREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGC--TGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEY 1479          

HSP 4 Score: 80.4925 bits (197), Expect = 1.288e-14
Identity = 35/82 (42.68%), Postives = 54/82 (65.85%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++  +D +RV LS++ G  G DYINA+Y+D Y K ++YI +Q P+  T  DFWR+VW++    IV+L  +EE  +V+
Sbjct:  960 KNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVK 1041          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 278.1 bits (710), Expect = 2.606e-91
Identity = 155/345 (44.93%), Postives = 210/345 (60.87%), Query Frame = 2
Query: 4190 SRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRIHGNATVNKQK 5224
            S   +PI +LA +I  L+  +      EFE +  ET + ++  +S+   NK KNRYAN+ AYDHS V L N       +YINANY+DGY K   YIATQGPL ET  DFW+MVWE++S  IVML   EE    KC+ YWP +GT  Y DIEVTL+  +  A+YT+R  ++K  G    R++  LQ+T WPD G+P    PFL FLK  K  + +D+GP I HCSAG+GRTG FIV+D  +ER+++D TV+IY  + A+R QR++MVQTE QY FI+D +L+      +E+    L   +   SQ    + LSG ++EF+ L     T  SN   +  N  VN+ K
Sbjct:  639 SHPAVPIAELANHIERLRMNNNAGFQSEFESI--ETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ-PSADQLSGIDMEFRHLTTLKWT--SNRCTV-ANLPVNRPK 977          

HSP 2 Score: 79.7221 bits (195), Expect = 2.606e-91
Identity = 36/77 (46.75%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN     +P+D NRV +  + G DGSDYINAS+ID Y +  AYI +Q P   T  DFWR +W+ N  II +L +  E
Sbjct:  977 KNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNE 1053          

HSP 3 Score: 162.155 bits (409), Expect = 1.203e-39
Identity = 94/286 (32.87%), Postives = 146/286 (51.05%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLK--SYDYLNMM-QEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWP-KKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +P  +L ++++ L   S D L+ +  EF  L            +NLP N+ KNR  +   YD + V ++     D  +YINA++IDGY ++  YIATQ P  ETA DFW+ +WE  S II MLVR  E   ++C  YWP + G ++   +   +  +  + Y+ +R+F+I        R V Q  F  WPD G P                Y +F    +GP  VHC +G GRT VFI +   ++R++ +  V+++  +K +R +R  M+Q   QY F+Y    E+
Sbjct:  926 VPASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYH-LREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGC--TGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEY 1208          

HSP 4 Score: 80.4925 bits (197), Expect = 1.202e-14
Identity = 35/82 (42.68%), Postives = 54/82 (65.85%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++  +D +RV LS++ G  G DYINA+Y+D Y K ++YI +Q P+  T  DFWR+VW++    IV+L  +EE  +V+
Sbjct:  689 KNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVK 770          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 277.715 bits (709), Expect = 3.789e-91
Identity = 155/345 (44.93%), Postives = 210/345 (60.87%), Query Frame = 2
Query: 4190 SRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRIHGNATVNKQK 5224
            S   +PI +LA +I  L+  +      EFE +  ET + ++  +S+   NK KNRYAN+ AYDHS V L N       +YINANY+DGY K   YIATQGPL ET  DFW+MVWE++S  IVML   EE    KC+ YWP +GT  Y DIEVTL+  +  A+YT+R  ++K  G    R++  LQ+T WPD G+P    PFL FLK  K  + +D+GP I HCSAG+GRTG FIV+D  +ER+++D TV+IY  + A+R QR++MVQTE QY FI+D +L+      +E+    L   +   SQ    + LSG ++EF+ L     T  SN   +  N  VN+ K
Sbjct:  506 SHPAVPIAELANHIERLRMNNNAGFQSEFESI--ETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ-PSADQLSGIDMEFRHLTTLKWT--SNRCTV-ANLPVNRPK 844          

HSP 2 Score: 79.337 bits (194), Expect = 3.789e-91
Identity = 36/77 (46.75%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN     +P+D NRV +  + G DGSDYINAS+ID Y +  AYI +Q P   T  DFWR +W+ N  II +L +  E
Sbjct:  844 KNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNE 920          

HSP 3 Score: 162.155 bits (409), Expect = 1.129e-39
Identity = 94/286 (32.87%), Postives = 146/286 (51.05%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLK--SYDYLNMM-QEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWP-KKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +P  +L ++++ L   S D L+ +  EF  L            +NLP N+ KNR  +   YD + V ++     D  +YINA++IDGY ++  YIATQ P  ETA DFW+ +WE  S II MLVR  E   ++C  YWP + G ++   +   +  +  + Y+ +R+F+I        R V Q  F  WPD G P                Y +F    +GP  VHC +G GRT VFI +   ++R++ +  V+++  +K +R +R  M+Q   QY F+Y    E+
Sbjct:  793 VPASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYH-LREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGC--TGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEY 1075          

HSP 4 Score: 80.1073 bits (196), Expect = 1.299e-14
Identity = 35/82 (42.68%), Postives = 54/82 (65.85%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++  +D +RV LS++ G  G DYINA+Y+D Y K ++YI +Q P+  T  DFWR+VW++    IV+L  +EE  +V+
Sbjct:  556 KNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVK 637          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0081260)

HSP 1 Score: 289.271 bits (739), Expect = 3.586e-78
Identity = 158/348 (45.40%), Postives = 216/348 (62.07%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKT-ILHI 5239
            IPI + A +I  LKS D     QE+E +  E  ++++  NSNL  NK KNRYAN+TAYDHS V L         +YINANY DGY K N Y+ATQGPL ET  DFW+M WE K+  IVM+ R EE    KC+ YWP +GT  Y  I VT+      A Y+IR FQ+ + GF+ +R++ QLQFT WPD G+P    PFL FL+  +  +  +SGP IVHCSAGVGRTG +IV+DS +ER+KH++ ++IY  +  +R QRN+MVQTE QY FI+D +LE      +E+    L + ++         ++SG E+EF+KL    + +  + S+ +  N   NK K  ++HI
Sbjct: 1454 IPISEFANHIERLKSNDNQKFSQEYESI--EPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGETISGMEVEFKKL----SNVKMDSSKFVTANLPCNKHKNRLVHI 1795          

HSP 2 Score: 183.341 bits (464), Expect = 1.003e-45
Identity = 97/263 (36.88%), Postives = 151/263 (57.41%), Query Frame = 2
Query: 4259 NMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
             M  EF++L+   ++    + +NLP NK KNR  +I  Y+ S V L      +  +Y+NA++IDGY  ++ YIA QGP+ + A DFW+M+WE  STI+VML + +E   +KC  YWP + +  Y    V  ++  +   Y +R+F++      + R V Q QF  WP+QG+P              K  ++F +   GP  VHCSAGVGR+GVFI +   +ER++++  ++++  ++ +R QR  MVQTE QY F Y   LE+
Sbjct: 1760 GMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEY 2020          

HSP 3 Score: 101.293 bits (251), Expect = 7.555e-21
Identity = 226/1054 (21.44%), Postives = 404/1054 (38.33%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKS--IVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCT--SFTIVARWRQPNKDAKNMTL-------QLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLK---GHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQI-----MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSV----PENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSEKEISLD-YNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNS-KFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSHEFSLIE-LKTNAKQNKLILPILALSRKPIQLFGNQPHYDFLFTYNFTKPNKMDRFSDGNF-----YRSALRACVETDEGHFLCNTSDWSESFQI----------------NFILQDELKVQNSKNTENILKPKHNDKAVXXXXXXXXXXXXAIVGIIIGCVVHKRKLPSKKWENSCRSSTPKIQQD--AQMTPLVDLDTPKLD 3949
            T+ +L P   Y + + +  S+G   +   V+    + +P  P ++  A+ I  TAV ++W      +  +  Y L W +       H R   + SE+  +  L P+ ++YI + A +  G+G  + P+ + TK   +   P    + I   S  I L W  P P +  N   +  ++ +   +   +++   +T N  S  +  +K  TE    + A   VG G P    I+   +  +  +  D+      S +I   W+ P +  +N  +       Q     GK F    ++        F + +   +N T L+P  KY I++  L      +   +     V++T        G   ++  V+LK     P V  E E    +++   +      YR+ +  +       + +       +   L + GV YEF +A   ++       K+   PEG P   PS I + + +   + + W  P  + RNG +   +VQ        L    N T     F  L  N  Y  RVR+ T+   GP+S              P  ++A    +    + W         P      LLG+ I+Y T   +     W Q K        ++ N+EK   Y V +++  + N  G+ SE       PE+V L         NL+ +  +++S+ L    P+  T +N   +++    +F         + V ++EI L  Y K  TI      +L+  T Y + +  I S  S +  + IT++T        + P       +V      +IL   +  E  G I +Y+L+VVP   KS +     +K   +F   + L    K  +   P +A            P     FT++    +    F++        YR  +RA V+T + H L  +S +SE   +                N+  + E+ V  +K+   IL           +   +    +    +I+ CVV +R+ P K  + +   + P +  D  A  TP   +D  +L+
Sbjct:  477 TVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQP-SNFRATDIGETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHHKRI--SNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQ-YVPGAPPRNITAIATSSTTISLSWLPP-PVERSNGRIIYYKVFFVE-VGREDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTSVGDG-PRSHPIILRTQEDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFK--------FDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAI----VVKTP-------GGVPVRPTVSLKIMEREPIVSIELE----WERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRFDNLER-GVEYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWE--------PVTSRGKLLGYKIFY-TMTAVEDLDDW-QTKTVGLTESADLVNLEKFAQYAVAIAARFK-NGLGRLSEKVTVRIKPEDVPL---------NLRAHDVSTHSMTLSWSPPIRLTPVN-YKISFDAMKVFVDSQGFSQTQIVPKREIILKHYVKTHTI-----NELSPFTTYNVNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFY---GVVNGEEILVILP--QASEEYGPISHYYLVVVP-EDKSNL-----HKIPDQFLTDDLLPGRNKPERPNAPYIA---------AKFPQRSIPFTFHLGSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKH-LYTSSPFSEFLSLDMREAPPGERPHRPDPNWPAEPEVSVNRNKDEPEIL---------WVVLPLMVSTFIVSTALIVLCVVKRRRQPCKTPDQAA-VTRPLMAADLGAGPTPSDPVDMRRLN 1442          

HSP 4 Score: 92.8189 bits (229), Expect = 2.834e-18
Identity = 114/467 (24.41%), Postives = 208/467 (44.54%), Query Frame = 2
Query:  359 EDNNNLLTCESENVMGTD-SQTTKIRVFKHEMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICW--KLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHW-RQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG-----MPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKN 1732
            E++     C +EN MGT+ S+ T + V    +   F     E  S+  L    S   + C    S    V W +  E +  PE E+ + ++V    + NI  ++   Y C +   + GQI     + +  +P   T+V ++E T+TS  + W  K P +   ++ +V+ Y+ +   ++ S     I+  +     Y ++ L P+T Y  ++ ++N++G+          T E   +  P ++    +S++ + + W+  E  NG +  Y + +T +S+ P   W  Q    SE + +S LTP+ I+ + +QA  ++G GP+S PV +  + G  S+   FRA+ I   ++ L+W  P    + N     L   Y +  Y+ +     I +N  ++ +  +  DT     L A +Q G G     +PV+      G    N   +  I  +S TI   W  P  +  N
Sbjct:  201 EEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPP-ETISEVML---GSNLNLSCIAVGSPMPHVKWMKGSEDLT-PENEMPIGRNV--LQLINI--QESANYTC-IAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPED---LQYYVIQYKPKNANQAFS-EISGIITMY-----YVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPT-HSSENIVHYEL---YWNDTYANQAHHKRI-SNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRN---ITAIATSSTTISLSWLPPPVERSN 640          

HSP 5 Score: 90.1225 bits (222), Expect = 2.067e-17
Identity = 36/81 (44.44%), Postives = 57/81 (70.37%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   H++P++ +RV L+ + G++GSDY+NAS+ID Y    AYI +Q P+    EDFWR++W+ N +I+V+L K++E
Sbjct: 1785 CNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKE 1865          

HSP 6 Score: 79.337 bits (194), Expect = 3.830e-14
Identity = 33/83 (39.76%), Postives = 54/83 (65.06%), Query Frame = 1
Query: 5218 TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            +KN   ++  +D +RV L ++ GV GSDYINA+Y D Y K  AY+ +Q P+  T  DFWR+ W+   + IV++ ++EE  +++
Sbjct: 1499 SKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIK 1581          

HSP 7 Score: 63.1586 bits (152), Expect = 3.283e-9
Identity = 45/171 (26.32%), Postives = 78/171 (45.61%), Query Frame = 2
Query:  929 QCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRW--KSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSL------ISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDP 1417
            + YTL  L+P T Y IW+ + +  G+      +   T + +P  PP +ITA A S+T + + W    VE+ NG +  Y + + E         R+ D  +  +L      +  L     + I + A  +VG GP S P+ + T+     +  + +A+ +   SI + W  P
Sbjct:  569 EAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVG-------REDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQEDVPGDPQDVKATPLNSTSIHVSWKPP 732          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0305950)

HSP 1 Score: 288.886 bits (738), Expect = 4.000e-78
Identity = 158/348 (45.40%), Postives = 216/348 (62.07%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKT-ILHI 5239
            IPI + A +I  LKS D     QE+E +  E  ++++  NSNL  NK KNRYAN+TAYDHS V L         +YINANY DGY K N Y+ATQGPL ET  DFW+M WE K+  IVM+ R EE    KC+ YWP +GT  Y  I VT+      A Y+IR FQ+ + GF+ +R++ QLQFT WPD G+P    PFL FL+  +  +  +SGP IVHCSAGVGRTG +IV+DS +ER+KH++ ++IY  +  +R QRN+MVQTE QY FI+D +LE      +E+    L + ++         ++SG E+EF+KL    + +  + S+ +  N   NK K  ++HI
Sbjct: 1337 IPISEFANHIERLKSNDNQKFSQEYESI--EPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGETISGMEVEFKKL----SNVKMDSSKFVTANLPCNKHKNRLVHI 1678          

HSP 2 Score: 183.341 bits (464), Expect = 9.518e-46
Identity = 97/263 (36.88%), Postives = 151/263 (57.41%), Query Frame = 2
Query: 4259 NMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
             M  EF++L+   ++    + +NLP NK KNR  +I  Y+ S V L      +  +Y+NA++IDGY  ++ YIA QGP+ + A DFW+M+WE  STI+VML + +E   +KC  YWP + +  Y    V  ++  +   Y +R+F++      + R V Q QF  WP+QG+P              K  ++F +   GP  VHCSAGVGR+GVFI +   +ER++++  ++++  ++ +R QR  MVQTE QY F Y   LE+
Sbjct: 1643 GMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEY 1903          

HSP 3 Score: 139.428 bits (350), Expect = 2.151e-32
Identity = 278/1249 (22.26%), Postives = 499/1249 (39.95%), Query Frame = 2
Query:  359 EDNNNLLTCESENVMGTD-SQTTKIRVFKHEMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICW--KLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHW-RQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCT--SFTIVARWRQPNKDAKNMTL-------QLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLK---GHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQI-----MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSV----PENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSEKEISLD-YNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNS-KFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSHEFSLIE-LKTNAKQNKLILPILALSRKPIQLFGNQPHYDFLFTYNFTKPNKMDRFSDGNF-----YRSALRACVETDEGHFLCNTSDWSESFQI----------------NFILQDELKVQNSKNTENILKPKHNDKAVXXXXXXXXXXXXAIVGIIIGCVVHKRKLPSKKWENSCRSSTPKIQQD--AQMTPLVDLDTPKLD 3949
            E++     C +EN MGT+ S+ T + V    +   F     E  S+  L    S   + C    S    V W +  E +  PE E+ + ++V    + NI  ++   Y C +   + GQI     + +  +P   T+V ++E T+TS  + W  K P +   ++ +V+ Y+ +   ++ S     I+  +     Y ++ L P+T Y  ++ ++N++G+          T E   +  P ++    +S++ + + W+  E  NG +  Y + +T +S+ P   W  Q    SE + +S LTP+ I+ + +QA  ++G GP+S PV +  + G  S+   FRA+ I   ++ L+W  P    + N     L   Y +  Y+ +     I +N  ++ +  +  DT     L A +Q G G     + V   K  +  +  D+      S +I   W+ P +  +N  +       Q     GK F    ++        F + +   +N T L+P  KY I++  L      +   +     V++T        G   ++  V+LK     P V  E E    +++   +      YR+ +  +       + +       +   L + GV YEF +A   ++       K+   PEG P   PS I + + +   + + W  P  + RNG +   +VQ        L    N T     F  L  N  Y  RVR+ T+   GP+S              P  ++A    +    + W         P      LLG+ I+Y T   +     W Q K        ++ N+EK   Y V +++  + N  G+ SE       PE+V L         NL+ +  +++S+ L    P+  T +N   +++    +F         + V ++EI L  Y K  TI      +L+  T Y + +  I S  S +  + IT++T        + P       +V      +IL   +  E  G I +Y+L+VVP   KS +     +K   +F   + L    K  +   P +A            P     FT++    +    F++        YR  +RA V+T + H L  +S +SE   +                N+  + E+ V  +K+   IL           +   +    +    +I+ CVV +R+ P K  + +   + P +  D  A  TP   +D  +L+
Sbjct:  183 EEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPP-ETISEVML---GSNLNLSCIAVGSPMPHVKWMKGSEDLT-PENEMPIGRNV--LQLINI--QESANYTC-IAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPED---LQYYVIQYKPKNANQAFS-EISGIITMY-----YVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPT-HSSENIVHYEL---YWNDTYANQAHHKRI-SNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRT-KQYVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFK--------FDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAI----VVKTP-------GGVPVRPTVSLKIMEREPIVSIELE----WERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRFDNLER-GVEYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWE--------PVTSRGKLLGYKIFY-TMTAVEDLDDW-QTKTVGLTESADLVNLEKFAQYAVAIAARFK-NGLGRLSEKVTVRIKPEDVPL---------NLRAHDVSTHSMTLSWSPPIRLTPVN-YKISFDAMKVFVDSQGFSQTQIVPKREIILKHYVKTHTI-----NELSPFTTYNVNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFY---GVVNGEEILVILP--QASEEYGPISHYYLVVVP-EDKSNL-----HKIPDQFLTDDLLPGRNKPERPNAPYIA---------AKFPQRSIPFTFHLGSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKH-LYTSSPFSEFLSLDMREAPPGERPHRPDPNWPAEPEVSVNRNKDEPEIL---------WVVLPLMVSTFIVSTALIVLCVVKRRRQPCKTPDQAA-VTRPLMAADLGAGPTPSDPVDMRRLN 1325          

HSP 4 Score: 90.1225 bits (222), Expect = 1.795e-17
Identity = 36/81 (44.44%), Postives = 57/81 (70.37%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   H++P++ +RV L+ + G++GSDY+NAS+ID Y    AYI +Q P+    EDFWR++W+ N +I+V+L K++E
Sbjct: 1668 CNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKE 1748          

HSP 5 Score: 79.337 bits (194), Expect = 3.477e-14
Identity = 33/83 (39.76%), Postives = 54/83 (65.06%), Query Frame = 1
Query: 5218 TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            +KN   ++  +D +RV L ++ GV GSDYINA+Y D Y K  AY+ +Q P+  T  DFWR+ W+   + IV++ ++EE  +++
Sbjct: 1382 SKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIK 1464          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331239)

HSP 1 Score: 289.271 bits (739), Expect = 4.086e-78
Identity = 158/348 (45.40%), Postives = 216/348 (62.07%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKT-ILHI 5239
            IPI + A +I  LKS D     QE+E +  E  ++++  NSNL  NK KNRYAN+TAYDHS V L         +YINANY DGY K N Y+ATQGPL ET  DFW+M WE K+  IVM+ R EE    KC+ YWP +GT  Y  I VT+      A Y+IR FQ+ + GF+ +R++ QLQFT WPD G+P    PFL FL+  +  +  +SGP IVHCSAGVGRTG +IV+DS +ER+KH++ ++IY  +  +R QRN+MVQTE QY FI+D +LE      +E+    L + ++         ++SG E+EF+KL    + +  + S+ +  N   NK K  ++HI
Sbjct: 1457 IPISEFANHIERLKSNDNQKFSQEYESI--EPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGETISGMEVEFKKL----SNVKMDSSKFVTANLPCNKHKNRLVHI 1798          

HSP 2 Score: 182.956 bits (463), Expect = 1.130e-45
Identity = 97/263 (36.88%), Postives = 151/263 (57.41%), Query Frame = 2
Query: 4259 NMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
             M  EF++L+   ++    + +NLP NK KNR  +I  Y+ S V L      +  +Y+NA++IDGY  ++ YIA QGP+ + A DFW+M+WE  STI+VML + +E   +KC  YWP + +  Y    V  ++  +   Y +R+F++      + R V Q QF  WP+QG+P              K  ++F +   GP  VHCSAGVGR+GVFI +   +ER++++  ++++  ++ +R QR  MVQTE QY F Y   LE+
Sbjct: 1763 GMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEY 2023          

HSP 3 Score: 100.138 bits (248), Expect = 2.059e-20
Identity = 226/1054 (21.44%), Postives = 403/1054 (38.24%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKS--IVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCT--SFTIVARWRQPNKDAKNMTL-------QLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLK---GHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQI-----MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSV----PENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSEKEISLD-YNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNS-KFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSHEFSLIE-LKTNAKQNKLILPILALSRKPIQLFGNQPHYDFLFTYNFTKPNKMDRFSDGNF-----YRSALRACVETDEGHFLCNTSDWSESFQI----------------NFILQDELKVQNSKNTENILKPKHNDKAVXXXXXXXXXXXXAIVGIIIGCVVHKRKLPSKKWENSCRSSTPKIQQD--AQMTPLVDLDTPKLD 3949
            T+ +L P   Y + + +  S+G   +   V+    + +P  P ++  A+ I  TAV ++W      +  +  Y L W +       H R   + SE+  +  L P+ ++YI + A +  G+G  + P+ + TK       P    + I   S  I L W  P P +  N   +  ++ +   +   +++   +T N  S  +  +K  TE    + A   VG G P    I+   +  +  +  D+      S +I   W+ P +  +N  +       Q     GK F    ++        F + +   +N T L+P  KY I++  L      +   +     V++T        G   ++  V+LK     P V  E E    +++   +      YR+ +  +       + +       +   L + GV YEF +A   ++       K+   PEG P   PS I + + +   + + W  P  + RNG +   +VQ        L    N T     F  L  N  Y  RVR+ T+   GP+S              P  ++A    +    + W         P      LLG+ I+Y T   +     W Q K        ++ N+EK   Y V +++  + N  G+ SE       PE+V L         NL+ +  +++S+ L    P+  T +N   +++    +F         + V ++EI L  Y K  TI      +L+  T Y + +  I S  S +  + IT++T        + P       +V      +IL   +  E  G I +Y+L+VVP   KS +     +K   +F   + L    K  +   P +A            P     FT++    +    F++        YR  +RA V+T + H L  +S +SE   +                N+  + E+ V  +K+   IL           +   +    +    +I+ CVV +R+ P K  + +   + P +  D  A  TP   +D  +L+
Sbjct:  482 TVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQP-SNFRATDIGETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHHKRI--SNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQ---YGAPPRNITAIATSSTTISLSWLPP-PVERSNGRIIYYKVFFVE-VGREDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTSVGDG-PRSHPIILRTQEDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFK--------FDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAI----VVKTP-------GGVPVRPTVSLKIMEREPIVSIELE----WERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRFDNLER-GVEYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWE--------PVTSRGKLLGYKIFY-TMTAVEDLDDW-QTKTVGLTESADLVNLEKFAQYAVAIAARFK-NGLGRLSEKVTVRIKPEDVPL---------NLRAHDVSTHSMTLSWSPPIRLTPVN-YKISFDAMKVFVDSQGFSQTQIVPKREIILKHYVKTHTI-----NELSPFTTYNVNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFY---GVVNGEEILVILP--QASEEYGPISHYYLVVVP-EDKSNL-----HKIPDQFLTDDLLPGRNKPERPNAPYIA---------AKFPQRSIPFTFHLGSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKH-LYTSSPFSEFLSLDMREAPPGERPHRPDPNWPAEPEVSVNRNKDEPEIL---------WVVLPLMVSTFIVSTALIVLCVVKRRRQPCKTPDQAA-VTRPLMAADLGAGPTPSDPVDMRRLN 1445          

HSP 4 Score: 90.1225 bits (222), Expect = 2.016e-17
Identity = 36/81 (44.44%), Postives = 57/81 (70.37%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   H++P++ +RV L+ + G++GSDY+NAS+ID Y    AYI +Q P+    EDFWR++W+ N +I+V+L K++E
Sbjct: 1788 CNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKE 1868          

HSP 5 Score: 87.0409 bits (214), Expect = 1.990e-16
Identity = 111/467 (23.77%), Postives = 205/467 (43.90%), Query Frame = 2
Query:  359 EDNNNLLTCESENVMGTD-SQTTKIRVFKHEMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICW--KLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQG-----PPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHW-RQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKN 1732
            E++     C +EN MGT+ S+ T + V    +   F     E  S+  L    S   + C    S    V W +  E +  PE E+ + ++V    + NI  ++   Y C +   + GQI     + +  +P   T+V ++E T+TS  + W  K P +   ++ +V+ Y+ +   ++ S     I+  +     Y ++ L P+T Y  ++ ++N++G+          T +    G      P ++    +S++ + + W+  E  NG +  Y + +T +S+ P   W  Q    SE + +S LTP+ I+ + +QA  ++G GP+S PV +  + G  S+   FRA+ I   ++ L+W  P    + N     L   Y +  Y+ +     I +N  ++ +  +  DT     L A +Q G G     + V   +       +  I  +S TI   W  P  +  N
Sbjct:  201 EEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPP-ETISEVML---GSNLNLSCIAVGSPMPHVKWMKGSEDLT-PENEMPIGRNV--LQLINI--QESANYTC-IAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPED---LQYYVIQYKPKNANQAFS-EISGIITMY-----YVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGDFSFGGTKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPT-HSSENIVHYEL---YWNDTYANQAHHKRI-SNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYGAPPRNITAIATSSTTISLSWLPPPVERSN 643          

HSP 6 Score: 79.337 bits (194), Expect = 3.767e-14
Identity = 33/83 (39.76%), Postives = 54/83 (65.06%), Query Frame = 1
Query: 5218 TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            +KN   ++  +D +RV L ++ GV GSDYINA+Y D Y K  AY+ +Q P+  T  DFWR+ W+   + IV++ ++EE  +++
Sbjct: 1502 SKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIK 1584          

HSP 7 Score: 55.0694 bits (131), Expect = 9.760e-7
Identity = 44/171 (25.73%), Postives = 76/171 (44.44%), Query Frame = 2
Query:  929 QCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRW--KSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSL------ISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDP 1417
            + YTL  L+P T Y IW+ + +  G+      +   T +     PP +ITA A S+T + + W    VE+ NG +  Y + + E         R+ D  +  +L      +  L     + I + A  +VG GP S P+ + T+     +  + +A+ +   SI + W  P
Sbjct:  574 EAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQY--GAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVG-------REDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQEDVPGDPQDVKATPLNSTSIHVSWKPP 735          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331241)

HSP 1 Score: 288.886 bits (738), Expect = 4.175e-78
Identity = 158/348 (45.40%), Postives = 216/348 (62.07%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKT-ILHI 5239
            IPI + A +I  LKS D     QE+E +  E  ++++  NSNL  NK KNRYAN+TAYDHS V L         +YINANY DGY K N Y+ATQGPL ET  DFW+M WE K+  IVM+ R EE    KC+ YWP +GT  Y  I VT+      A Y+IR FQ+ + GF+ +R++ QLQFT WPD G+P    PFL FL+  +  +  +SGP IVHCSAGVGRTG +IV+DS +ER+KH++ ++IY  +  +R QRN+MVQTE QY FI+D +LE      +E+    L + ++         ++SG E+EF+KL    + +  + S+ +  N   NK K  ++HI
Sbjct: 1352 IPISEFANHIERLKSNDNQKFSQEYESI--EPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGETISGMEVEFKKL----SNVKMDSSKFVTANLPCNKHKNRLVHI 1693          

HSP 2 Score: 182.956 bits (463), Expect = 1.153e-45
Identity = 97/263 (36.88%), Postives = 151/263 (57.41%), Query Frame = 2
Query: 4259 NMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
             M  EF++L+   ++    + +NLP NK KNR  +I  Y+ S V L      +  +Y+NA++IDGY  ++ YIA QGP+ + A DFW+M+WE  STI+VML + +E   +KC  YWP + +  Y    V  ++  +   Y +R+F++      + R V Q QF  WP+QG+P              K  ++F +   GP  VHCSAGVGR+GVFI +   +ER++++  ++++  ++ +R QR  MVQTE QY F Y   LE+
Sbjct: 1658 GMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEY 1918          

HSP 3 Score: 133.265 bits (334), Expect = 1.619e-30
Identity = 277/1249 (22.18%), Postives = 498/1249 (39.87%), Query Frame = 2
Query:  359 EDNNNLLTCESENVMGTD-SQTTKIRVFKHEMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICW--KLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHW-RQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCT--SFTIVARWRQPNKDAKNMTL-------QLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLK---GHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQI-----MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSV----PENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSEKEISLD-YNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNS-KFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSHEFSLIE-LKTNAKQNKLILPILALSRKPIQLFGNQPHYDFLFTYNFTKPNKMDRFSDGNF-----YRSALRACVETDEGHFLCNTSDWSESFQI----------------NFILQDELKVQNSKNTENILKPKHNDKAVXXXXXXXXXXXXAIVGIIIGCVVHKRKLPSKKWENSCRSSTPKIQQD--AQMTPLVDLDTPKLD 3949
            E++     C +EN MGT+ S+ T + V    +   F     E  S+  L    S   + C    S    V W +  E +  PE E+ + ++V    + NI  ++   Y C +   + GQI     + +  +P   T+V ++E T+TS  + W  K P +   ++ +V+ Y+ +   ++ S     I+  +     Y ++ L P+T Y  ++ ++N++G+          T     +  P ++    +S++ + + W+  E  NG +  Y + +T +S+ P   W  Q    SE + +S LTP+ I+ + +QA  ++G GP+S PV +  + G  S+   FRA+ I   ++ L+W  P    + N     L   Y +  Y+ +     I +N  ++ +  +  DT     L A +Q G G     + V   K  +  +  D+      S +I   W+ P +  +N  +       Q     GK F    ++        F + +   +N T L+P  KY I++  L      +   +     V++T        G   ++  V+LK     P V  E E    +++   +      YR+ +  +       + +       +   L + GV YEF +A   ++       K+   PEG P   PS I + + +   + + W  P  + RNG +   +VQ        L    N T     F  L  N  Y  RVR+ T+   GP+S              P  ++A    +    + W         P      LLG+ I+Y T   +     W Q K        ++ N+EK   Y V +++  + N  G+ SE       PE+V L         NL+ +  +++S+ L    P+  T +N   +++    +F         + V ++EI L  Y K  TI      +L+  T Y + +  I S  S +  + IT++T        + P       +V      +IL   +  E  G I +Y+L+VVP   KS +     +K   +F   + L    K  +   P +A            P     FT++    +    F++        YR  +RA V+T + H L  +S +SE   +                N+  + E+ V  +K+   IL           +   +    +    +I+ CVV +R+ P K  + +   + P +  D  A  TP   +D  +L+
Sbjct:  201 EEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPP-ETISEVML---GSNLNLSCIAVGSPMPHVKWMKGSEDLT-PENEMPIGRNV--LQLINI--QESANYTC-IAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPED---LQYYVIQYKPKNANQAFS-EISGIITMY-----YVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTEM---ESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPT-HSSENIVHYEL---YWNDTYANQAHHKRI-SNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRT-KQYVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFK--------FDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAI----VVKTP-------GGVPVRPTVSLKIMEREPIVSIELE----WERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRFDNLER-GVEYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWE--------PVTSRGKLLGYKIFY-TMTAVEDLDDW-QTKTVGLTESADLVNLEKFAQYAVAIAARFK-NGLGRLSEKVTVRIKPEDVPL---------NLRAHDVSTHSMTLSWSPPIRLTPVN-YKISFDAMKVFVDSQGFSQTQIVPKREIILKHYVKTHTI-----NELSPFTTYNVNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFY---GVVNGEEILVILP--QASEEYGPISHYYLVVVP-EDKSNL-----HKIPDQFLTDDLLPGRNKPERPNAPYIA---------AKFPQRSIPFTFHLGSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKH-LYTSSPFSEFLSLDMREAPPGERPHRPDPNWPAEPEVSVNRNKDEPEIL---------WVVLPLMVSTFIVSTALIVLCVVKRRRQPCKTPDQAA-VTRPLMAADLGAGPTPSDPVDMRRLN 1340          

HSP 4 Score: 90.1225 bits (222), Expect = 1.799e-17
Identity = 36/81 (44.44%), Postives = 57/81 (70.37%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   H++P++ +RV L+ + G++GSDY+NAS+ID Y    AYI +Q P+    EDFWR++W+ N +I+V+L K++E
Sbjct: 1683 CNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKE 1763          

HSP 5 Score: 79.337 bits (194), Expect = 3.483e-14
Identity = 33/83 (39.76%), Postives = 54/83 (65.06%), Query Frame = 1
Query: 5218 TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            +KN   ++  +D +RV L ++ GV GSDYINA+Y D Y K  AY+ +Q P+  T  DFWR+ W+   + IV++ ++EE  +++
Sbjct: 1397 SKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIK 1479          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331240)

HSP 1 Score: 288.886 bits (738), Expect = 4.176e-78
Identity = 158/348 (45.40%), Postives = 216/348 (62.07%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKT-ILHI 5239
            IPI + A +I  LKS D     QE+E +  E  ++++  NSNL  NK KNRYAN+TAYDHS V L         +YINANY DGY K N Y+ATQGPL ET  DFW+M WE K+  IVM+ R EE    KC+ YWP +GT  Y  I VT+      A Y+IR FQ+ + GF+ +R++ QLQFT WPD G+P    PFL FL+  +  +  +SGP IVHCSAGVGRTG +IV+DS +ER+KH++ ++IY  +  +R QRN+MVQTE QY FI+D +LE      +E+    L + ++         ++SG E+EF+KL    + +  + S+ +  N   NK K  ++HI
Sbjct: 1360 IPISEFANHIERLKSNDNQKFSQEYESI--EPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGETISGMEVEFKKL----SNVKMDSSKFVTANLPCNKHKNRLVHI 1701          

HSP 2 Score: 182.956 bits (463), Expect = 1.147e-45
Identity = 97/263 (36.88%), Postives = 151/263 (57.41%), Query Frame = 2
Query: 4259 NMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
             M  EF++L+   ++    + +NLP NK KNR  +I  Y+ S V L      +  +Y+NA++IDGY  ++ YIA QGP+ + A DFW+M+WE  STI+VML + +E   +KC  YWP + +  Y    V  ++  +   Y +R+F++      + R V Q QF  WP+QG+P              K  ++F +   GP  VHCSAGVGR+GVFI +   +ER++++  ++++  ++ +R QR  MVQTE QY F Y   LE+
Sbjct: 1666 GMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEY 1926          

HSP 3 Score: 131.339 bits (329), Expect = 6.918e-30
Identity = 278/1254 (22.17%), Postives = 499/1254 (39.79%), Query Frame = 2
Query:  359 EDNNNLLTCESENVMGTD-SQTTKIRVFKHEMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICW--KLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQG-----PPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHW-RQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCT--SFTIVARWRQPNKDAKNMTL-------QLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLK---GHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQI-----MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSV----PENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSEKEISLD-YNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNS-KFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSHEFSLIE-LKTNAKQNKLILPILALSRKPIQLFGNQPHYDFLFTYNFTKPNKMDRFSDGNF-----YRSALRACVETDEGHFLCNTSDWSESFQI----------------NFILQDELKVQNSKNTENILKPKHNDKAVXXXXXXXXXXXXAIVGIIIGCVVHKRKLPSKKWENSCRSSTPKIQQD--AQMTPLVDLDTPKLD 3949
            E++     C +EN MGT+ S+ T + V    +   F     E  S+  L    S   + C    S    V W +  E +  PE E+ + ++V    + NI  ++   Y C +   + GQI     + +  +P   T+V ++E T+TS  + W  K P +   ++ +V+ Y+ +   ++ S     I+  +     Y ++ L P+T Y  ++ ++N++G+          T +    G      P ++    +S++ + + W+  E  NG +  Y + +T +S+ P   W  Q    SE + +S LTP+ I+ + +QA  ++G GP+S PV +  + G  S+   FRA+ I   ++ L+W  P    + N     L   Y +  Y+ +     I +N  ++ +  +  DT     L A +Q G G     + V   K  +  +  D+      S +I   W+ P +  +N  +       Q     GK F    ++        F + +   +N T L+P  KY I++  L      +   +     V++T        G   ++  V+LK     P V  E E    +++   +      YR+ +  +       + +       +   L + GV YEF +A   ++       K+   PEG P   PS I + + +   + + W  P  + RNG +   +VQ        L    N T     F  L  N  Y  RVR+ T+   GP+S              P  ++A    +    + W         P      LLG+ I+Y T   +     W Q K        ++ N+EK   Y V +++  + N  G+ SE       PE+V L         NL+ +  +++S+ L    P+  T +N   +++    +F         + V ++EI L  Y K  TI      +L+  T Y + +  I S  S +  + IT++T        + P       +V      +IL   +  E  G I +Y+L+VVP   KS +     +K   +F   + L    K  +   P +A            P     FT++    +    F++        YR  +RA V+T + H L  +S +SE   +                N+  + E+ V  +K+   IL           +   +    +    +I+ CVV +R+ P K  + +   + P +  D  A  TP   +D  +L+
Sbjct:  201 EEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPP-ETISEVML---GSNLNLSCIAVGSPMPHVKWMKGSEDLT-PENEMPIGRNV--LQLINI--QESANYTC-IAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPED---LQYYVIQYKPKNANQAFS-EISGIITMY-----YVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGDFSFGGTKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPT-HSSENIVHYEL---YWNDTYANQAHHKRI-SNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRT-KQYVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFK--------FDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAI----VVKTP-------GGVPVRPTVSLKIMEREPIVSIELE----WERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRFDNLER-GVEYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWE--------PVTSRGKLLGYKIFY-TMTAVEDLDDW-QTKTVGLTESADLVNLEKFAQYAVAIAARFK-NGLGRLSEKVTVRIKPEDVPL---------NLRAHDVSTHSMTLSWSPPIRLTPVN-YKISFDAMKVFVDSQGFSQTQIVPKREIILKHYVKTHTI-----NELSPFTTYNVNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFY---GVVNGEEILVILP--QASEEYGPISHYYLVVVP-EDKSNL-----HKIPDQFLTDDLLPGRNKPERPNAPYIA---------AKFPQRSIPFTFHLGSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKH-LYTSSPFSEFLSLDMREAPPGERPHRPDPNWPAEPEVSVNRNKDEPEIL---------WVVLPLMVSTFIVSTALIVLCVVKRRRQPCKTPDQAA-VTRPLMAADLGAGPTPSDPVDMRRLN 1348          

HSP 4 Score: 90.1225 bits (222), Expect = 1.800e-17
Identity = 36/81 (44.44%), Postives = 57/81 (70.37%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   H++P++ +RV L+ + G++GSDY+NAS+ID Y    AYI +Q P+    EDFWR++W+ N +I+V+L K++E
Sbjct: 1691 CNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKE 1771          

HSP 5 Score: 79.337 bits (194), Expect = 3.486e-14
Identity = 33/83 (39.76%), Postives = 54/83 (65.06%), Query Frame = 1
Query: 5218 TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            +KN   ++  +D +RV L ++ GV GSDYINA+Y D Y K  AY+ +Q P+  T  DFWR+ W+   + IV++ ++EE  +++
Sbjct: 1405 SKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIK 1487          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 310.842 bits (795), Expect = 4.141e-105
Identity = 171/371 (46.09%), Postives = 233/371 (62.80%), Query Frame = 2
Query: 4067 ILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRY---------TIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            +L N  ++ +H     D V +  R NF   DS  +SS V ++ +          IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YIN+NYIDGY KQN YIATQGPL ET  DFW+MVWEQ++  +VM+ R EE    KC+ YWP +GT  Y  I+VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     +SG E+EF++L
Sbjct: 1294 LLNNADITPHHPT---DPVEMR-RINFQTPDS-GLSSPVSEAGFDYESMMNHPPIPISELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTRLEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEAGEHVSGMELEFKRL 1657          

HSP 2 Score: 93.9745 bits (232), Expect = 4.141e-105
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYIN+S+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1674 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1754          

HSP 3 Score: 203.756 bits (517), Expect = 6.532e-52
Identity = 117/315 (37.14%), Postives = 179/315 (56.83%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSRYTIP-IDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R     I KLA+    +++ ++++ M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YIN+++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1601 MVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQ----VEAGEHVSGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1909          

HSP 4 Score: 98.9821 bits (245), Expect = 5.502e-20
Identity = 74/280 (26.43%), Postives = 127/280 (45.36%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAK-SESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQF----SFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFT---IVARWRQPNKDAKNMTLQLF 1750
            Y++  L P T Y I +++ N++G+    + V+  T E  P  PP +I A  IS   V VRW   ++ NG +K Y + +T    LP   W+ ++ + S  + I  L  +  + I + A  +VG GP S P+ +    G   +   F+  ++    + L W           F     ISY+  L+  E K   +   +F    SF +  ++ +TE  F+L A +  G G     L  +  +AK +    D I C+S +   ++  WR P  +++N  L  +
Sbjct:  372 YSIGGLSPNTDYEIRVSAFNTIGQGPPSEPVEARTGEQAPASPPRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYYTMDPTLPMSMWQIHNVQDSVLTTIQSLVTSETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPTNFQVGEVSDTGVELTWEP--------AFEKEGIISYE--LHYKEGKDGPLGKKKFAPTSSFVVDGLRPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPPQD-IKCSSSSSTVLMVSWRPPPAESQNGELAGY 640          

HSP 5 Score: 88.1965 bits (217), Expect = 1.181e-16
Identity = 35/82 (42.68%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYIN++YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ ++EE  +++
Sbjct: 1389 KNRYANVIAYDHSRVILAPIEGITGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTRLEEKSRIK 1470          

HSP 6 Score: 75.485 bits (184), Expect = 6.662e-13
Identity = 58/231 (25.11%), Postives = 105/231 (45.45%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSV--EKINGILKKYILLWT-----EHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPD-PTKTLNCFGLNLEISYK--SPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            L++L  +T YR+ + +  S+G     + +   T ED+P  PP  +    +++TA++V W+S+   K +G ++ Y + +      E   LP        A ++  +I  L P+  + IT+ A    G G  SKP  +LTK G +   P    ++    + ++ W  PD     L   G  L+   K  +PL ++E         +  + I N+      +F + A ++ GFG
Sbjct:  668 LQRLEKWTMYRVTVAASTSVGSGPESEPLLCRTDEDVPGAPPRRVEVEVLNSTAIKVMWRSLLPGKQHGQIRGYQVHYVRVENGESRGLPLIKDVML-ADAQEMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVLTK-GAVPGPPFLSVNQNSESTAIIRWQPPDYVAPGLEVQGYRLQFGRKDVNPLATLE-----FGPQELEYSISNIHRGATYIFKVSAKSKSGFG 891          

HSP 7 Score: 60.077 bits (144), Expect = 4.087e-8
Identity = 78/339 (23.01%), Postives = 127/339 (37.46%), Query Frame = 2
Query:  803 ICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKS--VEKINGILKKYILLW----------TEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLE--WNDPDPTKTLNCFGLNLEISYKSPLYSMEN---------KIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLF 1750
            + W+  F    I  + LHY+     E    P  K    F     + +  L P T Y   + +++S G       +   TS+  P  PP  I  S+ S+T + V W+    E  NG L  YI+ +          TEH + P          S+  L+  L    ++ +T+ A  +VG GP S+P+   T    +   P  R    +L S  ++  W    P K            Y+     +EN         K V +   Q    I  ++ DT    T+ A+   G G   K  +V    A      + +   +  T + RW+ P+  A  + +Q +
Sbjct:  528 LTWEPAFEKEGIISYELHYK-----EGKDGPLGK--KKFAPTSSFVVDGLRPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPPQDIKCSSSSSTVLMVSWRPPPAESQNGELAGYIVRYAVVGAGAEVSTEHVEAP---------TSDQILLQRLEKWTMYRVTVAASTSVGSGPESEPLLCRTDE-DVPGAPPRRVEVEVLNSTAIKVMWRSLLPGKQHGQI-----RGYQVHYVRVENGESRGLPLIKDVMLADAQ-EMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVLTKGAVPGPPFLSVNQNSESTAIIRWQPPDYVAPGLEVQGY 843          

HSP 8 Score: 55.8398 bits (133), Expect = 7.898e-7
Identity = 109/466 (23.39%), Postives = 179/466 (38.41%), Query Frame = 2
Query: 1391 SIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGK---AKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYN--------FTRLKPSQKYQIR-LTFLVVGEFNEIRESFYLSNVIETK--KAHPQSVGNFNL----KTGVNLKGHPNVMAEWEEIPIFDK--VFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLI-AMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKL--------IYNEVQIMPLNQILNSTDNTISFYKLPN-KVYQLRVRSCTRVACGPWSKYFEFSV-YDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYY 2695
            SI + W+  +P    +     ++   KSP    E  + +ITT ++S  I  +  +T+    + AFN +G G P + +    G+   A   +N+   I  +  T++ RW +P+           E NG+     VY T+        +  W+I+N           L  S+ Y IR L F  VG+          S+ I  K  +  P    NF +     TGV L         WE  P F+K  + S   Y L Y+      L  K    +   SS V+  L   +    Y F LA   +         L     + KPS  P  IK    S   + + W+ P  + +NG+L        +      +    +   T + I   +L    +Y++ V + T V  GP S+        DV   PP+ +    +  T I+V W     ++ +P      + G+ ++Y
Sbjct:  332 SITITWDSGNPEPVSHYI---IQYRAKSPESKFET-VDSITTTRYS--IGGLSPNTDYEIRVSAFNTIGQGPPSEPVEARTGEQAPASPPRNIQARI-ISQNTVLVRWDEPD-----------EPNGQIKGYRVYYTM---DPTLPMSMWQIHNVQDSVLTTIQSLVTSETYTIRVLAFTSVGDGP-------FSDPIHVKVLQGVPGQPTNFQVGEVSDTGVELT--------WE--PAFEKEGIIS---YELHYKEGKDGPLGKKK---FAPTSSFVVDGL---RPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPPQDIKCSSSSSTVLMVSWRPPPAESQNGELAGYIVRYAVVGAGAEVSTEHVEAPTSDQILLQRLEKWTMYRVTVAASTSVGSGPESEPLLCRTDEDVPGAPPRRVEVEVLNSTAIKVMW-----RSLLPGKQHGQIRGYQVHY 745          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 308.145 bits (788), Expect = 2.969e-104
Identity = 158/317 (49.84%), Postives = 211/317 (66.56%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YIN+NYIDGY KQN YIATQGPL ET  DFW+MVWEQ++  +VM+ R EE    KC+ YWP +GT  Y  I+VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     +SG E+EF++L
Sbjct: 1222 IPISELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTRLEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEAGEHVSGMELEFKRL 1536          

HSP 2 Score: 93.9745 bits (232), Expect = 2.969e-104
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYIN+S+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1553 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1633          

HSP 3 Score: 203.371 bits (516), Expect = 9.339e-52
Identity = 117/315 (37.14%), Postives = 179/315 (56.83%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSRYTIP-IDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R     I KLA+    +++ ++++ M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YIN+++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1480 MVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQ----VEAGEHVSGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1788          

HSP 4 Score: 98.9821 bits (245), Expect = 5.394e-20
Identity = 74/280 (26.43%), Postives = 127/280 (45.36%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAK-SESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQF----SFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFT---IVARWRQPNKDAKNMTLQLF 1750
            Y++  L P T Y I +++ N++G+    + V+  T E  P  PP +I A  IS   V VRW   ++ NG +K Y + +T    LP   W+ ++ + S  + I  L  +  + I + A  +VG GP S P+ +    G   +   F+  ++    + L W           F     ISY+  L+  E K   +   +F    SF +  ++ +TE  F+L A +  G G     L  +  +AK +    D I C+S +   ++  WR P  +++N  L  +
Sbjct:  267 YSIGGLSPNTDYEIRVSAFNTIGQGPPSEPVEARTGEQAPASPPRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYYTMDPTLPMSMWQIHNVQDSVLTTIQSLVTSETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPTNFQVGEVSDTGVELTWEP--------AFEKEGIISYE--LHYKEGKDGPLGKKKFAPTSSFVVDGLRPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPPQD-IKCSSSSSTVLMVSWRPPPAESQNGELAGY 535          

HSP 5 Score: 87.8113 bits (216), Expect = 1.202e-16
Identity = 35/82 (42.68%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYIN++YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ ++EE  +++
Sbjct: 1268 KNRYANVIAYDHSRVILAPIEGITGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTRLEEKSRIK 1349          

HSP 6 Score: 75.8702 bits (185), Expect = 6.462e-13
Identity = 58/231 (25.11%), Postives = 105/231 (45.45%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSV--EKINGILKKYILLWT-----EHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPD-PTKTLNCFGLNLEISYK--SPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            L++L  +T YR+ + +  S+G     + +   T ED+P  PP  +    +++TA++V W+S+   K +G ++ Y + +      E   LP        A ++  +I  L P+  + IT+ A    G G  SKP  +LTK G +   P    ++    + ++ W  PD     L   G  L+   K  +PL ++E         +  + I N+      +F + A ++ GFG
Sbjct:  563 LQRLEKWTMYRVTVAASTSVGSGPESEPLLCRTDEDVPGAPPRRVEVEVLNSTAIKVMWRSLLPGKQHGQIRGYQVHYVRVENGESRGLPLIKDVML-ADAQEMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVLTK-GAVPGPPFLSVNQNSESTAIIRWQPPDYVAPGLEVQGYRLQFGRKDVNPLATLE-----FGPQELEYSISNIHRGATYIFKVSAKSKSGFG 786          

HSP 7 Score: 60.077 bits (144), Expect = 3.979e-8
Identity = 78/339 (23.01%), Postives = 127/339 (37.46%), Query Frame = 2
Query:  803 ICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKS--VEKINGILKKYILLW----------TEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLE--WNDPDPTKTLNCFGLNLEISYKSPLYSMEN---------KIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLF 1750
            + W+  F    I  + LHY+     E    P  K    F     + +  L P T Y   + +++S G       +   TS+  P  PP  I  S+ S+T + V W+    E  NG L  YI+ +          TEH + P          S+  L+  L    ++ +T+ A  +VG GP S+P+   T    +   P  R    +L S  ++  W    P K            Y+     +EN         K V +   Q    I  ++ DT    T+ A+   G G   K  +V    A      + +   +  T + RW+ P+  A  + +Q +
Sbjct:  423 LTWEPAFEKEGIISYELHYK-----EGKDGPLGK--KKFAPTSSFVVDGLRPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPPQDIKCSSSSSTVLMVSWRPPPAESQNGELAGYIVRYAVVGAGAEVSTEHVEAP---------TSDQILLQRLEKWTMYRVTVAASTSVGSGPESEPLLCRTDE-DVPGAPPRRVEVEVLNSTAIKVMWRSLLPGKQHGQIR-----GYQVHYVRVENGESRGLPLIKDVMLADAQ-EMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVLTKGAVPGPPFLSVNQNSESTAIIRWQPPDYVAPGLEVQGY 738          

HSP 8 Score: 55.4546 bits (132), Expect = 8.445e-7
Identity = 109/466 (23.39%), Postives = 179/466 (38.41%), Query Frame = 2
Query: 1391 SIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGK---AKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYN--------FTRLKPSQKYQIR-LTFLVVGEFNEIRESFYLSNVIETK--KAHPQSVGNFNL----KTGVNLKGHPNVMAEWEEIPIFDK--VFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLI-AMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKL--------IYNEVQIMPLNQILNSTDNTISFYKLPN-KVYQLRVRSCTRVACGPWSKYFEFSV-YDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYY 2695
            SI + W+  +P    +     ++   KSP    E  + +ITT ++S  I  +  +T+    + AFN +G G P + +    G+   A   +N+   I  +  T++ RW +P+           E NG+     VY T+        +  W+I+N           L  S+ Y IR L F  VG+          S+ I  K  +  P    NF +     TGV L         WE  P F+K  + S   Y L Y+      L  K    +   SS V+  L   +    Y F LA   +         L     + KPS  P  IK    S   + + W+ P  + +NG+L        +      +    +   T + I   +L    +Y++ V + T V  GP S+        DV   PP+ +    +  T I+V W     ++ +P      + G+ ++Y
Sbjct:  227 SITITWDSGNPEPVSHYI---IQYRAKSPESKFET-VDSITTTRYS--IGGLSPNTDYEIRVSAFNTIGQGPPSEPVEARTGEQAPASPPRNIQARI-ISQNTVLVRWDEPD-----------EPNGQIKGYRVYYTM---DPTLPMSMWQIHNVQDSVLTTIQSLVTSETYTIRVLAFTSVGDGP-------FSDPIHVKVLQGVPGQPTNFQVGEVSDTGVELT--------WE--PAFEKEGIIS---YELHYKEGKDGPLGKKK---FAPTSSFVVDGL---RPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPPQDIKCSSSSSTVLMVSWRPPPAESQNGELAGYIVRYAVVGAGAEVSTEHVEAPTSDQILLQRLEKWTMYRVTVAASTSVGSGPESEPLLCRTDEDVPGAPPRRVEVEVLNSTAIKVMW-----RSLLPGKQHGQIRGYQVHY 640          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 298.13 bits (762), Expect = 3.169e-102
Identity = 157/366 (42.90%), Postives = 231/366 (63.11%), Query Frame = 2
Query: 4073 KNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQV-----SSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            K T+ SA  +++      V D     ++D V++      +  ++    + +  LA++I  L++ D L   QE+E ++    ++++  NSNL  NK KNRYAN+ AYDHS V L  P+D     +YIN NYIDGY KQN YIATQGPL ET  DFW+MVWEQ+++ IVM+ R EE    KC+ YWP +GT  Y  I+V+++  +  A Y++R F + +NG S KR+V Q QF  WPD G+P    P L+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ER+KH+++V+IY  +  +R QRN+MVQTE QY FI++ LLE      +E+    L + I+  +Q    ++++  E+EF+KL
Sbjct: 1274 KRTSPSAKDEHS----AGVKDHLLAHSSDPVEMRRLNYQTQGMREHPPVSVCALADHIERLRANDSLRFSQEYESVDPG--QQFTWENSNLEVNKPKNRYANVIAYDHSRVVL-TPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQAPPGDTVTAMELEFKKL 1632          

HSP 2 Score: 97.0561 bits (240), Expect = 3.169e-102
Identity = 47/103 (45.63%), Postives = 69/103 (66.99%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      +S S  CN    KN   +++PF+ +RV L  + GV+GSDYINAS+ID Y + KAYI +Q P++ T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1635 SKAHTSRF------ISASLPCNK--FKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLRE 1729          

HSP 3 Score: 198.364 bits (503), Expect = 2.858e-50
Identity = 114/314 (36.31%), Postives = 170/314 (54.14%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSY---DYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F +   ++ ++        +P   L  +I  L      D +  M+ EF++L          I+++LP NK KNR  NI  ++ S V LQ     +  +YINA++IDGY +Q  YIATQGPL+ET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  IK +R QR  MVQTE QY   Y   LE+
Sbjct: 1576 MVQTEDQYIFIHEALLEAATC---GNTEVPARSLYTHIQKLTQAPPGDTVTAMELEFKKLANSKAHTSRFISASLPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEY 1884          

HSP 4 Score: 90.8929 bits (224), Expect = 1.587e-17
Identity = 39/82 (47.56%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + GV GSDYIN +YID Y K  AYI +Q P+  T+ DFWR+VW+Q  S IV++ ++EE  +V+
Sbjct: 1364 KNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVK 1445          

HSP 5 Score: 87.8113 bits (216), Expect = 1.466e-16
Identity = 60/225 (26.67%), Postives = 110/225 (48.89%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSES-SLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGM 1606
            Y++  L P++ Y   + ++N++G+      V+  TSE  P  PP  + A  +S T + V+W+  E+ NG ++ Y + +T     P   W++++ +  S + IS L P+  + + + A  +VG GP S  + + T+ G  ++   F A   L   I+L W  P   +         E++Y       +NK   I     S+ I ++K DT   F+L A +++G G+
Sbjct:  374 YSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQI-----TKYELTYWE--ADSDNKHHVIFDPAGSYAIDSLKPDTLYKFSLAARSEMGLGV 591          

HSP 6 Score: 71.633 bits (174), Expect = 1.162e-11
Identity = 73/328 (22.26%), Postives = 139/328 (42.38%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSV--EKINGILKKYILLWTE-HSDLPHQHWRQYDA---KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYK---SPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKIN-KNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFT-LIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            Y L+ L  +T Y +W+ +   +G      S +  T ED+P  PP  +    I++TA+ V WK    +K +G ++ Y ++++   +  P       D    +++ ++IS L P   + +T+ A    G G  SK   ++T +G +   P    S  +  + +++W    P K +    +   + YK     +Y++ +     T + F+  +  + +    +F L A N+ G G      I +      +    + ++G T+ T    W  P          L E+NGK    ++VYR +   +++             LKP   Y IR+
Sbjct:  668 YVLEGLEKWTEYTVWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSK-AKVVTTTGAVPGKPTMIISTTIGNTALIQWQ---PPKEMVGELMGYRLRYKREEEDIYTVRD--FRRTDDHFT--VTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLKVVGLTTTTTKLAWDPP---------PLPERNGKIVRYVVVYRDINSHQNQTNGTADTEMTIQGLKPDTTYDIRV 978          

HSP 7 Score: 66.6254 bits (161), Expect = 3.425e-10
Identity = 130/595 (21.85%), Postives = 241/595 (40.50%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECP-EFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENK----IVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGK----AKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYT----NKSSHVIQLLELPKYGVTYEFVLA---RYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTDNT----ISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAF---RVMDTKIRVEWSI 2629
            T+  L P  TY + + +  S+G       ++  T + +P   PT   A A  +T + + W  +  +   + KY L + E +D  ++H   +D    S  I  L P+ ++  ++ A + +G G  ++P+   T     S  P E     +   SI + W  P P  + +   +   ++Y++   S E++    + +I  +  S+ +  +++ TE    ++A   VG G       +   +    A   +  VD I  T+  +   W+ P +  ++  ++ ++      +NG+       R  PII  +  + E +    + L P   Y + +  +   G+    +     + V+ T  A P   G   +     +      + +W+  P  + V     Y L+Y+         +   IYT     ++     +  L K G TY F L    R GN  E     K I+ PE  PS  P  +KV+ ++     L W  P +  RNGK++   V    +N   N T+ T    ++   L P+  Y +RVR+ T    GP S   +       +  P+  + F    VM T + + W +
Sbjct:  474 TISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVP-AQPTGFEAEAELDTRIMLSW--LWPVQDQITKYELTYWE-ADSDNKHHVIFDPAG-SYAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAP-PAASRHGSIVRYSLAYQA--VSGEDQERHEVKDIPADVSSYVLEGLEKWTEYTVWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRV--SWKPPLQQKQHGHIRGYQVVYSRLENGEP------RGQPIIL-DVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSK-----AKVVTTTGAVP---GKPTMIISTTIGN--TALIQWQ--PPKEMVGELMGYRLRYK--------REEEDIYTVRDFRRTDDHFTVTGLHK-GATYIFKLCAKNRAGNGEE---YSKEISTPEDVPSSYPQNLKVVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDINSHQNQTNGTADTEMTIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMSTSM--PEFTKNFGVKAVMKTSVLLTWEV 1025          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 298.13 bits (762), Expect = 3.169e-102
Identity = 157/366 (42.90%), Postives = 231/366 (63.11%), Query Frame = 2
Query: 4073 KNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQV-----SSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            K T+ SA  +++      V D     ++D V++      +  ++    + +  LA++I  L++ D L   QE+E ++    ++++  NSNL  NK KNRYAN+ AYDHS V L  P+D     +YIN NYIDGY KQN YIATQGPL ET  DFW+MVWEQ+++ IVM+ R EE    KC+ YWP +GT  Y  I+V+++  +  A Y++R F + +NG S KR+V Q QF  WPD G+P    P L+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ER+KH+++V+IY  +  +R QRN+MVQTE QY FI++ LLE      +E+    L + I+  +Q    ++++  E+EF+KL
Sbjct: 1274 KRTSPSAKDEHS----AGVKDHLLAHSSDPVEMRRLNYQTQGMREHPPVSVCALADHIERLRANDSLRFSQEYESVDPG--QQFTWENSNLEVNKPKNRYANVIAYDHSRVVL-TPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQAPPGDTVTAMELEFKKL 1632          

HSP 2 Score: 97.0561 bits (240), Expect = 3.169e-102
Identity = 47/103 (45.63%), Postives = 69/103 (66.99%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      +S S  CN    KN   +++PF+ +RV L  + GV+GSDYINAS+ID Y + KAYI +Q P++ T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1635 SKAHTSRF------ISASLPCNK--FKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLRE 1729          

HSP 3 Score: 198.364 bits (503), Expect = 2.858e-50
Identity = 114/314 (36.31%), Postives = 170/314 (54.14%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSY---DYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F +   ++ ++        +P   L  +I  L      D +  M+ EF++L          I+++LP NK KNR  NI  ++ S V LQ     +  +YINA++IDGY +Q  YIATQGPL+ET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  IK +R QR  MVQTE QY   Y   LE+
Sbjct: 1576 MVQTEDQYIFIHEALLEAATC---GNTEVPARSLYTHIQKLTQAPPGDTVTAMELEFKKLANSKAHTSRFISASLPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEY 1884          

HSP 4 Score: 90.8929 bits (224), Expect = 1.587e-17
Identity = 39/82 (47.56%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + GV GSDYIN +YID Y K  AYI +Q P+  T+ DFWR+VW+Q  S IV++ ++EE  +V+
Sbjct: 1364 KNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVK 1445          

HSP 5 Score: 87.8113 bits (216), Expect = 1.466e-16
Identity = 60/225 (26.67%), Postives = 110/225 (48.89%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSES-SLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGM 1606
            Y++  L P++ Y   + ++N++G+      V+  TSE  P  PP  + A  +S T + V+W+  E+ NG ++ Y + +T     P   W++++ +  S + IS L P+  + + + A  +VG GP S  + + T+ G  ++   F A   L   I+L W  P   +         E++Y       +NK   I     S+ I ++K DT   F+L A +++G G+
Sbjct:  374 YSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQI-----TKYELTYWE--ADSDNKHHVIFDPAGSYAIDSLKPDTLYKFSLAARSEMGLGV 591          

HSP 6 Score: 71.633 bits (174), Expect = 1.162e-11
Identity = 73/328 (22.26%), Postives = 139/328 (42.38%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSV--EKINGILKKYILLWTE-HSDLPHQHWRQYDA---KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYK---SPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKIN-KNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFT-LIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            Y L+ L  +T Y +W+ +   +G      S +  T ED+P  PP  +    I++TA+ V WK    +K +G ++ Y ++++   +  P       D    +++ ++IS L P   + +T+ A    G G  SK   ++T +G +   P    S  +  + +++W    P K +    +   + YK     +Y++ +     T + F+  +  + +    +F L A N+ G G      I +      +    + ++G T+ T    W  P          L E+NGK    ++VYR +   +++             LKP   Y IR+
Sbjct:  668 YVLEGLEKWTEYTVWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSK-AKVVTTTGAVPGKPTMIISTTIGNTALIQWQ---PPKEMVGELMGYRLRYKREEEDIYTVRD--FRRTDDHFT--VTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLKVVGLTTTTTKLAWDPP---------PLPERNGKIVRYVVVYRDINSHQNQTNGTADTEMTIQGLKPDTTYDIRV 978          

HSP 7 Score: 66.6254 bits (161), Expect = 3.425e-10
Identity = 130/595 (21.85%), Postives = 241/595 (40.50%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECP-EFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENK----IVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGK----AKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYT----NKSSHVIQLLELPKYGVTYEFVLA---RYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTDNT----ISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAF---RVMDTKIRVEWSI 2629
            T+  L P  TY + + +  S+G       ++  T + +P   PT   A A  +T + + W  +  +   + KY L + E +D  ++H   +D    S  I  L P+ ++  ++ A + +G G  ++P+   T     S  P E     +   SI + W  P P  + +   +   ++Y++   S E++    + +I  +  S+ +  +++ TE    ++A   VG G       +   +    A   +  VD I  T+  +   W+ P +  ++  ++ ++      +NG+       R  PII  +  + E +    + L P   Y + +  +   G+    +     + V+ T  A P   G   +     +      + +W+  P  + V     Y L+Y+         +   IYT     ++     +  L K G TY F L    R GN  E     K I+ PE  PS  P  +KV+ ++     L W  P +  RNGK++   V    +N   N T+ T    ++   L P+  Y +RVR+ T    GP S   +       +  P+  + F    VM T + + W +
Sbjct:  474 TISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVP-AQPTGFEAEAELDTRIMLSW--LWPVQDQITKYELTYWE-ADSDNKHHVIFDPAG-SYAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAP-PAASRHGSIVRYSLAYQA--VSGEDQERHEVKDIPADVSSYVLEGLEKWTEYTVWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRV--SWKPPLQQKQHGHIRGYQVVYSRLENGEP------RGQPIIL-DVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSK-----AKVVTTTGAVP---GKPTMIISTTIGN--TALIQWQ--PPKEMVGELMGYRLRYK--------REEEDIYTVRDFRRTDDHFTVTGLHK-GATYIFKLCAKNRAGNGEE---YSKEISTPEDVPSSYPQNLKVVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDINSHQNQTNGTADTEMTIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMSTSM--PEFTKNFGVKAVMKTSVLLTWEV 1025          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 297.745 bits (761), Expect = 3.332e-102
Identity = 157/366 (42.90%), Postives = 231/366 (63.11%), Query Frame = 2
Query: 4073 KNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQV-----SSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            K T+ SA  +++      V D     ++D V++      +  ++    + +  LA++I  L++ D L   QE+E ++    ++++  NSNL  NK KNRYAN+ AYDHS V L  P+D     +YIN NYIDGY KQN YIATQGPL ET  DFW+MVWEQ+++ IVM+ R EE    KC+ YWP +GT  Y  I+V+++  +  A Y++R F + +NG S KR+V Q QF  WPD G+P    P L+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ER+KH+++V+IY  +  +R QRN+MVQTE QY FI++ LLE      +E+    L + I+  +Q    ++++  E+EF+KL
Sbjct: 1172 KRTSPSAKDEHS----AGVKDHLLAHSSDPVEMRRLNYQTQGMREHPPVSVCALADHIERLRANDSLRFSQEYESVDPG--QQFTWENSNLEVNKPKNRYANVIAYDHSRVVL-TPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQAPPGDTVTAMELEFKKL 1530          

HSP 2 Score: 97.0561 bits (240), Expect = 3.332e-102
Identity = 47/103 (45.63%), Postives = 69/103 (66.99%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      +S S  CN    KN   +++PF+ +RV L  + GV+GSDYINAS+ID Y + KAYI +Q P++ T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1533 SKAHTSRF------ISASLPCNK--FKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLRE 1627          

HSP 3 Score: 198.364 bits (503), Expect = 3.180e-50
Identity = 114/314 (36.31%), Postives = 170/314 (54.14%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSY---DYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F +   ++ ++        +P   L  +I  L      D +  M+ EF++L          I+++LP NK KNR  NI  ++ S V LQ     +  +YINA++IDGY +Q  YIATQGPL+ET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  IK +R QR  MVQTE QY   Y   LE+
Sbjct: 1474 MVQTEDQYIFIHEALLEAATC---GNTEVPARSLYTHIQKLTQAPPGDTVTAMELEFKKLANSKAHTSRFISASLPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEY 1782          

HSP 4 Score: 119.398 bits (298), Expect = 3.063e-26
Identity = 141/592 (23.82%), Postives = 252/592 (42.57%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSES-SLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGM---PVKLLIVSAGKAKINKNV-VDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL-TFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYT----NKSSHVIQLLELPKYGVTYEFVLA---RYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTDNT----ISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAF---RVMDTKIRVEWSI 2629
            Y++  L P++ Y   + ++N++G+      V+  TSE  P  PP  + A  +S T + V+W+  E+ NG ++ Y + +T     P   W++++ +  S + IS L P+  + + + A  +VG GP S  + + T+ G  ++   F A   L   I+L W  P   +         E++Y       +NK   I     S+ I ++K DT   F+L A +++G G+   P++     +      + V VD I  T+  +   W+ P +  ++  ++ ++      +NG+       R  PII  +  + E +    + L P   Y + +  +   G+    +     + V+ T  A P   G   +     +      + +W+  P  + V     Y L+Y+         +   IYT     ++     +  L K G TY F L    R GN  E     K I+ PE  PS  P  +KV+ ++     L W  P +  RNGK++   V    +N   N T+ T    ++   L P+  Y +RVR+ T    GP S   +       +  P+  + F    VM T + + W +
Sbjct:  374 YSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQI-----TKYELTYWE--ADSDNKHHVIFDPAGSYAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSVPGAPPRRVEVDNINSTALRV--SWKPPLQQKQHGHIRGYQVVYSRLENGEP------RGQPIIL-DVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSK-----AKVVTTTGAVP---GKPTMIISTTIGN--TALIQWQ--PPKEMVGELMGYRLRYK--------REEEDIYTVRDFRRTDDHFTVTGLHK-GATYIFKLCAKNRAGNGEE---YSKEISTPEDVPSSYPQNLKVVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDINSHQNQTNGTADTEMTIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMSTSM--PEFTKNFGVKAVMKTSVLLTWEV 923          

HSP 5 Score: 91.2781 bits (225), Expect = 1.266e-17
Identity = 39/82 (47.56%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + GV GSDYIN +YID Y K  AYI +Q P+  T+ DFWR+VW+Q  S IV++ ++EE  +V+
Sbjct: 1262 KNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVK 1343          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 303.908 bits (777), Expect = 1.958e-103
Identity = 172/389 (44.22%), Postives = 241/389 (61.95%), Query Frame = 2
Query: 4070 LKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            L N+    +H  T P    V  R   F     + +S+ + +   IPI +LA++I  LK+ D L   QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YIN+NYIDGY KQN YIATQGPL ET  DFW+M+WEQ++  IVM+ + EE    KC+ YWP +GT  Y  I++TL+  +  A YT+R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERI+H++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L + I+  +QI    +++G E+EF++L     +  ++ SR I  N   NK K  L
Sbjct: 1293 LPNSKEIPSHHPTDP----VELRRLNFQTPGNKHNSSCMANHPPIPILELADHIERLKANDNLKFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRL----ASSKAHTSRFISANLPCNKFKNRL 1671          

HSP 2 Score: 95.9005 bits (237), Expect = 1.958e-103
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1664 CNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLRE 1744          

HSP 3 Score: 203.756 bits (517), Expect = 8.583e-52
Identity = 118/314 (37.58%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F ++  ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  +VQTE QY F Y   LE+
Sbjct: 1591 MVQTEDQYIFIHDALLEA---VTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEY 1899          

HSP 4 Score: 100.908 bits (250), Expect = 2.213e-20
Identity = 72/273 (26.37%), Postives = 139/273 (50.92%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQH---WRQYD-AKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGC---TSFTIVARWRQPNKDAKN 1732
            Y++  L P++ Y   + ++N++G+    + V   TSE  P  PP ++ A  +S+T + V+W+  E+ NG ++ Y + +T     P QH   W +++ A S+ + I +L P + + + + A  +VG GPLS  + ++T++G  S+   F+A      SI+L W  P  + T++ +    ++ YK   ++ E +++ I     S+ +  +K ++   F L A  QVG G     +     ++K +    D I C   +S +I+  W  P  + +N
Sbjct:  376 YSVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMD---PTQHINSWTKHNVADSQITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQPLNFKAEPESETSILLSWTPPR-SDTISSY----DLYYKEGDHA-EEQVITIDPAT-SYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSKPSAPPQD-IRCNSQSSTSILVSWLPPPVEKQN 637          

HSP 5 Score: 89.7373 bits (221), Expect = 5.674e-17
Identity = 37/82 (45.12%), Postives = 58/82 (70.73%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV LS++ G+ GSDYIN++YID Y K  AYI +Q P+  T  DFWR++W+Q  + IV++ K+EE  +++
Sbjct: 1379 KNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIK 1460          

HSP 6 Score: 86.2705 bits (212), Expect = 5.109e-16
Identity = 84/332 (25.30%), Postives = 146/332 (43.98%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKS--VEKINGILKKYILLWTE-HSDLPHQHWRQYD---AKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFS-----FEIHNVKEDTEIVFTLRAFNQVGFGMPV--KLLIVSAGKAKINKNV-VDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYR-TLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            Y L++L  +T YRI + +   +G       +   T ED+P GPP  +   A+++T+V+V W+S    K +G ++ Y + +    +  P       D   A ++  +IS L P   + IT+ A    G G  SKP  I++ S  +   P    S   + + +++W  P     +  FG    I Y+  L      +  +TT +FS     F   ++ +    +F L A N+VG+G  +  +L I     +   +N+  D    TS  I   W+ PN + +N  L  +    +   L  Y   +PI+ ++  +        T LKP   Y ++L
Sbjct:  670 YLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQEMIISGLQPETAYSITVTAYTTKGDGARSKP-KIVSTSAAVPGKPRLVISHTQMNTALIQWYPP-----VETFG--PVIGYR--LKFGRKDLDTLTTLEFSEKEEHFTATDIHKGALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSSTSVLIT--WQHPNLEERNGLLTKYTLMYRDINLPHYPIEVPIVPADTTV------TLTGLKPDTTYDVKL 983          

HSP 7 Score: 77.0258 bits (188), Expect = 4.086e-13
Identity = 119/588 (20.24%), Postives = 236/588 (40.14%), Query Frame = 2
Query:  929 QCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKS--PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGK--AKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEW-EEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNG-----KLIYNEVQI--MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSI 2629
            Q  T+  L P  TY + + +  S+G   +   ++  T   +P  P  +  A   S T++ + W      +  +  Y L + E  D   +     D  + S  +  L PN ++Y  + A   VG G  +  ++  T     S  P+  R +     SI++ W  P P +  N   +   I Y       +  ++I++I++    + +  +++ T+    + A+  VG G     +++   +         V++    S ++   WR P  + ++  ++ ++      +NG+       +  P+++     D  ++   + L+P   Y I +T +   G+    +       ++ T  A P         T +N       + +W   +  F  V     Y LK+      +L T     ++ K  H     ++ K G  Y F L+    V     + K +++PE  PS  P  I     S   V + W++P+++ RNG      L+Y ++ +   P+   +   D T++   L P+  Y +++R+ T    GP+S   +F    V+ +  K      VM T + + W I
Sbjct:  473 QITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQP-LNFKAEPESETSILLSWTPPR--SDTISSYDLYYKE-GDHAEEQVITIDPAT-SYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSKPSAPPQDIRCNSQSSTSILVSWLPP-PVEKQNGKIMGYSIKYTGVDTDDAKSHEILSISSETRQYLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEP------KGQPMLKDVMLADAQEMI-ISGLQPETAYSITVTAYTTKGDGARSK-----PKIVSTSAAVPGKPRLVISHTQMN-----TALIQWYPPVETFGPVIG---YRLKFGR---KDLDTLTTLEFSEKEEH-FTATDIHK-GALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSSTSVLITWQHPNLEERNGLLTKYTLMYRDINLPHYPIEVPIVPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEI 1029          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 303.523 bits (776), Expect = 2.218e-103
Identity = 173/392 (44.13%), Postives = 243/392 (61.99%), Query Frame = 2
Query: 4070 LKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSN---VLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            L N+    +H  T P  +    R NF   +S  + S+    + +   IPI +LA++I  LK+ D L   QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YIN+NYIDGY KQN YIATQGPL ET  DFW+M+WEQ++  IVM+ + EE    KC+ YWP +GT  Y  I++TL+  +  A YT+R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERI+H++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L + I+  +QI    +++G E+EF++L     +  ++ SR I  N   NK K  L
Sbjct: 1273 LPNSKEIPSHHPTDPVELR---RLNFQTPESQPLGSSHPLGMANHPPIPILELADHIERLKANDNLKFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRL----ASSKAHTSRFISANLPCNKFKNRL 1655          

HSP 2 Score: 95.9005 bits (237), Expect = 2.218e-103
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1648 CNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLRE 1728          

HSP 3 Score: 203.371 bits (516), Expect = 1.391e-51
Identity = 118/314 (37.58%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F ++  ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  +VQTE QY F Y   LE+
Sbjct: 1575 MVQTEDQYIFIHDALLEA---VTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEY 1883          

HSP 4 Score: 98.5969 bits (244), Expect = 9.088e-20
Identity = 63/227 (27.75%), Postives = 120/227 (52.86%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQH---WRQYD-AKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            Y++  L P++ Y   + ++N++G+    + V   TSE  P  PP ++ A  +S+T + V+W+  E+ NG ++ Y + +T     P QH   W +++ A S+ + I +L P + + + + A  +VG GPLS  + ++T++G  S+   F+A      SI+L W  P  + T++ +    ++ YK   ++ E   ++  T   S+ +  +K ++   F L A  QVG G
Sbjct:  375 YSVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMD---PTQHINSWTKHNVADSQITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQPLNFKAEPESETSILLSWTPPR-SDTISSY----DLYYKEGDHAEEVITIDPAT---SYRLQGLKPNSLYYFRLAARAQVGLG 590          

HSP 5 Score: 89.7373 bits (221), Expect = 5.661e-17
Identity = 37/82 (45.12%), Postives = 58/82 (70.73%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV LS++ G+ GSDYIN++YID Y K  AYI +Q P+  T  DFWR++W+Q  + IV++ K+EE  +++
Sbjct: 1363 KNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIK 1444          

HSP 6 Score: 88.9669 bits (219), Expect = 8.626e-17
Identity = 84/341 (24.63%), Postives = 144/341 (42.23%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKS--VEKINGILKKYILLWTEHSD-------------LPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFS-----FEIHNVKEDTEIVFTLRAFNQVGFGMPV--KLLIVSAGKAKINKNV-VDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYR-TLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            Y L++L  +T YRI + +   +G       +   T ED+P GPP  +   A+++T+V+V W+S    K +G ++ Y + +    +             L    W   D      +IS L P   + IT+ A    G G  SKP  I++ S  +   P    S   + + +++W  P     +  FG    I Y+  L      +  +TT +FS     F   ++ +    +F L A N+VG+G  +  +L I     +   +N+  D    TS  I   W+ PN + +N  L  +    +   L  Y   +PI+ ++  +        T LKP   Y ++L
Sbjct:  665 YLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEYDDTTEHEMIISGLQPETAYSITVTAYTTKGDGARSKP-KIVSTSAAVPGKPRLVISHTQMNTALIQWYPP-----VETFG--PVIGYR--LKFGRKDLDTLTTLEFSEKEEHFTATDIHKGALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSSTSVLIT--WQHPNLEERNGLLTKYTLMYRDINLPHYPIEVPIVPADTTV------TLTGLKPDTTYDVKL 987          

HSP 7 Score: 65.855 bits (159), Expect = 8.086e-10
Identity = 116/595 (19.50%), Postives = 238/595 (40.00%), Query Frame = 2
Query:  929 QCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKS--PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNV-------VDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNF--TRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEW-EEIPIFDKVFSSAIYHLKYRIIFP-AELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNG-----KLIYNEVQI--MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSI 2629
            Q  T+  L P  TY + + +  S+G   +   ++  T   +P  P  +  A   S T++ + W      +  +  Y L + E     H         + S  +  L PN ++Y  + A   VG G  +  ++  T   T  +  + R +     SI++ W  P P +  N   +   I Y       +  ++I++I++    + +  +++ T+    + A+  VG G     +++     + +++V       V++    S ++   WR P  + ++  ++ ++      +NG+     + + + +  ++++ D+   +    + L+P   Y I +T +   G+    +       ++ T  A P         T +N       + +W   +  F  V       + YR+ F   +L T     ++ K  H     ++ K G  Y F L+    V     + K +++PE  PS  P  I     S   V + W++P+++ RNG      L+Y ++ +   P+   +   D T++   L P+  Y +++R+ T    GP    F F+         K      VM T + + W I
Sbjct:  472 QITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQP-LNFKAEPESETSILLSWTPPR--SDTISSYDLYYKEGD---HAEEVITIDPATSYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSTPPQ--DIRCNSQSSTSILVSWLPP-PVEKQNGKIMGYSIKYTGVDTDDAKSHEILSISSETRQYLLEQLEKWTQYRIIMIAYTDVGPGPESSPILI-----RTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEYDDTTEHEMIISGLQPETAYSITVTAYTTKGDGARSK-----PKIVSTSAAVPGKPRLVISHTQMN-----TALIQWYPPVETFGPV-------IGYRLKFGRKDLDTLTTLEFSEKEEH-FTATDIHK-GALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSSTSVLITWQHPNLEERNGLLTKYTLMYRDINLPHYPIEVPIVPADTTVTLTGLKPDTTYDVKLRAHTSKGPGP----FMFA---------KNFHVKAVMKTSVLLSWEI 1020          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 301.982 bits (772), Expect = 7.339e-103
Identity = 173/395 (43.80%), Postives = 242/395 (61.27%), Query Frame = 2
Query: 4070 LKNTTVSANHQNTTPDIVNVSDRFNFFNNDSV------QVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            L N+    +H  T P  +    R NF    S        + S+ + +   IPI +LA++I  LK+ D L   QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YIN+NYIDGY KQN YIATQGPL ET  DFW+M+WEQ++  IVM+ + EE    KC+ YWP +GT  Y  I++TL+  +  A YT+R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERI+H++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L + I+  +QI    +++G E+EF++L     +  ++ SR I  N   NK K  L
Sbjct: 1298 LPNSKEIPSHHPTDPVELR---RLNFQTPGSGVSGYPRNLHSSSMANHPPIPILELADHIERLKANDNLKFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRL----ASSKAHTSRFISANLPCNKFKNRL 1683          

HSP 2 Score: 95.9005 bits (237), Expect = 7.339e-103
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1676 CNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLRE 1756          

HSP 3 Score: 203.371 bits (516), Expect = 1.171e-51
Identity = 118/314 (37.58%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F ++  ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  +VQTE QY F Y   LE+
Sbjct: 1603 MVQTEDQYIFIHDALLEA---VTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEY 1911          

HSP 4 Score: 100.523 bits (249), Expect = 2.537e-20
Identity = 72/273 (26.37%), Postives = 139/273 (50.92%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQH---WRQYD-AKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGC---TSFTIVARWRQPNKDAKN 1732
            Y++  L P++ Y   + ++N++G+    + V   TSE  P  PP ++ A  +S+T + V+W+  E+ NG ++ Y + +T     P QH   W +++ A S+ + I +L P + + + + A  +VG GPLS  + ++T++G  S+   F+A      SI+L W  P  + T++ +    ++ YK   ++ E +++ I     S+ +  +K ++   F L A  QVG G     +     ++K +    D I C   +S +I+  W  P  + +N
Sbjct:  372 YSVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMD---PTQHINSWTKHNVADSQITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQPLNFKAEPESETSILLSWTPPR-SDTISSY----DLYYKEGDHA-EEQVITIDPAT-SYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSKPSAPPQD-IRCNSQSSTSILVSWLPPPVEKQN 633          

HSP 5 Score: 89.3521 bits (220), Expect = 6.182e-17
Identity = 37/82 (45.12%), Postives = 58/82 (70.73%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV LS++ G+ GSDYIN++YID Y K  AYI +Q P+  T  DFWR++W+Q  + IV++ K+EE  +++
Sbjct: 1391 KNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIK 1472          

HSP 6 Score: 88.5817 bits (218), Expect = 1.042e-16
Identity = 84/341 (24.63%), Postives = 144/341 (42.23%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKS--VEKINGILKKYILLWTEHSD-------------LPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFS-----FEIHNVKEDTEIVFTLRAFNQVGFGMPV--KLLIVSAGKAKINKNV-VDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYR-TLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            Y L++L  +T YRI + +   +G       +   T ED+P GPP  +   A+++T+V+V W+S    K +G ++ Y + +    +             L    W   D      +IS L P   + IT+ A    G G  SKP  I++ S  +   P    S   + + +++W  P     +  FG    I Y+  L      +  +TT +FS     F   ++ +    +F L A N+VG+G  +  +L I     +   +N+  D    TS  I   W+ PN + +N  L  +    +   L  Y   +PI+ ++  +        T LKP   Y ++L
Sbjct:  666 YLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEYDDTTEHEMIISGLQPETAYSITVTAYTTKGDGARSKP-KIVSTSAAVPGKPRLVISHTQMNTALIQWYPP-----VETFG--PVIGYR--LKFGRKDLDTLTTLEFSEKEEHFTATDIHKGALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSSTSVLIT--WQHPNLEERNGLLTKYTLMYRDINLPHYPIEVPIVPADTTV------TLTGLKPDTTYDVKL 988          

HSP 7 Score: 77.7962 bits (190), Expect = 2.232e-13
Identity = 119/595 (20.00%), Postives = 243/595 (40.84%), Query Frame = 2
Query:  929 QCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKS--PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNV-------VDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNF--TRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEW-EEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNG-----KLIYNEVQI--MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSI 2629
            Q  T+  L P  TY + + +  S+G   +   ++  T   +P  P  +  A   S T++ + W      +  +  Y L + E  D   +     D  + S  +  L PN ++Y  + A   VG G  +  ++  T     S  P+  R +     SI++ W  P P +  N   +   I Y       +  ++I++I++    + +  +++ T+    + A+  VG G     +++     + +++V       V++    S ++   WR P  + ++  ++ ++      +NG+     + + + +  ++++ D+   +    + L+P   Y I +T +   G+    +       ++ T  A P         T +N       + +W   +  F  V     Y LK+      +L T     ++ K  H     ++ K G  Y F L+    V     + K +++PE  PS  P  I     S   V + W++P+++ RNG      L+Y ++ +   P+   +   D T++   L P+  Y +++R+ T    GP+S   +F    V+ +  K      VM T + + W I
Sbjct:  469 QITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQP-LNFKAEPESETSILLSWTPPR--SDTISSYDLYYKE-GDHAEEQVITIDPAT-SYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSKPSAPPQDIRCNSQSSTSILVSWLPP-PVEKQNGKIMGYSIKYTGVDTDDAKSHEILSISSETRQYLLEQLEKWTQYRIIMIAYTDVGPGPESSPILI-----RTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEYDDTTEHEMIISGLQPETAYSITVTAYTTKGDGARSK-----PKIVSTSAAVPGKPRLVISHTQMN-----TALIQWYPPVETFGPVIG---YRLKFGR---KDLDTLTTLEFSEKEEH-FTATDIHK-GALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSSTSVLITWQHPNLEERNGLLTKYTLMYRDINLPHYPIEVPIVPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEI 1034          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 301.982 bits (772), Expect = 7.525e-103
Identity = 173/395 (43.80%), Postives = 242/395 (61.27%), Query Frame = 2
Query: 4070 LKNTTVSANHQNTTPDIVNVSDRFNFFNNDSV------QVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            L N+    +H  T P  +    R NF    S        + S+ + +   IPI +LA++I  LK+ D L   QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YIN+NYIDGY KQN YIATQGPL ET  DFW+M+WEQ++  IVM+ + EE    KC+ YWP +GT  Y  I++TL+  +  A YT+R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERI+H++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L + I+  +QI    +++G E+EF++L     +  ++ SR I  N   NK K  L
Sbjct: 1294 LPNSKEIPSHHPTDPVELR---RLNFQTPGSGVSGYPRNLHSSSMANHPPIPILELADHIERLKANDNLKFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRL----ASSKAHTSRFISANLPCNKFKNRL 1679          

HSP 2 Score: 95.9005 bits (237), Expect = 7.525e-103
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1672 CNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLRE 1752          

HSP 3 Score: 203.756 bits (517), Expect = 1.092e-51
Identity = 118/314 (37.58%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F ++  ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  +VQTE QY F Y   LE+
Sbjct: 1599 MVQTEDQYIFIHDALLEA---VTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEY 1907          

HSP 4 Score: 100.523 bits (249), Expect = 2.472e-20
Identity = 72/273 (26.37%), Postives = 139/273 (50.92%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQH---WRQYD-AKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGC---TSFTIVARWRQPNKDAKN 1732
            Y++  L P++ Y   + ++N++G+    + V   TSE  P  PP ++ A  +S+T + V+W+  E+ NG ++ Y + +T     P QH   W +++ A S+ + I +L P + + + + A  +VG GPLS  + ++T++G  S+   F+A      SI+L W  P  + T++ +    ++ YK   ++ E +++ I     S+ +  +K ++   F L A  QVG G     +     ++K +    D I C   +S +I+  W  P  + +N
Sbjct:  372 YSVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMD---PTQHINSWTKHNVADSQITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQPLNFKAEPESETSILLSWTPPR-SDTISSY----DLYYKEGDHA-EEQVITIDPAT-SYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSKPSAPPQD-IRCNSQSSTSILVSWLPPPVEKQN 633          

HSP 5 Score: 89.3521 bits (220), Expect = 5.874e-17
Identity = 37/82 (45.12%), Postives = 58/82 (70.73%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV LS++ G+ GSDYIN++YID Y K  AYI +Q P+  T  DFWR++W+Q  + IV++ K+EE  +++
Sbjct: 1387 KNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIK 1468          

HSP 6 Score: 86.2705 bits (212), Expect = 5.658e-16
Identity = 84/332 (25.30%), Postives = 146/332 (43.98%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKS--VEKINGILKKYILLWTE-HSDLPHQHWRQYD---AKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFS-----FEIHNVKEDTEIVFTLRAFNQVGFGMPV--KLLIVSAGKAKINKNV-VDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYR-TLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            Y L++L  +T YRI + +   +G       +   T ED+P GPP  +   A+++T+V+V W+S    K +G ++ Y + +    +  P       D   A ++  +IS L P   + IT+ A    G G  SKP  I++ S  +   P    S   + + +++W  P     +  FG    I Y+  L      +  +TT +FS     F   ++ +    +F L A N+VG+G  +  +L I     +   +N+  D    TS  I   W+ PN + +N  L  +    +   L  Y   +PI+ ++  +        T LKP   Y ++L
Sbjct:  666 YLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQEMIISGLQPETAYSITVTAYTTKGDGARSKP-KIVSTSAAVPGKPRLVISHTQMNTALIQWYPP-----VETFG--PVIGYR--LKFGRKDLDTLTTLEFSEKEEHFTATDIHKGALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSSTSVLIT--WQHPNLEERNGLLTKYTLMYRDINLPHYPIEVPIVPADTTV------TLTGLKPDTTYDVKL 979          

HSP 7 Score: 77.0258 bits (188), Expect = 4.056e-13
Identity = 120/593 (20.24%), Postives = 240/593 (40.47%), Query Frame = 2
Query:  929 QCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKS--PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNV-------VDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEW-EEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNG-----KLIYNEVQI--MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSI 2629
            Q  T+  L P  TY + + +  S+G   +   ++  T   +P  P  +  A   S T++ + W      +  +  Y L + E  D   +     D  + S  +  L PN ++Y  + A   VG G  +  ++  T     S  P+  R +     SI++ W  P P +  N   +   I Y       +  ++I++I++    + +  +++ T+    + A+  VG G     +++     + +++V       V++    S ++   WR P  + ++  ++ ++      +NG+       +  P+++     D  ++   + L+P   Y I +T +   G+    +       ++ T  A P         T +N       + +W   +  F  V     Y LK+      +L T     ++ K  H     ++ K G  Y F L+    V     + K +++PE  PS  P  I     S   V + W++P+++ RNG      L+Y ++ +   P+   +   D T++   L P+  Y +++R+ T    GP+S   +F    V+ +  K      VM T + + W I
Sbjct:  469 QITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQP-LNFKAEPESETSILLSWTPPR--SDTISSYDLYYKE-GDHAEEQVITIDPAT-SYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSKPSAPPQDIRCNSQSSTSILVSWLPP-PVEKQNGKIMGYSIKYTGVDTDDAKSHEILSISSETRQYLLEQLEKWTQYRIIMIAYTDVGPGPESSPILI-----RTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEP------KGQPMLKDVMLADAQEMI-ISGLQPETAYSITVTAYTTKGDGARSK-----PKIVSTSAAVPGKPRLVISHTQMN-----TALIQWYPPVETFGPVIG---YRLKFGR---KDLDTLTTLEFSEKEEH-FTATDIHK-GALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSSTSVLITWQHPNLEERNGLLTKYTLMYRDINLPHYPIEVPIVPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEI 1025          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 301.982 bits (772), Expect = 7.779e-103
Identity = 173/395 (43.80%), Postives = 242/395 (61.27%), Query Frame = 2
Query: 4070 LKNTTVSANHQNTTPDIVNVSDRFNFFNNDSV------QVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            L N+    +H  T P  +    R NF    S        + S+ + +   IPI +LA++I  LK+ D L   QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YIN+NYIDGY KQN YIATQGPL ET  DFW+M+WEQ++  IVM+ + EE    KC+ YWP +GT  Y  I++TL+  +  A YT+R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERI+H++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L + I+  +QI    +++G E+EF++L     +  ++ SR I  N   NK K  L
Sbjct: 1303 LPNSKEIPSHHPTDPVELR---RLNFQTPGSGVSGYPRNLHSSSMANHPPIPILELADHIERLKANDNLKFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRL----ASSKAHTSRFISANLPCNKFKNRL 1688          

HSP 2 Score: 95.5153 bits (236), Expect = 7.779e-103
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1681 CNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLRE 1761          

HSP 3 Score: 203.756 bits (517), Expect = 1.043e-51
Identity = 118/314 (37.58%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F ++  ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  +VQTE QY F Y   LE+
Sbjct: 1608 MVQTEDQYIFIHDALLEA---VTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEY 1916          

HSP 4 Score: 100.523 bits (249), Expect = 2.475e-20
Identity = 72/273 (26.37%), Postives = 139/273 (50.92%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQH---WRQYD-AKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGC---TSFTIVARWRQPNKDAKN 1732
            Y++  L P++ Y   + ++N++G+    + V   TSE  P  PP ++ A  +S+T + V+W+  E+ NG ++ Y + +T     P QH   W +++ A S+ + I +L P + + + + A  +VG GPLS  + ++T++G  S+   F+A      SI+L W  P  + T++ +    ++ YK   ++ E +++ I     S+ +  +K ++   F L A  QVG G     +     ++K +    D I C   +S +I+  W  P  + +N
Sbjct:  372 YSVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMD---PTQHINSWTKHNVADSQITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQPLNFKAEPESETSILLSWTPPR-SDTISSY----DLYYKEGDHA-EEQVITIDPAT-SYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSKPSAPPQD-IRCNSQSSTSILVSWLPPPVEKQN 633          

HSP 5 Score: 89.3521 bits (220), Expect = 6.729e-17
Identity = 37/82 (45.12%), Postives = 58/82 (70.73%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV LS++ G+ GSDYIN++YID Y K  AYI +Q P+  T  DFWR++W+Q  + IV++ K+EE  +++
Sbjct: 1396 KNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIK 1477          

HSP 6 Score: 88.5817 bits (218), Expect = 1.087e-16
Identity = 84/341 (24.63%), Postives = 144/341 (42.23%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKS--VEKINGILKKYILLWTEHSD-------------LPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFS-----FEIHNVKEDTEIVFTLRAFNQVGFGMPV--KLLIVSAGKAKINKNV-VDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYR-TLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            Y L++L  +T YRI + +   +G       +   T ED+P GPP  +   A+++T+V+V W+S    K +G ++ Y + +    +             L    W   D      +IS L P   + IT+ A    G G  SKP  I++ S  +   P    S   + + +++W  P     +  FG    I Y+  L      +  +TT +FS     F   ++ +    +F L A N+VG+G  +  +L I     +   +N+  D    TS  I   W+ PN + +N  L  +    +   L  Y   +PI+ ++  +        T LKP   Y ++L
Sbjct:  666 YLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEYDDTTEHEMIISGLQPETAYSITVTAYTTKGDGARSKP-KIVSTSAAVPGKPRLVISHTQMNTALIQWYPP-----VETFG--PVIGYR--LKFGRKDLDTLTTLEFSEKEEHFTATDIHKGALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSSTSVLIT--WQHPNLEERNGLLTKYTLMYRDINLPHYPIEVPIVPADTTV------TLTGLKPDTTYDVKL 988          

HSP 7 Score: 77.7962 bits (190), Expect = 2.053e-13
Identity = 119/596 (19.97%), Postives = 244/596 (40.94%), Query Frame = 2
Query:  929 QCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKS--PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNV-------VDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNF--TRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEW-EEIPIFDKVFSSAIYHLKYRIIFP-AELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNG-----KLIYNEVQI--MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSI 2629
            Q  T+  L P  TY + + +  S+G   +   ++  T   +P  P  +  A   S T++ + W      +  +  Y L + E  D   +     D  + S  +  L PN ++Y  + A   VG G  +  ++  T     S  P+  R +     SI++ W  P P +  N   +   I Y       +  ++I++I++    + +  +++ T+    + A+  VG G     +++     + +++V       V++    S ++   WR P  + ++  ++ ++      +NG+     + + + +  ++++ D+   +    + L+P   Y I +T +   G+    +       ++ T  A P         T +N       + +W   +  F  V       + YR+ F   +L T     ++ K  H     ++ K G  Y F L+    V     + K +++PE  PS  P  I     S   V + W++P+++ RNG      L+Y ++ +   P+   +   D T++   L P+  Y +++R+ T    GP+S   +F    V+ +  K      VM T + + W I
Sbjct:  469 QITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQP-LNFKAEPESETSILLSWTPPR--SDTISSYDLYYKE-GDHAEEQVITIDPAT-SYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSKPSAPPQDIRCNSQSSTSILVSWLPP-PVEKQNGKIMGYSIKYTGVDTDDAKSHEILSISSETRQYLLEQLEKWTQYRIIMIAYTDVGPGPESSPILI-----RTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEYDDTTEHEMIISGLQPETAYSITVTAYTTKGDGARSK-----PKIVSTSAAVPGKPRLVISHTQMN-----TALIQWYPPVETFGPV-------IGYRLKFGRKDLDTLTTLEFSEKEEH-FTATDIHK-GALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSSTSVLITWQHPNLEERNGLLTKYTLMYRDINLPHYPIEVPIVPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEI 1034          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 301.982 bits (772), Expect = 4.648e-103
Identity = 155/324 (47.84%), Postives = 217/324 (66.98%), Query Frame = 2
Query: 4184 LKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            + S   IPI  +AE++  LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V LQ PL+     +YINANY+DGY +QN YIATQGPL ET  DFW+MVWEQ+S  +VM+ R EE    KC+ YWP +GT  Y  I+VTL+  +  A + +R F + +NG S KR+V   QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERIK ++TV++Y  +  +R QRN+MVQTE QYGFI++ LLE      +E+    L + I+  +Q+     ++G E+EF++L
Sbjct: 1326 MLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEANKPKNRYANVIAYDHSRVILQ-PLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVEPGEHVTGMELEFKRL 1646          

HSP 2 Score: 95.9005 bits (237), Expect = 4.648e-103
Identity = 46/103 (44.66%), Postives = 68/103 (66.02%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      ++ S  CN    KN   +++P++ +RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR +W+ N +I+V+L K+ E
Sbjct: 1649 SKAHTSRF------ITASLPCNK--FKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLRE 1743          

HSP 3 Score: 200.675 bits (509), Expect = 7.245e-51
Identity = 116/314 (36.94%), Postives = 164/314 (52.23%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F +   ++    V      +P   L  YI  L   +       M  EF+ L          I ++LP NK KNR  NI  Y+ S V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+ +WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F +   LE+
Sbjct: 1590 MVQTEDQYGFIHEALLEA---VGCGNTEVPARSLYTYIQKLAQVEPGEHVTGMELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEY 1898          

HSP 4 Score: 100.138 bits (248), Expect = 2.407e-20
Identity = 78/311 (25.08%), Postives = 145/311 (46.62%), Query Frame = 2
Query:  824 NNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSME-NKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSF---TIVARWRQPNKDAKNMTL 1741
            N   +  +V+ Y+S+ Q      P++ I  D    + Y++  L P + Y IW++++NS+G+    +SV   T E  P   P ++ A  +S T + V+W+   + NG+++ Y + +T   + P  +W++++   S  + +  L  +  + + + A  +VG GPLS P+ + T+ G   +    RA      SI L W+ P          +  E+ ++      E  +  + TT   +F + ++K +TE  F L A +  G G    ++     +AK +    D + CTS     I+  WR P  +  N  L
Sbjct:  343 NPDPVSYYVIEYKSKSQ----DGPYQ-IKEDITTTR-YSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAPRQESV-----IKYELLFREGDRGREVGRTFDPTT---AFVVEDLKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQAKPSAPPQD-VKCTSLRSTAILVSWRPPPPETHNGAL 638          

HSP 5 Score: 86.6557 bits (213), Expect = 2.906e-16
Identity = 34/82 (41.46%), Postives = 56/82 (68.29%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  + G+ GSDYINA+Y+D Y +  AYI +Q P+  T  DFWR+VW+Q  + +V++ ++EE  +++
Sbjct: 1378 KNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIK 1459          

HSP 6 Score: 64.3142 bits (155), Expect = 2.204e-9
Identity = 45/181 (24.86%), Postives = 75/181 (41.44%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVE------KINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEIS 1465
            L+ L  +T YR+   +   +G       V   T ED+P  PP  + A A++ TA+ V W+S        +I G    Y+ +    +  P +      A ++  +I++L P   + IT+ A    G G  SKP  ++TK G +   P     +    S++  W  P         G  L+  
Sbjct:  670 LEALEKWTEYRVTAVAYTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDIMLADAQEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTK-GAVLGRPTLSVQQTPEGSLLARWEPPADAAEDPVLGYRLQFG 849          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Mouse
Match: Ptprf (protein tyrosine phosphatase, receptor type, F [Source:MGI Symbol;Acc:MGI:102695])

HSP 1 Score: 301.597 bits (771), Expect = 7.101e-103
Identity = 153/323 (47.37%), Postives = 211/323 (65.33%), Query Frame = 2
Query: 4184 LKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            ++    IPI  LA+ I  LK+ D L   QE+E ++    ++++  NSN   NK KNRYAN+ AYDHS V L +       +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ++  +VM+ R EE    KC+ YWP +GT  Y  I+VTLV  +  A YT+R F + ++G S KR++ Q QF  WPD G+P    P L+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ER+KH++TV+IY  +  +R QRN+MVQTE QY FI++ LLE     ++E++   L + I+   Q+    S++  E+EF+ L
Sbjct: 1317 MRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPG--QQFTWENSNSEVNKPKNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPVRGTETYGLIQVTLVDTVELATYTMRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAAMCGHTEVLARNLYAHIQKLGQVPPGESVTAMELEFKLL 1637          

HSP 2 Score: 95.9005 bits (237), Expect = 7.101e-103
Identity = 46/103 (44.66%), Postives = 68/103 (66.02%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      VS +  CN    KN   +++P++  RV L  + GV+GSDYINAS++D Y + KAYI +Q P+A + EDFWR++W+ N +IIV+L K+ E
Sbjct: 1640 SKAHTSRF------VSANLPCNK--FKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLRE 1734          

HSP 3 Score: 196.823 bits (499), Expect = 9.935e-50
Identity = 105/262 (40.08%), Postives = 149/262 (56.87%), Query Frame = 2
Query: 4262 MMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            M  EF+ L          +++NLP NK KNR  NI  Y+ + V LQ     +  +YINA+++DGY +Q  YIATQGPLAE+  DFW+M+WE  STIIVML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  +K +R QR  MVQTE QY   Y   LE+
Sbjct: 1630 MELEFKLLANSKAHTSRFVSANLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEY 1889          

HSP 4 Score: 92.4337 bits (228), Expect = 5.140e-18
Identity = 39/82 (47.56%), Postives = 59/82 (71.95%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+S+ GV GSDYINA+YID Y K  AYI +Q P+  T+ DFWR+VW+Q  + +V++ ++EE  +V+
Sbjct: 1369 KNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVK 1450          

HSP 5 Score: 91.6633 bits (226), Expect = 1.106e-17
Identity = 66/283 (23.32%), Postives = 131/283 (46.29%), Query Frame = 2
Query:  893 PFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSE-SSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGM--PVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKN 1732
            PF+++  D      Y++  L PF+ Y   + ++NS+G+    ++V+  T E  P  PP  + A  +S + + V+W+  E+ NG+++ Y + +T  S  P   W +++  +   + +  L P   + + + A   VG GP S  + + T+ G  ++  +F+A+      I L W  P P + +  + L   + + +     ++K+    T+ ++ E  ++K DT   F L A + +G G+  P      +          V  +   S T+   W  P  D++N
Sbjct:  362 PFQEV--DGVASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQANAESDTRIQLSWLLP-PQERIVKYEL---VYWAAEDEGQQHKVTFDPTSSYTLE--DLKPDTLYHFQLAARSDLGVGVFTPTVEARTAQSTPSAPPQKVTCVSTGSTTVRVSWVPPPADSRN 636          

HSP 6 Score: 88.5817 bits (218), Expect = 9.470e-17
Identity = 91/367 (24.80%), Postives = 156/367 (42.51%), Query Frame = 2
Query:  827 NLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWK--SVEKINGILKKYILLWT--EHSDLPHQHWRQ--YDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKIN-KNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGK--SFTLIVYRTLPIIRSEFQIDEWKIYNFTR-----LKPSQKYQIRL 1885
            N  I Q+ + YE+ +  +      + I  + + W    L+K   +T YR+W+ +   +G       V   T ED+P GPP  +    +++TAV V WK     K +G ++ Y + +   E+ +   Q   Q    A+++ + IS LTP   + IT+ A    G G  SKP  ++T +G +   P    S   + + +L+W+   P K L    L   + Y+    +  N I +   +   F +  + +    VF L A N+ G G   +  I +           + + G T+ T    W  P          L E+NG   ++T +VYR +       Q++   + N T      LKP   Y I++
Sbjct:  636 NGIITQYSVAYEAVDGEDRKRHVVDGISREHSSWDLLGLEK---WTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKP-KVVTTTGAVPGRPTMMVSTTAMHTALLQWH---PPKELPGELLGYRLQYRRADEARPNTI-DFGKDDQHFTVTGLHKGATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQNLRVTGLTTSTTELTWDPP---------VLAERNGHITNYT-VVYRDI-----NSQLELQNVTNDTHLTLLGLKPDTTYDIKV 979          

HSP 7 Score: 83.1889 bits (204), Expect = 3.280e-15
Identity = 130/595 (21.85%), Postives = 241/595 (40.50%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRW--KSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENK----IVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNV-------VDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQS----VGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKL-----IYNEV-QIMPLNQILNSTDNTISFYKLPNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSI 2629
            T+  L P  TY + + +  ++G      +++  T + +P   P    A+A S+T +++ W     E+I     KY L++    D   QH   +D  S  +L   L P+ +++  + A +++G G  +  V   T   T S  P+          ++ + W  P P  + N       ++Y++     E++    +  I+    S+++  +++ TE    +RA   VG G     ++V     + +++V       V++    S  +   W+ P  + ++  ++ ++      +NG+       R  PII+ +  + E +    + L P   Y I +  +   G+    +       V+ T  A P      V    + T + L+ HP      +E+P   ++     Y L+YR    A  +T    I   K      +  L K G TY F LA           +K I  PE  PS  P  ++V  ++     L W  P +  RNG +     +Y ++   + L  + N T  T+   K P+  Y ++VR+ T    GP S   +     VE +  K  R    M T + + W +
Sbjct:  474 TVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVP-AQPADFQANAESDTRIQLSWLLPPQERI----VKYELVYWAAEDEGQQHKVTFDPTSSYTL-EDLKPDTLYHFQLAARSDLGVGVFTPTVEARTAQSTPSAPPQKVTCVSTGSTTVRVSWVPP-PADSRNGIITQYSVAYEA--VDGEDRKRHVVDGISREHSSWDLLGLEKWTEYRVWVRAHTDVGPGPESSPVLV-----RTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEP------RGQPIIQ-DVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSK-----PKVVTTTGAVPGRPTMMVSTTAMHTAL-LQWHPP-----KELP--GELLG---YRLQYRRADEARPNT----IDFGKDDQHFTVTGLHK-GATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQNLRVTGLTTSTTELTWDPPVLAERNGHITNYTVVYRDINSQLELQNVTNDTHLTLLGLK-PDTTYDIKVRAHTSKGAGPLSPSIQSRTMPVEQVFAKNFRVAAAMKTSVLLSWEV 1025          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 301.212 bits (770), Expect = 9.749e-103
Identity = 155/324 (47.84%), Postives = 217/324 (66.98%), Query Frame = 2
Query: 4184 LKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            + S   IPI  +AE++  LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V LQ PL+     +YINANY+DGY +QN YIATQGPL ET  DFW+MVWEQ+S  +VM+ R EE    KC+ YWP +GT  Y  I+VTL+  +  A + +R F + +NG S KR+V   QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERIK ++TV++Y  +  +R QRN+MVQTE QYGFI++ LLE      +E+    L + I+  +Q+     ++G E+EF++L
Sbjct:  916 MLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEANKPKNRYANVIAYDHSRVILQ-PLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVEPGEHVTGMELEFKRL 1236          

HSP 2 Score: 95.5153 bits (236), Expect = 9.749e-103
Identity = 46/103 (44.66%), Postives = 68/103 (66.02%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      ++ S  CN    KN   +++P++ +RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR +W+ N +I+V+L K+ E
Sbjct: 1239 SKAHTSRF------ITASLPCNK--FKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLRE 1333          

HSP 3 Score: 200.675 bits (509), Expect = 5.403e-51
Identity = 116/314 (36.94%), Postives = 164/314 (52.23%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F +   ++    V      +P   L  YI  L   +       M  EF+ L          I ++LP NK KNR  NI  Y+ S V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+ +WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F +   LE+
Sbjct: 1180 MVQTEDQYGFIHEALLEA---VGCGNTEVPARSLYTYIQKLAQVEPGEHVTGMELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEY 1488          

HSP 4 Score: 92.4337 bits (228), Expect = 4.934e-18
Identity = 66/262 (25.19%), Postives = 126/262 (48.09%), Query Frame = 2
Query:  824 NNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSME-NKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            N   +  +V+ Y+S+ Q      P++ I  D    + Y++  L P + Y IW++++NS+G+    +SV   T E  P   P ++ A  +S T + V+W+   + NG+++ Y + +T   + P  +W++++   S  + +  L  +  + + + A  +VG GPLS P+ + T+ G   +    RA      SI L W+ P          +  E+ ++      E  +  + TT   +F + ++K +TE  F L A +  G G
Sbjct:  343 NPDPVSYYVIEYKSKSQ----DGPYQ-IKEDITTTR-YSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAPRQESV-----IKYELLFREGDRGREVGRTFDPTT---AFVVEDLKPNTEYAFRLAARSPQGLG 590          

HSP 5 Score: 86.6557 bits (213), Expect = 3.492e-16
Identity = 34/82 (41.46%), Postives = 56/82 (68.29%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  + G+ GSDYINA+Y+D Y +  AYI +Q P+  T  DFWR+VW+Q  + +V++ ++EE  +++
Sbjct:  968 KNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIK 1049          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 301.212 bits (770), Expect = 1.033e-102
Identity = 155/324 (47.84%), Postives = 217/324 (66.98%), Query Frame = 2
Query: 4184 LKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            + S   IPI  +AE++  LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V LQ PL+     +YINANY+DGY +QN YIATQGPL ET  DFW+MVWEQ+S  +VM+ R EE    KC+ YWP +GT  Y  I+VTL+  +  A + +R F + +NG S KR+V   QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERIK ++TV++Y  +  +R QRN+MVQTE QYGFI++ LLE      +E+    L + I+  +Q+     ++G E+EF++L
Sbjct:  920 MLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEANKPKNRYANVIAYDHSRVILQ-PLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVEPGEHVTGMELEFKRL 1240          

HSP 2 Score: 95.5153 bits (236), Expect = 1.033e-102
Identity = 46/103 (44.66%), Postives = 68/103 (66.02%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      ++ S  CN    KN   +++P++ +RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR +W+ N +I+V+L K+ E
Sbjct: 1243 SKAHTSRF------ITASLPCNK--FKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLRE 1337          

HSP 3 Score: 200.29 bits (508), Expect = 5.566e-51
Identity = 116/314 (36.94%), Postives = 164/314 (52.23%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F +   ++    V      +P   L  YI  L   +       M  EF+ L          I ++LP NK KNR  NI  Y+ S V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+ +WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F +   LE+
Sbjct: 1184 MVQTEDQYGFIHEALLEA---VGCGNTEVPARSLYTYIQKLAQVEPGEHVTGMELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEY 1492          

HSP 4 Score: 92.4337 bits (228), Expect = 5.195e-18
Identity = 66/262 (25.19%), Postives = 126/262 (48.09%), Query Frame = 2
Query:  824 NNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSME-NKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            N   +  +V+ Y+S+ Q      P++ I  D    + Y++  L P + Y IW++++NS+G+    +SV   T E  P   P ++ A  +S T + V+W+   + NG+++ Y + +T   + P  +W++++   S  + +  L  +  + + + A  +VG GPLS P+ + T+ G   +    RA      SI L W+ P          +  E+ ++      E  +  + TT   +F + ++K +TE  F L A +  G G
Sbjct:  343 NPDPVSYYVIEYKSKSQ----DGPYQ-IKEDITTTR-YSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAPRQESV-----IKYELLFREGDRGREVGRTFDPTT---AFVVEDLKPNTEYAFRLAARSPQGLG 590          

HSP 5 Score: 86.2705 bits (212), Expect = 3.555e-16
Identity = 34/82 (41.46%), Postives = 56/82 (68.29%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  + G+ GSDYINA+Y+D Y +  AYI +Q P+  T  DFWR+VW+Q  + +V++ ++EE  +++
Sbjct:  972 KNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIK 1053          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Mouse
Match: Ptprf (protein tyrosine phosphatase, receptor type, F [Source:MGI Symbol;Acc:MGI:102695])

HSP 1 Score: 300.442 bits (768), Expect = 1.383e-102
Identity = 153/323 (47.37%), Postives = 211/323 (65.33%), Query Frame = 2
Query: 4184 LKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            ++    IPI  LA+ I  LK+ D L   QE+E ++    ++++  NSN   NK KNRYAN+ AYDHS V L +       +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ++  +VM+ R EE    KC+ YWP +GT  Y  I+VTLV  +  A YT+R F + ++G S KR++ Q QF  WPD G+P    P L+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ER+KH++TV+IY  +  +R QRN+MVQTE QY FI++ LLE     ++E++   L + I+   Q+    S++  E+EF+ L
Sbjct:  751 MRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPG--QQFTWENSNSEVNKPKNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPVRGTETYGLIQVTLVDTVELATYTMRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAAMCGHTEVLARNLYAHIQKLGQVPPGESVTAMELEFKLL 1071          

HSP 2 Score: 95.9005 bits (237), Expect = 1.383e-102
Identity = 46/103 (44.66%), Postives = 68/103 (66.02%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      VS +  CN    KN   +++P++  RV L  + GV+GSDYINAS++D Y + KAYI +Q P+A + EDFWR++W+ N +IIV+L K+ E
Sbjct: 1074 SKAHTSRF------VSANLPCNK--FKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLRE 1168          

HSP 3 Score: 196.438 bits (498), Expect = 7.020e-50
Identity = 105/262 (40.08%), Postives = 149/262 (56.87%), Query Frame = 2
Query: 4262 MMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            M  EF+ L          +++NLP NK KNR  NI  Y+ + V LQ     +  +YINA+++DGY +Q  YIATQGPLAE+  DFW+M+WE  STIIVML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  +K +R QR  MVQTE QY   Y   LE+
Sbjct: 1064 MELEFKLLANSKAHTSRFVSANLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEY 1323          

HSP 4 Score: 92.8189 bits (229), Expect = 4.440e-18
Identity = 39/82 (47.56%), Postives = 59/82 (71.95%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+S+ GV GSDYINA+YID Y K  AYI +Q P+  T+ DFWR+VW+Q  + +V++ ++EE  +V+
Sbjct:  803 KNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVK 884          

HSP 5 Score: 83.1889 bits (204), Expect = 3.085e-15
Identity = 88/375 (23.47%), Postives = 160/375 (42.67%), Query Frame = 2
Query:  803 ICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWK--SVEKINGILKKYILLWT--EHSDLPHQHWRQ--YDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKIN-KNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGK--SFTLIVYRTLPIIRSEFQIDEWKIYNFTR-----LKPSQKYQIRL 1885
            + W LP     ++  ++++ + ++ +   + F+           YTL+ L P T Y   + + + LG      +V+  T++ +P GPP  +    +++TAV V WK     K +G ++ Y + +   E+ +   Q   Q    A+++ + IS LTP   + IT+ A    G G  SKP  ++T +G +   P    S   + + +L+W+   P K L    L   + Y+    +  N I +   +   F +  + +    VF L A N+ G G   +  I +           + + G T+ T    W  P          L E+NG   ++T +VYR +       Q++   + N T      LKP   Y I++
Sbjct:   55 LSWLLPPQERIVKYELVYWAAEDEGQQHKVTFDPT-------SSYTLEDLKPDTLYHFQLAARSDLGVGVFTPTVEARTAQSMPSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKP-KVVTTTGAVPGRPTMMVSTTAMHTALLQWH---PPKELPGELLGYRLQYRRADEARPNTI-DFGKDDQHFTVTGLHKGATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQNLRVTGLTTSTTELTWDPP---------VLAERNGHITNYT-VVYRDI-----NSQLELQNVTNDTHLTLLGLKPDTTYDIKV 402          

HSP 6 Score: 72.0182 bits (175), Expect = 9.120e-12
Identity = 108/481 (22.45%), Postives = 192/481 (39.92%), Query Frame = 2
Query: 1244 LTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGM--PVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQS----VGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKL-----IYNEV-QIMPLNQILNSTDNTISFYKLPNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSI 2629
            L P   + + + A   VG GP S  + + T+ G  ++  +F+A+      I L W  P P + +  + L   + + +     ++K+    T+ ++ E  ++K DT   F L A + +G G+  P      +          V++    S  +   W+ P  + ++  ++ ++      +NG+       R  PII+ +  + E +    + L P   Y I +  +   G+    +       V+ T  A P      V    + T + L+ HP      +E+P   ++     Y L+YR    A  +T    I   K      +  L K G TY F LA           +K I  PE  PS  P  ++V  ++     L W  P +  RNG +     +Y ++   + L  + N T  T+   K P+  Y ++VR+ T    GP S   +     VE +  K  R    M T + + W +
Sbjct:    3 LLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQANAESDTRIQLSWLLP-PQERIVKYEL---VYWAAEDEGQQHKVTFDPTSSYTLE--DLKPDTLYHFQLAARSDLGVGVFTPTVEARTAQSMPSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEP------RGQPIIQ-DVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSK-----PKVVTTTGAVPGRPTMMVSTTAMHTAL-LQWHPP-----KELP--GELLG---YRLQYRRADEARPNT----IDFGKDDQHFTVTGLHK-GATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQNLRVTGLTTSTTELTWDPPVLAERNGHITNYTVVYRDINSQLELQNVTNDTHLTLLGLK-PDTTYDIKVRAHTSKGAGPLSPSIQSRTMPVEQVFAKNFRVAAAMKTSVLLSWEV 448          
BLAST of Tyrosine-protein phosphatase Lar-like vs. UniProt/SwissProt
Match: sp|F1NWE3|PTPRS_CHICK (Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3)

HSP 1 Score: 306.22 bits (783), Expect = 1.169e-103
Identity = 170/373 (45.58%), Postives = 234/373 (62.73%), Query Frame = 2
Query: 4067 ILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSS--------NVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHS---IVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            +L N  ++ +H     D V +  R NF   DS   S           + S   IP+ +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS   ++P++  +  D   YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ+S  IVM+ + EE    KC+ YWP +GT  Y  I+VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L + I+  +QI     ++G E+EF++L
Sbjct:  892 LLNNAEITPHHPK---DPVEMR-RINFQTPDSGLSSPLSDPEFDFESMLSHPPIPVSELAEHTEHLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILLPIEGIVGSD---YINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTKLEEKSRIKCDQYWPGRGTDTYGMIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIEVGEHVTGMELEFKRL 1255          

HSP 2 Score: 96.2857 bits (238), Expect = 1.169e-103
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1272 CNKFKNRLVNIMPYETTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLRE 1352          

HSP 3 Score: 206.068 bits (523), Expect = 6.853e-52
Identity = 118/314 (37.58%), Postives = 169/314 (53.82%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDY----LNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++  ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1199 MVQTEDQYSFIHDALLEA---VACGNTEVPARNLYTYIQKLAQIEVGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1507          

HSP 4 Score: 99.7525 bits (247), Expect = 2.019e-19
Identity = 71/265 (26.79%), Postives = 124/265 (46.79%), Query Frame = 2
Query:  824 NNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQF----SFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            N   +  +V+ Y+S+ Q      P++ I  D    + Y++  L P + Y IW++++NS+G+    +SV   T E  P   P ++    +S+T + ++W+   + NG ++ Y + +T   D P  +W++++   S  + +  L  +  + + + A  +VG GPLS P+ + T+ G   +   FRA      SIVL W+ P             EI  K  L   E          F    SF +  +K +TE VF L A + +G G
Sbjct:  346 NPDPVSYYVIEYKSKSQ----DGPYQ-IKEDITTTR-YSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQGRMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKTETSIVLSWSPP-----------RQEIIVKYELLFKEGDHGREVPRNFEPTTSFTVEGLKPNTEYVFRLAARSALGLG 593          

HSP 5 Score: 87.8113 bits (216), Expect = 9.145e-16
Identity = 38/82 (46.34%), Postives = 56/82 (68.29%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  + G+ GSDYINA+YID Y K  AYI +Q P+  T  DFWR+VW+Q  + IV++ K+EE  +++
Sbjct:  987 KNRYANVIAYDHSRVILLPIEGIVGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTKLEEKSRIK 1068          
BLAST of Tyrosine-protein phosphatase Lar-like vs. UniProt/SwissProt
Match: sp|B0V2N1|PTPRS_MOUSE (Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 2.840e-102
Identity = 155/324 (47.84%), Postives = 217/324 (66.98%), Query Frame = 2
Query: 4184 LKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            + S   IPI  +AE++  LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V LQ PL+     +YINANY+DGY +QN YIATQGPL ET  DFW+MVWEQ+S  +VM+ R EE    KC+ YWP +GT  Y  I+VTL+  +  A + +R F + +NG S KR+V   QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERIK ++TV++Y  +  +R QRN+MVQTE QYGFI++ LLE      +E+    L + I+  +Q+     ++G E+EF++L
Sbjct: 1326 MLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEANKPKNRYANVIAYDHSRVILQ-PLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVEPGEHVTGMELEFKRL 1646          

HSP 2 Score: 95.9005 bits (237), Expect = 2.840e-102
Identity = 46/103 (44.66%), Postives = 68/103 (66.02%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      ++ S  CN    KN   +++P++ +RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR +W+ N +I+V+L K+ E
Sbjct: 1649 SKAHTSRF------ITASLPCNK--FKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLRE 1743          

HSP 3 Score: 200.675 bits (509), Expect = 5.068e-50
Identity = 116/314 (36.94%), Postives = 164/314 (52.23%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F +   ++    V      +P   L  YI  L   +       M  EF+ L          I ++LP NK KNR  NI  Y+ S V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+ +WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F +   LE+
Sbjct: 1590 MVQTEDQYGFIHEALLEA---VGCGNTEVPARSLYTYIQKLAQVEPGEHVTGMELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEY 1898          

HSP 4 Score: 100.138 bits (248), Expect = 1.684e-19
Identity = 78/311 (25.08%), Postives = 145/311 (46.62%), Query Frame = 2
Query:  824 NNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSME-NKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSF---TIVARWRQPNKDAKNMTL 1741
            N   +  +V+ Y+S+ Q      P++ I  D    + Y++  L P + Y IW++++NS+G+    +SV   T E  P   P ++ A  +S T + V+W+   + NG+++ Y + +T   + P  +W++++   S  + +  L  +  + + + A  +VG GPLS P+ + T+ G   +    RA      SI L W+ P          +  E+ ++      E  +  + TT   +F + ++K +TE  F L A +  G G    ++     +AK +    D + CTS     I+  WR P  +  N  L
Sbjct:  343 NPDPVSYYVIEYKSKSQ----DGPYQ-IKEDITTTR-YSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAPRQESV-----IKYELLFREGDRGREVGRTFDPTT---AFVVEDLKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQAKPSAPPQD-VKCTSLRSTAILVSWRPPPPETHNGAL 638          

HSP 5 Score: 86.6557 bits (213), Expect = 2.032e-15
Identity = 34/82 (41.46%), Postives = 56/82 (68.29%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  + G+ GSDYINA+Y+D Y +  AYI +Q P+  T  DFWR+VW+Q  + +V++ ++EE  +++
Sbjct: 1378 KNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIK 1459          

HSP 6 Score: 64.3142 bits (155), Expect = 1.541e-8
Identity = 45/181 (24.86%), Postives = 75/181 (41.44%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVE------KINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEIS 1465
            L+ L  +T YR+   +   +G       V   T ED+P  PP  + A A++ TA+ V W+S        +I G    Y+ +    +  P +      A ++  +I++L P   + IT+ A    G G  SKP  ++TK G +   P     +    S++  W  P         G  L+  
Sbjct:  670 LEALEKWTEYRVTAVAYTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDIMLADAQEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTK-GAVLGRPTLSVQQTPEGSLLARWEPPADAAEDPVLGYRLQFG 849          
BLAST of Tyrosine-protein phosphatase Lar-like vs. UniProt/SwissProt
Match: sp|A2A8L5|PTPRF_MOUSE (Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 4.340e-102
Identity = 153/323 (47.37%), Postives = 211/323 (65.33%), Query Frame = 2
Query: 4184 LKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            ++    IPI  LA+ I  LK+ D L   QE+E ++    ++++  NSN   NK KNRYAN+ AYDHS V L +       +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ++  +VM+ R EE    KC+ YWP +GT  Y  I+VTLV  +  A YT+R F + ++G S KR++ Q QF  WPD G+P    P L+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ER+KH++TV+IY  +  +R QRN+MVQTE QY FI++ LLE     ++E++   L + I+   Q+    S++  E+EF+ L
Sbjct: 1317 MRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPG--QQFTWENSNSEVNKPKNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPVRGTETYGLIQVTLVDTVELATYTMRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAAMCGHTEVLARNLYAHIQKLGQVPPGESVTAMELEFKLL 1637          

HSP 2 Score: 95.9005 bits (237), Expect = 4.340e-102
Identity = 46/103 (44.66%), Postives = 68/103 (66.02%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      VS +  CN    KN   +++P++  RV L  + GV+GSDYINAS++D Y + KAYI +Q P+A + EDFWR++W+ N +IIV+L K+ E
Sbjct: 1640 SKAHTSRF------VSANLPCNK--FKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLRE 1734          

HSP 3 Score: 196.823 bits (499), Expect = 6.950e-49
Identity = 105/262 (40.08%), Postives = 149/262 (56.87%), Query Frame = 2
Query: 4262 MMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            M  EF+ L          +++NLP NK KNR  NI  Y+ + V LQ     +  +YINA+++DGY +Q  YIATQGPLAE+  DFW+M+WE  STIIVML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  +K +R QR  MVQTE QY   Y   LE+
Sbjct: 1630 MELEFKLLANSKAHTSRFVSANLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEY 1889          

HSP 4 Score: 92.4337 bits (228), Expect = 3.595e-17
Identity = 39/82 (47.56%), Postives = 59/82 (71.95%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+S+ GV GSDYINA+YID Y K  AYI +Q P+  T+ DFWR+VW+Q  + +V++ ++EE  +V+
Sbjct: 1369 KNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVK 1450          

HSP 5 Score: 91.6633 bits (226), Expect = 7.737e-17
Identity = 66/283 (23.32%), Postives = 131/283 (46.29%), Query Frame = 2
Query:  893 PFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSE-SSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGM--PVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKN 1732
            PF+++  D      Y++  L PF+ Y   + ++NS+G+    ++V+  T E  P  PP  + A  +S + + V+W+  E+ NG+++ Y + +T  S  P   W +++  +   + +  L P   + + + A   VG GP S  + + T+ G  ++  +F+A+      I L W  P P + +  + L   + + +     ++K+    T+ ++ E  ++K DT   F L A + +G G+  P      +          V  +   S T+   W  P  D++N
Sbjct:  362 PFQEV--DGVASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQANAESDTRIQLSWLLP-PQERIVKYEL---VYWAAEDEGQQHKVTFDPTSSYTLE--DLKPDTLYHFQLAARSDLGVGVFTPTVEARTAQSTPSAPPQKVTCVSTGSTTVRVSWVPPPADSRN 636          

HSP 6 Score: 88.5817 bits (218), Expect = 6.624e-16
Identity = 91/367 (24.80%), Postives = 156/367 (42.51%), Query Frame = 2
Query:  827 NLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWK--SVEKINGILKKYILLWT--EHSDLPHQHWRQ--YDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKIN-KNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGK--SFTLIVYRTLPIIRSEFQIDEWKIYNFTR-----LKPSQKYQIRL 1885
            N  I Q+ + YE+ +  +      + I  + + W    L+K   +T YR+W+ +   +G       V   T ED+P GPP  +    +++TAV V WK     K +G ++ Y + +   E+ +   Q   Q    A+++ + IS LTP   + IT+ A    G G  SKP  ++T +G +   P    S   + + +L+W+   P K L    L   + Y+    +  N I +   +   F +  + +    VF L A N+ G G   +  I +           + + G T+ T    W  P          L E+NG   ++T +VYR +       Q++   + N T      LKP   Y I++
Sbjct:  636 NGIITQYSVAYEAVDGEDRKRHVVDGISREHSSWDLLGLEK---WTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKP-KVVTTTGAVPGRPTMMVSTTAMHTALLQWH---PPKELPGELLGYRLQYRRADEARPNTI-DFGKDDQHFTVTGLHKGATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQNLRVTGLTTSTTELTWDPP---------VLAERNGHITNYT-VVYRDI-----NSQLELQNVTNDTHLTLLGLKPDTTYDIKV 979          

HSP 7 Score: 83.1889 bits (204), Expect = 2.294e-14
Identity = 130/595 (21.85%), Postives = 241/595 (40.50%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRW--KSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENK----IVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNV-------VDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQS----VGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKL-----IYNEV-QIMPLNQILNSTDNTISFYKLPNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSI 2629
            T+  L P  TY + + +  ++G      +++  T + +P   P    A+A S+T +++ W     E+I     KY L++    D   QH   +D  S  +L   L P+ +++  + A +++G G  +  V   T   T S  P+          ++ + W  P P  + N       ++Y++     E++    +  I+    S+++  +++ TE    +RA   VG G     ++V     + +++V       V++    S  +   W+ P  + ++  ++ ++      +NG+       R  PII+ +  + E +    + L P   Y I +  +   G+    +       V+ T  A P      V    + T + L+ HP      +E+P   ++     Y L+YR    A  +T    I   K      +  L K G TY F LA           +K I  PE  PS  P  ++V  ++     L W  P +  RNG +     +Y ++   + L  + N T  T+   K P+  Y ++VR+ T    GP S   +     VE +  K  R    M T + + W +
Sbjct:  474 TVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVP-AQPADFQANAESDTRIQLSWLLPPQERI----VKYELVYWAAEDEGQQHKVTFDPTSSYTL-EDLKPDTLYHFQLAARSDLGVGVFTPTVEARTAQSTPSAPPQKVTCVSTGSTTVRVSWVPP-PADSRNGIITQYSVAYEA--VDGEDRKRHVVDGISREHSSWDLLGLEKWTEYRVWVRAHTDVGPGPESSPVLV-----RTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEP------RGQPIIQ-DVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSK-----PKVVTTTGAVPGRPTMMVSTTAMHTAL-LQWHPP-----KELP--GELLG---YRLQYRRADEARPNT----IDFGKDDQHFTVTGLHK-GATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQNLRVTGLTTSTTELTWDPPVLAERNGHITNYTVVYRDINSQLELQNVTNDTHLTLLGLK-PDTTYDIKVRAHTSKGAGPLSPSIQSRTMPVEQVFAKNFRVAAAMKTSVLLSWEV 1025          
BLAST of Tyrosine-protein phosphatase Lar-like vs. UniProt/SwissProt
Match: sp|Q13332|PTPRS_HUMAN (Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3)

HSP 1 Score: 300.056 bits (767), Expect = 5.804e-102
Identity = 166/370 (44.86%), Postives = 228/370 (61.62%), Query Frame = 2
Query: 4067 ILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSS--------NVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            +L N  ++ +H     D V +  R NF   DS   S           + S   IPI  +AE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V LQ        +YINANY+DGY  QN YIATQGPL ET  DFW+MVWEQ+S  IVM+ R EE    KC+ YWP +GT  Y  I+VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ERIK ++TV++Y  +  +R QRN+MVQTE QY FI++ LLE      +E+    L + I+  +Q+     ++G E+EF++L
Sbjct: 1324 LLNNADLAPHHPK---DPVEMR-RINFQTPDSGLRSPLREPGFHFESMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFKRL 1687          

HSP 2 Score: 96.6709 bits (239), Expect = 5.804e-102
Identity = 46/103 (44.66%), Postives = 68/103 (66.02%), Query Frame = 1
Query: 5143 SKAQSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            SKA +S +      +S +  CN    KN   +++P++  RV L  + GV+GSDYINAS+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1690 SKAHTSRF------ISANLPCNK--FKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1784          

HSP 3 Score: 205.682 bits (522), Expect = 1.557e-51
Identity = 118/314 (37.58%), Postives = 168/314 (53.50%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F +   ++    V      +P   L  YI  L   +       M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1631 MVQTEDQYSFIHEALLEA---VGCGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1939          

HSP 4 Score: 100.523 bits (249), Expect = 1.294e-19
Identity = 77/310 (24.84%), Postives = 141/310 (45.48%), Query Frame = 2
Query:  824 NNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSME-NKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGM--PVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTL 1741
            N   +  +V+ Y+S+ Q      P++ I  D    + Y++  L P + Y IW++++NS+G+    +SV   T E  P   P ++ A  +S T + V+W+   + NG+++ Y + +T   + P  +W++++   S  + +  L  +  + + + A  +VG GPLS P+ + T+ G   +    RA      SI L W+ P          +  E+ ++   +  E  +  + TT   S+ + ++K +TE  F L A +  G G   PV        K       V  +   S  I+  WR P  +  N  L
Sbjct:  356 NPDPVSYYVIEYKSKSQ----DGPYQ-IKEDITTTR-YSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSPPRQESI-----IKYELLFREGDHGREVGRTFDPTT---SYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGAL 651          

HSP 5 Score: 85.8853 bits (211), Expect = 4.432e-15
Identity = 136/613 (22.19%), Postives = 245/613 (39.97%), Query Frame = 2
Query:  965 TYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYS--MENKIVN---ITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGK----AKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYRTLPIIR------SEFQIDEWKIYNF--TRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSI--------YTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIY-MSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNS------------TDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNR-MPYVFSKNLL 2677
            TY + + +  S+G   +   ++  T + +P G P ++ A A S T++ + W    + + I  KY LL+ E  D   +  R +D  + S ++  L PN  +   + A +  G G  +  V   T     S  P+  +   +   +I++ W  P P +T N   +   + Y+ PL S   E K VN    TT Q   E   +++ T+   T  A  +VG G     ++V   +    A   K   + +  T+  ++  WR P    ++  ++ ++ +         R  P I+      ++++ D+   Y    T L+P   Y I +  + + G+    +       V+ TK A    +G   L      +G  +++A WE         ++    L YR+ F  E ST   ++        YT    H          G TY F LA            +++++PE  P   P +++     S   V L+W  P    RNG ++   V +     +  +             +N ++   L P+  Y L+VR+ TR   GP+S    +  +  + + PK  +   +M T + + W    + N   PY    N L
Sbjct:  496 TYTVRVLAFTSVGDGPLSDPIQVKTQQGVP-GQPMNLRAEARSETSITLSWSPPRQESII--KYELLFRE-GDHGREVGRTFDPTT-SYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPP-PPETHNGALVGYSVRYR-PLGSEDPEPKEVNGIPPTTTQILLEA--LEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVL--WRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSK-----PKVVVTKGA---VLGRPTLSVQQTPEG--SLLARWEP-----PAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVH---------KGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGPFSPPVRYRTFLRDQVSPKNFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGL 1073          

HSP 6 Score: 84.7297 bits (208), Expect = 7.856e-15
Identity = 35/82 (42.68%), Postives = 55/82 (67.07%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  + G+ GSDYINA+Y+D Y    AYI +Q P+  T  DFWR+VW+Q  + IV++ ++EE  +++
Sbjct: 1419 KNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIK 1500          

HSP 7 Score: 78.9518 bits (193), Expect = 4.859e-13
Identity = 65/286 (22.73%), Postives = 116/286 (40.56%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVE------KINGILKKYILLWTEHSDLPHQ---------HWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYK--SPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG-MPVKLLIVSAGKAKINKNVVDIIG-CTSFTIVARWRQPNKDAKNMTL 1741
            L+ L  +T YRI   +   +G       V   T ED+P  PP  + A A++ TA+ V W+S        +I G    Y+ +    +  P +          W   D      +I++L P   + IT+ A    G G  SKP  ++TK G +   P     +    S++  W  P  T      G  L+   +  +PL ++E        ++  +    V +    VF L A ++ G G    ++L +     + +  +++  G  ++ T++ RW  P    +N  +
Sbjct:  683 LEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTK-GAVLGRPTLSVQQTPEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLE-----FPPSEDRYTASGVHKGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNGAI 962          
BLAST of Tyrosine-protein phosphatase Lar-like vs. UniProt/SwissProt
Match: sp|A7MBJ4|PTPRF_BOVIN (Receptor-type tyrosine-protein phosphatase F OS=Bos taurus OX=9913 GN=PTPRF PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 7.027e-102
Identity = 156/349 (44.70%), Postives = 221/349 (63.32%), Query Frame = 2
Query: 4121 VNVSDRFNFFNNDSVQV-----SSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            + + D     ++D V++      +  ++    IPI  LA+ I  LK+ D L   QE+E ++    ++++  NSNL  NK KNRYAN+ AYDHS V L +       +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ++  +VM+ R EE    KC+ YWP +GT  Y  I+VTL+  +  A YT+R F + ++G S KR++ Q QF  WPD G+P    P L+FL+  K  +  D+GP +VHCSAGVGRTG FIV+D+ +ER+KH++TV+IY  +  +R QRN+MVQTE QY FI++ LLE     ++E+    L + I+   Q+    S++  E+EF+ L
Sbjct: 1291 IGLKDSLLAHSSDPVEMRRLNYQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPG--QQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETYGLIQVTLLDTVELATYTVRTFALYKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRAQRNYMVQTEDQYVFIHEALLEAAMCGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLL 1637          

HSP 2 Score: 94.3597 bits (233), Expect = 7.027e-102
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + GV+GSDYINAS++D Y + KAYI +Q P+A + EDFWR++W+ N +IIV+L ++ E
Sbjct: 1654 CNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTRLRE 1734          

HSP 3 Score: 199.134 bits (505), Expect = 1.490e-49
Identity = 114/314 (36.31%), Postives = 166/314 (52.87%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDL----KSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D++ F +   ++ +   +     +P   L  +I  L           M  EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA+++DGY +Q  YIATQGPLAE+  DFW+M+WE  STIIVML R  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  +K +R QR  MVQTE QY   Y   LE+
Sbjct: 1581 MVQTEDQYVFIHEALLEAA---MCGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLANSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTRLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQ--DGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEY 1889          

HSP 4 Score: 92.8189 bits (229), Expect = 3.447e-17
Identity = 39/82 (47.56%), Postives = 59/82 (71.95%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+S+ GV GSDYINA+YID Y K  AYI +Q P+  T+ DFWR+VW+Q  + +V++ ++EE  +V+
Sbjct: 1369 KNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVK 1450          

HSP 5 Score: 91.6633 bits (226), Expect = 6.993e-17
Identity = 66/283 (23.32%), Postives = 131/283 (46.29%), Query Frame = 2
Query:  893 PFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSE-SSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGM--PVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKN 1732
            PF+++  D      Y++  L PF+ Y   + ++NS+G+    ++V+  T E  P  PP  + A  +S + + V+W+  E+ NG+++ Y + +T  S  P   W +++  +   + +  L P   + + + A   VG GP S  + + T+ G  ++  +F+A       I L W  P P + +  + L   + + +     ++K+    T+  S+ + ++K DT   F L A +++G G+  P      +          V  +   S T+   W  P  D++N
Sbjct:  362 PFQEV--DGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVDSDTRIQLSWLLP-PQERIVKYEL---VYWAAEDEGQQHKVTFDPTS--SYTVEDLKPDTLYRFQLAARSELGVGVFTPTIEARTAQSTPSAPPQKVTCVSVGSTTVRVSWVPPPADSRN 636          

HSP 6 Score: 89.7373 bits (221), Expect = 2.646e-16
Identity = 87/362 (24.03%), Postives = 153/362 (42.27%), Query Frame = 2
Query:  827 NLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWK--SVEKINGILKKYILLWTE-HSDLPHQHWRQYD---AKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKIN-KNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGK--SFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            N  I Q+ + YE+ +  +      + I  + + W    L+K   +T YR+W+ +   +G       V   T ED+P GPP  +    +++TAV V WK     K +G ++ Y + +    +  P       D   A+++ + IS LTP   + IT+ A    G G  SKP  I+T +G +   P    S   + + +L+W+   P K L    L   + Y+    +  + I +   +   F +  + +    +F L A N+ G G   +  I +           + +IG T+ T    W  P          L E+NG+  ++T +VYR +   +    +        + LKP   Y I++
Sbjct:  636 NGVITQYSVAYEAVDGEDRGRHVVDGIGREHSSWDLVGLEK---WTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPLNSTAVRVSWKLPVPSKQHGQIRGYQVTYVRLENGEPRGAPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKP-KIVTTTGAVPGRPTMMVSTTAMNTALLQWH---PPKELPGELLGYRLQYRRADEARPSTI-DFGKDDQHFTVTGLHKGATYIFRLTAKNRAGLGEEFEKEITTPEDVPSGFPQNLRVIGLTTSTTELIWDPP---------VLAERNGRITNYT-VVYRDINSQQELQNVTADTHLTLSGLKPDTTYDIKV 979          

HSP 7 Score: 79.337 bits (194), Expect = 3.630e-13
Identity = 128/594 (21.55%), Postives = 235/594 (39.56%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRW--KSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENK----IVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNV-------VDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVN---LKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKL-----IYNEV-QIMPLNQILNSTDNTISFYKLPNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSI 2629
            T+  L P  TY + + +  ++G      +++  T + +P   P    A   S+T +++ W     E+I     KY L++    D   QH   +D  S S  +  L P+ ++   + A + +G G  +  +   T   T S  P+      +   ++ + W  P P  + N       ++Y++     E++    +  I     S+++  +++ TE    +RA   VG G     ++V     + +++V       V++    S  +   W+ P    ++  ++ ++      +NG+       R  PII+ +  + E +    + L P   Y I +  +   G+    +       ++ T  A P         T +N   L+ HP      +E+P   ++     Y L+YR    A  ST    I   K      +  L K G TY F L            +K I  PE  PS  P  ++VI ++     L W  P +  RNG++     +Y ++     L  +   T  T+S  K P+  Y ++VR+ T    GP S   +     VE +  K  R    M T + + W +
Sbjct:  474 TVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVP-AQPADFQAEVDSDTRIQLSWLLPPQERI----VKYELVYWAAEDEGQQHKVTFDPTS-SYTVEDLKPDTLYRFQLAARSELGVGVFTPTIEARTAQSTPSAPPQKVTCVSVGSTTVRVSWVPP-PADSRNGVITQYSVAYEA--VDGEDRGRHVVDGIGREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLV-----RTDEDVPSGPPRKVEVEPLNSTAVRVSWKLPVPSKQHGQIRGYQVTYVRLENGEP------RGAPIIQ-DVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSK-----PKIVTTTGAVPGRPTMMVSTTAMNTALLQWHPP-----KELP--GELLG---YRLQYRRADEARPST----IDFGKDDQHFTVTGLHK-GATYIFRLTAKNRAGLGEEFEKEITTPEDVPSGFPQNLRVIGLTTSTTELIWDPPVLAERNGRITNYTVVYRDINSQQELQNVTADTHLTLSGLK-PDTTYDIKVRARTSKGAGPLSPSIQSRTMPVEQVFAKNFRVEAAMKTSVLLSWEV 1025          

HSP 8 Score: 55.0694 bits (131), Expect = 8.695e-6
Identity = 64/317 (20.19%), Postives = 129/317 (40.69%), Query Frame = 2
Query:  803 ICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRW--KSVEKINGILKKYILLWTEHSDLPHQHWRQYD--AKSESSL-ISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECP-EFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFE-----IHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNK 1720
            + W LP     ++  ++++ + ++ +   + F+           YT++ L P T YR  + + + LG      +++  T++  P  PP  +T  ++ +T V V W     +  NG++ +Y + + E  D   +     D   +  SS  +  L     + + ++A  +VG GP S PV + T     S  P +     +   ++ + W  P P+K         +++Y   L + E +   I  +    E     I  +  +T    T+ A+   G G   K  IV+   A   +  + +      T + +W  P +
Sbjct:  530 LSWLLPPQERIVKYELVYWAAEDEGQQHKVTFDPT-------SSYTVEDLKPDTLYRFQLAARSELGVGVFTPTIEARTAQSTPSAPPQKVTCVSVGSTTVRVSWVPPPADSRNGVITQYSVAY-EAVDGEDRGRHVVDGIGREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPLNSTAVRVSWKLPVPSKQHGQI-RGYQVTYVR-LENGEPRGAPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKPKIVTTTGAVPGRPTMMVSTTAMNTALLQWHPPKE 836          
BLAST of Tyrosine-protein phosphatase Lar-like vs. TrEMBL
Match: A0A1S3HQ46 (receptor-type tyrosine-protein phosphatase delta isoform X4 OS=Lingula unguis OX=7574 GN=LOC106157176 PE=4 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 3.320e-103
Identity = 171/350 (48.86%), Postives = 228/350 (65.14%), Query Frame = 2
Query: 4190 SRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            S   IP+++LAE+I+ LK+ D L   QE+E +  E  ++++  NSNL  NK KNRYAN+ AYDHS V LQ PLD     +YINANY+DGY KQN YIATQGPL ET  DFW+MVWEQ+S  IVM+ + EE    KC+ YWP +GT  Y  ++VT++  +  A YTIR FQ+ + G+  KR+V Q QFT WPD G+P    P L F++  K  +  DSGP I HCSAGVGRTG FIV+D+ +ERI+H+RTV+IY  +  +R QRN+MVQTE QY FI+D LLE      +EI    L + ++  +Q     +++G E+EF++L        +N SR +  N  VNK K  L
Sbjct: 1338 SHPPIPVEQLAEHIDRLKAQDNLKFSQEYESI--EPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQ-PLDAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIKCDQYWPLRGTENYGVMQVTILDIMDLATYTIRTFQLSRQGYPEKREVKQFQFTAWPDHGVPDHPTPLLMFMRRVKASTPPDSGPMITHCSAGVGRTGAFIVIDAMLERIRHERTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEIPARNLYAHLQKLTQPEPGETVTGMELEFKRL----AHTKANPSRFVSANLPVNKFKNRL 1680          

HSP 2 Score: 91.6633 bits (226), Expect = 3.320e-103
Identity = 40/77 (51.95%), Postives = 54/77 (70.13%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   +++P++  RV L  + GVDGSDYINASYID Y    AYI +Q P+  T EDFWR++W+ N +IIV+L K+ E
Sbjct: 1677 KNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLRE 1753          

HSP 3 Score: 200.29 bits (508), Expect = 1.643e-47
Identity = 107/263 (40.68%), Postives = 149/263 (56.65%), Query Frame = 2
Query: 4259 NMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
             M  EF+ L          +++NLP NK KNR  NI  Y+++ V LQ     D  +YINA+YIDGY  +  YIATQGPL ET  DFW+M+WE  STIIVML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  ++ +R QR  MVQTE QY F Y   LE+
Sbjct: 1648 GMELEFKRLAHTKANPSRFVSANLPVNKFKNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFIALSIVLERMRYEGVVDLFQTVRMLRTQRPAMVQTEDQYQFCYRAALEY 1908          

HSP 4 Score: 87.8113 bits (216), Expect = 3.402e-13
Identity = 186/863 (21.55%), Postives = 339/863 (39.28%), Query Frame = 2
Query:  149 VLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMGTDSQTTKIRVFKHEMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKV-YWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVT--------------GHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLP-FNNLTIEQFVLHYESREQIESVS-IPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKI-LLKSIVLEWNDPDPTKTLNCFGLNLEISY---KSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG---MPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLF-----EKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNL--KGHPNVMAEWEEIPIFDKVFSS-AIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTDNTISFYKLP------NKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEW 2623
            V+ G  + I+C++ G+P+P ++W +    +  +  +                     + K+ LI K V    N    TC + + +G     T+++V     ++  P V LE S       E +A ++K  +    N  +  +  NY+    P+Y+    + V   SI  I+ + E T    V+              G       K           P  NV     ++++  + W  P   N  I  + ++Y  +E+ E+++  P+    N     +   ++ L P  TY + +    S+G     + V+  T + +P+ P  ++         + V W+  E  + I+  Y L +   S    +   Q     ES L+  L P  ++ I + A +  G GP S  V   T+  T S  P+    +I    +I+++W+ P P    N      +I Y   +S     E  +V +   + S  I N+K  T+    ++A  +VG G   +P+ +    A   +  +  V+ +  T+  +  RW  P  D +N  ++ +     + +  S  LI  R    I S  Q+ E  I   T L+P   Y+ ++   V G+ + I   +    + +T  A P+   +F     VNL  +  P V   W+       ++ +   Y L+Y  +     S K+ +I      +   +  L + G  YEF L+    V       + I  P+  P   P    +   +     L WK P     NG++I  E++       +NS    +S  +        N+VY  ++++ T    GPWS  ++F  Y      P  I+  R   + I+V W
Sbjct:  261 VMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADA--------------------PLGKNVLILKDVQQSAN---YTCFAASDLGNIEAITQVKV----KALPNPPVHLEIS-------EVTATSVKLSWDEGNNDPIDSYIINYK----PKYK----QGVESKSISGIV-ETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLAERPYYTWQNMAVTDKVANIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQP-RNLQTEVRGPDQIYVTWEKPENSDDIITSYELYYQSPSRGKVRVTIQ--PPVESYLLEDLIPATVYNIHVLAKSERGTGPESPVVQATTQEFTPSAPPQDVTGEIEGATAIIIKWSPP-PLNARNGQITEYKIRYVETESGQQLQEASVVTVLGEKDSVVIRNLKIWTKYTIWVQAATRVGPGPNSVPIVVRTDEAVPGRPERVRVETVNSTAIRV--RWSSPAPDKRNGIIRAYVVIYGKIDISSMQLIGSRKRHTI-SGGQVTETVI---TGLQPDSSYKFQVA-AVTGKGDGI---YSKGKIAKTLGAVPERPRSFR----VNLINEDPPMVQLVWQRP---RNIYGALQAYKLEYGKVG----SDKFETIALEAEQYQRTVTSLDR-GAEYEFRLSARNTVDYGEKAVQNIKTPDSVPYGYPMNFTMSAKTSTVAQLSWKPPPADQCNGRIIMYEIEYYKKLDDINSFSLNVSQMETEVSGLETNEVYLFQIKAYTSKGPGPWSPKYQFKTYKQLPAAPTNIKLRRTSHSTIQVTW 1054          

HSP 5 Score: 85.1149 bits (209), Expect = 2.169e-12
Identity = 185/904 (20.46%), Postives = 349/904 (38.61%), Query Frame = 2
Query:  107 SEKPRIIFISDNNKVLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMG-TDSQTTKIRVFKHEMSV--NFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQ----CYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVK-------------FNTSE-------------DLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSL------ISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPD-PTK---------TLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKL--LIVSAGKAKINKNV-VDIIGCTSFTIVARWRQP-NKDAKNMTLQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIE--TKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYT---NKSSHVIQLLEL-PKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNG-----KLIYNEVQIMPLNQILNSTDNTISFYKL---------PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRV 2596
            + +P II    + K   G  +   C ++GNP PDI+W           + N   +   + RYL  +        S L  + V    ++ + TC + N +G   S   ++ V+ ++M +    P + ++ + KS  K  +  A+++C    +   ++YW ++Y  ++  +  IT+ +S    +I N  + D+G Y C     +G                                + +    N        L+   R      SI   ++L+   G      C  +    P   +++ +  L  +  + +GK+V              F  S+              LP  PP  +  S ++ T+V++ W   E  N  +  YI+ +        ++ +  ++KS S +      I+ L    I+   + AVNN+G+G  S+P    T     S  P   RA  +   ++ ++W++P+ P           TL   G NL    + P Y+ +N  V   T++ +  I N+  +   V  +     VG G P +   ++   G  +  +N+  ++ G     I   W +P N D    + +L+ ++     + V    P+          + Y    L P+  Y I +  L   E     ES  +    +  T  A PQ V      TG  ++G   ++ +W   P+  +      Y ++Y +   +    +  S+ T    K S VI+ L++  KY +  +    R G      SV  ++   E  P   P  ++V  ++   + ++W +P    RNG      +IY ++ I  +  I +   +TIS  ++         P+  Y+ +V + T    G +SK     +       P+  R+FRV
Sbjct:   47 THEPSIIQSPQSKKAPNGGIVSFFCKASGNPAPDIKW-----------QKNGNDLGTSKQRYLVFDMPF----GSVLRIEPVRQRRDDAMFTCTATNGVGEAASAQAQLTVYPNDMEMPRTAPKIVVQPNLKSVEK--DRPASMQCATEGTPPPRIYWLKDYIPVDISDPRITVSES-GTLNIMNSRKSDQGKYECVAENEAG--------------------------------VAYSYAAN--------LYVRVRNVAPRFSIQPPEMLDVMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADAPLGKNVLILKDVQQSANYTCFAASDLGNIEAITQVKVKALPN-PPVHLEISEVTATSVKLSWD--EGNNDPIDSYIINYKP------KYKQGVESKSISGIVETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLA---ERPYYTWQNMAV---TDKVA-NIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQPRNLQTEVRGPDQ--IYVTWEKPENSDDIITSYELYYQSPSRGKVRVTIQPPV----------ESYLLEDLIPATVYNIHV--LAKSERGTGPESPVVQATTQEFTPSAPPQDV------TG-EIEGATAIIIKWSPPPLNARNGQITEYKIRY-VETESGQQLQEASVVTVLGEKDSVVIRNLKIWTKYTIWVQ-AATRVGPGPN--SVPIVVRTDEAVPGR-PERVRVETVNSTAIRVRWSSPAPDKRNGIIRAYVVIYGKIDISSMQLIGSRKRHTISGGQVTETVITGLQPDSSYKFQVAAVTGKGDGIYSK---GKIAKTLGAVPERPRSFRV 847          

HSP 6 Score: 84.7297 bits (208), Expect = 2.399e-12
Identity = 36/82 (43.90%), Postives = 55/82 (67.07%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  +  + GSDYINA+Y+D Y K  AYI +Q P+  T  DFWR+VW+Q  + IV++ K+EE  +++
Sbjct: 1388 KNRYANVIAYDHSRVILQPLDAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIK 1469          
BLAST of Tyrosine-protein phosphatase Lar-like vs. TrEMBL
Match: A0A1S3HQ62 (receptor-type tyrosine-protein phosphatase F isoform X3 OS=Lingula unguis OX=7574 GN=LOC106157176 PE=4 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 5.377e-103
Identity = 170/346 (49.13%), Postives = 227/346 (65.61%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            IP+++LAE+I+ LK+ D L   QE+E +  E  ++++  NSNL  NK KNRYAN+ AYDHS V LQ PLD     +YINANY+DGY KQN YIATQGPL ET  DFW+MVWEQ+S  IVM+ + EE    KC+ YWP +GT  Y  ++VT++  +  A YTIR FQ+ + G+  KR+V Q QFT WPD G+P    P L F++  K  +  DSGP I HCSAGVGRTG FIV+D+ +ERI+H+RTV+IY  +  +R QRN+MVQTE QY FI+D LLE      +EI    L + ++  +Q     +++G E+EF++L        +N SR +  N  VNK K  L
Sbjct: 1344 IPVEQLAEHIDRLKAQDNLKFSQEYESI--EPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQ-PLDAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIKCDQYWPLRGTENYGVMQVTILDIMDLATYTIRTFQLSRQGYPEKREVKQFQFTAWPDHGVPDHPTPLLMFMRRVKASTPPDSGPMITHCSAGVGRTGAFIVIDAMLERIRHERTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEIPARNLYAHLQKLTQPEPGETVTGMELEFKRL----AHTKANPSRFVSANLPVNKFKNRL 1682          

HSP 2 Score: 91.6633 bits (226), Expect = 5.377e-103
Identity = 40/77 (51.95%), Postives = 54/77 (70.13%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   +++P++  RV L  + GVDGSDYINASYID Y    AYI +Q P+  T EDFWR++W+ N +IIV+L K+ E
Sbjct: 1679 KNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLRE 1755          

HSP 3 Score: 199.904 bits (507), Expect = 2.510e-47
Identity = 107/263 (40.68%), Postives = 149/263 (56.65%), Query Frame = 2
Query: 4259 NMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
             M  EF+ L          +++NLP NK KNR  NI  Y+++ V LQ     D  +YINA+YIDGY  +  YIATQGPL ET  DFW+M+WE  STIIVML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  ++ +R QR  MVQTE QY F Y   LE+
Sbjct: 1650 GMELEFKRLAHTKANPSRFVSANLPVNKFKNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFIALSIVLERMRYEGVVDLFQTVRMLRTQRPAMVQTEDQYQFCYRAALEY 1910          

HSP 4 Score: 95.5153 bits (236), Expect = 1.302e-15
Identity = 114/582 (19.59%), Postives = 224/582 (38.49%), Query Frame = 2
Query:  107 SEKPRIIFISDNNKVLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMG-TDSQTTKIRVFKH--EMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQ----CYTLKKLHPFTTYRIWINSLNSLGKSQVGKSV------------KFNTSEDL-------------PQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWT---EHSDL---PHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIG--CTSFTIVARWRQPNKDAKN 1732
            + +P II    + K   G  +   C ++GNP PDI+W           + N   +   + RYL  +        S L  + V    ++ + TC + N +G   S   ++ V+ +  EM    P + ++ + KS  K  +  A+++C    +   ++YW ++Y  ++  +  IT+ +S    +I N  + D+G Y C     +G                                + +    N        L+   R      SI   ++L+   G      C  +    P   +++ +  L  +  + +GK+V                + DL             P  PP ++ A  +S + + V+W   E  NG++  Y + +T   E  +L   P+  W+      + + I +L+PNR + + +    +VG GP S+ V +LT+ G   +    +        I + W  P+ +  +     + E+ Y+SP  S     V I     S+ + ++   T     + A ++ G G    ++  +  +   +    D+ G    +  I+ +W  P  +A+N
Sbjct:   47 THEPSIIQSPQSKKAPNGGIVSFFCKASGNPAPDIKW-----------QKNGNDLGTSKQRYLVFDMPF----GSVLRIEPVRQRRDDAMFTCTATNGVGEAASAQAQLTVYPNDMEMPRTAPKIVVQPNLKSVEK--DRPASMQCATEGTPPPRIYWLKDYIPVDISDPRITVSES-GTLNIMNSRKSDQGKYECVAENEAG--------------------------------VAYSYAAN--------LYVRVRNVAPRFSIQPPEMLDVMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADAPLGKNVLILKDVQQSANYTCFAASDLGNIEAITQVKVKEPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLAERPYYTWQNMAVTDKVANIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQPRNLQTEVRGPDQIYVTWEKPENSDDIIT---SYELYYQSP--SRGKVRVTIQPPVESYLLEDLIPATVYNIHVLAKSERGTGPESPVVQATTQEFTPSAPPQDVTGEIEGATAIIIKWSPPPLNARN 565          

HSP 5 Score: 94.3597 bits (233), Expect = 2.849e-15
Identity = 207/935 (22.14%), Postives = 369/935 (39.47%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKI-LLKSIVLEWNDPDPTKTLNCFGLNLEISY---KSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG---MPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLF-----EKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNL--KGHPNVMAEWEEIPIFDKVFSS-AIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTDNTISFYKLP------NKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSVPENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLN-SILVTYSGRIIFWSPLNPESVEFVSEKEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNSKFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSHEFSLIELKTNAKQNKLILPILALSRKPIQLFGNQ-PHYDFLFTYNFTKPNKMDRFSDGNFYRSALRACVETDEGHFLCNTSDWSESFQI 3676
            ++ L P  TY + +    S+G     + V+  T + +P+ P  ++         + V W+  E  + I+  Y L +   S    +   Q     ES L+  L P  ++ I + A +  G GP S  V   T+  T S  P+    +I    +I+++W+ P P    N      +I Y   +S     E  +V +   + S  I N+K  T+    ++A  +VG G   +P+ +    A   +  +  V+ +  T+  +  RW  P  D +N  ++ +     + +  S  LI  R    I S  Q+ E  I   T L+P   Y+ ++   V G+ + I   +    + +T  A P+   +F     VNL  +  P V   W+       ++ +   Y L+Y  +     S K+ +I      +   +  L + G  YEF L+    V       + I  P+  P   P    +   +     L WK P     NG++I  E++       +NS    +S  +        N+VY  ++++ T    GPWS  ++F  Y      P  I+  R   + I+V W    +    P      + G+ I+YS+    ++   W++  I    +   I+  +  ++  V+  S+D   R G  S+    EN +      +   +     T+S+ + L  D P+    +   IL   S R I    ++P S   V  +E            ++ + +L   T+Y   I   +   S      TL+             ++  P+  +++    I   +++  R G++DYY ++VVP   KS    +E N    EF   EL+++      I P    +    Q  GN  P    L   N     +  R  +   Y+  LRA    +E      +SD+SE F +
Sbjct:  403 IRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQP-RNLQTEVRGPDQIYVTWEKPENSDDIITSYELYYQSPSRGKVRVTIQ--PPVESYLLEDLIPATVYNIHVLAKSERGTGPESPVVQATTQEFTPSAPPQDVTGEIEGATAIIIKWSPP-PLNARNGQITEYKIRYVETESGQQLQEASVVTVLGEKDSVVIRNLKIWTKYTIWVQAATRVGPGPNSVPIVVRTDEAVPGRPERVRVETVNSTAIRV--RWSSPAPDKRNGIIRAYVVIYGKIDISSMQLIGSRKRHTI-SGGQVTETVI---TGLQPDSSYKFQVA-AVTGKGDGI---YSKGKIAKTLGAVPERPRSFR----VNLINEDPPMVQLVWQRP---RNIYGALQAYKLEYGKVG----SDKFETIALEAEQYQRTVTSLDR-GAEYEFRLSARNTVDYGEKAVQNIKTPDSVPYGYPMNFTMSAKTSTVAQLSWKPPPADQCNGRIIMYEIEYYKKLDDINSFSLNVSQMETEVSGLETNEVYLFQIKAYTSKGPGPWSPKYQFKTYKQLPAAPTNIKLRRTSHSTIQVTW----NAPNFP------IKGYRIFYSSFPNRDM-DLWTKKTIPPVTATDLIQLTDSCYYVRVQAQSLD--GRFGNLSDQE--ENCEQPPEIPQCVRSFTAVDTSSDYVVLDWDPPLTPGVVKYKILYEGSQRDIL---VHPRSEITVRNQE------------RVKISELFPETRYTFNISAQFLDGSLGPYVYTLAETQRG--------VLERPQFRKMNEDKTIGFQLKSRSRIGKVDYYWVVVVP---KSHFDIKEPN----EFEENELQSD------ISPAYIAA----QFEGNNLPDMFSLSDGNMYGNYRNKRLDENEEYKVFLRAVTTENE----VTSSDYSEPFSL 1252          

HSP 6 Score: 84.7297 bits (208), Expect = 2.400e-12
Identity = 36/82 (43.90%), Postives = 55/82 (67.07%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  +  + GSDYINA+Y+D Y K  AYI +Q P+  T  DFWR+VW+Q  + IV++ K+EE  +++
Sbjct: 1390 KNRYANVIAYDHSRVILQPLDAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIK 1471          
BLAST of Tyrosine-protein phosphatase Lar-like vs. TrEMBL
Match: A0A1S3HSZ8 (receptor-type tyrosine-protein phosphatase delta isoform X5 OS=Lingula unguis OX=7574 GN=LOC106157176 PE=4 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 5.699e-103
Identity = 170/346 (49.13%), Postives = 227/346 (65.61%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            IP+++LAE+I+ LK+ D L   QE+E +  E  ++++  NSNL  NK KNRYAN+ AYDHS V LQ PLD     +YINANY+DGY KQN YIATQGPL ET  DFW+MVWEQ+S  IVM+ + EE    KC+ YWP +GT  Y  ++VT++  +  A YTIR FQ+ + G+  KR+V Q QFT WPD G+P    P L F++  K  +  DSGP I HCSAGVGRTG FIV+D+ +ERI+H+RTV+IY  +  +R QRN+MVQTE QY FI+D LLE      +EI    L + ++  +Q     +++G E+EF++L        +N SR +  N  VNK K  L
Sbjct: 1337 IPVEQLAEHIDRLKAQDNLKFSQEYESI--EPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQ-PLDAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIKCDQYWPLRGTENYGVMQVTILDIMDLATYTIRTFQLSRQGYPEKREVKQFQFTAWPDHGVPDHPTPLLMFMRRVKASTPPDSGPMITHCSAGVGRTGAFIVIDAMLERIRHERTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEIPARNLYAHLQKLTQPEPGETVTGMELEFKRL----AHTKANPSRFVSANLPVNKFKNRL 1675          

HSP 2 Score: 91.6633 bits (226), Expect = 5.699e-103
Identity = 40/77 (51.95%), Postives = 54/77 (70.13%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   +++P++  RV L  + GVDGSDYINASYID Y    AYI +Q P+  T EDFWR++W+ N +IIV+L K+ E
Sbjct: 1672 KNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLRE 1748          

HSP 3 Score: 199.904 bits (507), Expect = 2.481e-47
Identity = 107/263 (40.68%), Postives = 149/263 (56.65%), Query Frame = 2
Query: 4259 NMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
             M  EF+ L          +++NLP NK KNR  NI  Y+++ V LQ     D  +YINA+YIDGY  +  YIATQGPL ET  DFW+M+WE  STIIVML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  ++ +R QR  MVQTE QY F Y   LE+
Sbjct: 1643 GMELEFKRLAHTKANPSRFVSANLPVNKFKNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFIALSIVLERMRYEGVVDLFQTVRMLRTQRPAMVQTEDQYQFCYRAALEY 1903          

HSP 4 Score: 112.849 bits (281), Expect = 8.227e-21
Identity = 216/977 (22.11%), Postives = 395/977 (40.43%), Query Frame = 2
Query:  824 NNLTIEQFVLHYESR--EQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWT---EHSDL---PHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKI--NKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLF-----EKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNL--KGHPNVMAEWEEIPIFDKVFSS-AIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTDNTISFYKLP------NKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSVPENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLN-SILVTYSGRIIFWSPLNPESVEFVSEKEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNSKFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSHEFSLIELKTNAKQNKLILPILALSRKPIQLFGNQ-PHYDFLFTYNFTKPNKMDRFSDGNFYRSALRACVETDEGHFLCNTSDWSESFQI 3676
            NN  I+ ++++Y+ +  + +ES SI    I+        +T+  L  +T Y   + ++N++G+ +  +  +  T E  P  PP ++ A  +S + + V+W   E  NG++  Y + +T   E  +L   P+  W+      + + I +L+PNR + + +    +VG GP S+ V +LT+ G   +    +        I + W  P+ +  +     + E+ Y+SP  S     V I     S+ + ++   T     + A ++ G G P   ++ +  +  I      V +    S  I  RW  P  D +N  ++ +     + +  S  LI  R    I S  Q+ E  I   T L+P   Y+ ++   V G+ + I   +    + +T  A P+   +F     VNL  +  P V   W+       ++ +   Y L+Y  +     S K+ +I      +   +  L + G  YEF L+    V       + I  P+  P   P    +   +     L WK P     NG++I  E++       +NS    +S  +        N+VY  ++++ T    GPWS  ++F  Y      P  I+  R   + I+V W    +    P      + G+ I+YS+    ++   W++  I    +   I+  +  ++  V+  S+D   R G  S+    EN +      +   +     T+S+ + L  D P+    +   IL   S R I    ++P S   V  +E            ++ + +L   T+Y   I   +   S      TL+             ++  P+  +++    I   +++  R G++DYY ++VVP   KS    +E N    EF   EL+++      I P    +    Q  GN  P    L   N     +  R  +   Y+  LRA    +E      +SD+SE F +
Sbjct:  361 NNDPIDSYIINYKPKYKQGVESKSI--SGIVETE-----HTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLAERPYYTWQNMAVTDKVANIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQPRNLQTEVRGPDQIYVTWEKPENSDDIIT---SYELYYQSP--SRGKVRVTIQPPVESYLLEDLIPATVYNIHVLAKSERGTG-PESPVVQATTQEFIPGRPERVRVETVNSTAIRVRWSSPAPDKRNGIIRAYVVIYGKIDISSMQLIGSRKRHTI-SGGQVTETVI---TGLQPDSSYKFQVA-AVTGKGDGI---YSKGKIAKTLGAVPERPRSFR----VNLINEDPPMVQLVWQRP---RNIYGALQAYKLEYGKVG----SDKFETIALEAEQYQRTVTSLDR-GAEYEFRLSARNTVDYGEKAVQNIKTPDSVPYGYPMNFTMSAKTSTVAQLSWKPPPADQCNGRIIMYEIEYYKKLDDINSFSLNVSQMETEVSGLETNEVYLFQIKAYTSKGPGPWSPKYQFKTYKQLPAAPTNIKLRRTSHSTIQVTW----NAPNFP------IKGYRIFYSSFPNRDM-DLWTKKTIPPVTATDLIQLTDSCYYVRVQAQSLD--GRFGNLSDQE--ENCEQPPEIPQCVRSFTAVDTSSDYVVLDWDPPLTPGVVKYKILYEGSQRDIL---VHPRSEITVRNQE------------RVKISELFPETRYTFNISAQFLDGSLGPYVYTLAETQRG--------VLERPQFRKMNEDKTIGFQLKSRSRIGKVDYYWVVVVP---KSHFDIKEPN----EFEENELQSD------ISPAYIAA----QFEGNNLPDMFSLSDGNMYGNYRNKRLDENEEYKVFLRAVTTENE----VTSSDYSEPFSL 1245          

HSP 5 Score: 84.7297 bits (208), Expect = 2.338e-12
Identity = 36/82 (43.90%), Postives = 55/82 (67.07%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  +  + GSDYINA+Y+D Y K  AYI +Q P+  T  DFWR+VW+Q  + IV++ K+EE  +++
Sbjct: 1383 KNRYANVIAYDHSRVILQPLDAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIK 1464          

HSP 6 Score: 77.411 bits (189), Expect = 4.945e-10
Identity = 113/551 (20.51%), Postives = 210/551 (38.11%), Query Frame = 2
Query:  107 SEKPRIIFISDNNKVLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMG-TDSQTTKIRVFKH--EMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQ----CYTLKKLHPFTTYRIWINSLNSLGKSQVGKSV-------------KFNTSE-------------DLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSL------ISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPD-PTK---------TLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMP 1609
            + +P II    + K   G  +   C ++GNP PDI+W           + N   +   + RYL  +        S L  + V    ++ + TC + N +G   S   ++ V+ +  EM    P + ++ + KS  K  +  A+++C    +   ++YW ++Y  ++  +  IT+ +S    +I N  + D+G Y C     +G                                + +    N        L+   R      SI   ++L+   G      C  +    P   +++ +  L  +  + +GK+V              F  S+              LP  PP  +  S ++ T+V++ W   E  N  +  YI+ +        ++ +  ++KS S +      I+ L    I+   + AVNN+G+G  S+P    T     S  P   RA  +   ++ ++W++P+ P           TL   G NL    + P Y+ +N  V   T++ +  I N+  +   V  +     VG G P
Sbjct:   47 THEPSIIQSPQSKKAPNGGIVSFFCKASGNPAPDIKW-----------QKNGNDLGTSKQRYLVFDMPF----GSVLRIEPVRQRRDDAMFTCTATNGVGEAASAQAQLTVYPNDMEMPRTAPKIVVQPNLKSVEK--DRPASMQCATEGTPPPRIYWLKDYIPVDISDPRITVSES-GTLNIMNSRKSDQGKYECVAENEAG--------------------------------VAYSYAAN--------LYVRVRNVAPRFSIQPPEMLDVMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADAPLGKNVLILKDVQQSANYTCFAASDLGNIEAITQVKVKALPN-PPVHLEISEVTATSVKLSWD--EGNNDPIDSYIINYKP------KYKQGVESKSISGIVETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLA---ERPYYTWQNMAV---TDKVA-NIRNLSPNRTYVVCVLGRTSVGDGPP 523          
BLAST of Tyrosine-protein phosphatase Lar-like vs. TrEMBL
Match: A0A1S3HRJ8 (tyrosine-protein phosphatase Lar isoform X2 OS=Lingula unguis OX=7574 GN=LOC106157176 PE=4 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 6.295e-103
Identity = 170/346 (49.13%), Postives = 227/346 (65.61%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            IP+++LAE+I+ LK+ D L   QE+E +  E  ++++  NSNL  NK KNRYAN+ AYDHS V LQ PLD     +YINANY+DGY KQN YIATQGPL ET  DFW+MVWEQ+S  IVM+ + EE    KC+ YWP +GT  Y  ++VT++  +  A YTIR FQ+ + G+  KR+V Q QFT WPD G+P    P L F++  K  +  DSGP I HCSAGVGRTG FIV+D+ +ERI+H+RTV+IY  +  +R QRN+MVQTE QY FI+D LLE      +EI    L + ++  +Q     +++G E+EF++L        +N SR +  N  VNK K  L
Sbjct: 1424 IPVEQLAEHIDRLKAQDNLKFSQEYESI--EPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQ-PLDAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIKCDQYWPLRGTENYGVMQVTILDIMDLATYTIRTFQLSRQGYPEKREVKQFQFTAWPDHGVPDHPTPLLMFMRRVKASTPPDSGPMITHCSAGVGRTGAFIVIDAMLERIRHERTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEIPARNLYAHLQKLTQPEPGETVTGMELEFKRL----AHTKANPSRFVSANLPVNKFKNRL 1762          

HSP 2 Score: 91.6633 bits (226), Expect = 6.295e-103
Identity = 40/77 (51.95%), Postives = 54/77 (70.13%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   +++P++  RV L  + GVDGSDYINASYID Y    AYI +Q P+  T EDFWR++W+ N +IIV+L K+ E
Sbjct: 1759 KNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLRE 1835          

HSP 3 Score: 199.519 bits (506), Expect = 3.107e-47
Identity = 107/263 (40.68%), Postives = 149/263 (56.65%), Query Frame = 2
Query: 4259 NMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
             M  EF+ L          +++NLP NK KNR  NI  Y+++ V LQ     D  +YINA+YIDGY  +  YIATQGPL ET  DFW+M+WE  STIIVML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  ++ +R QR  MVQTE QY F Y   LE+
Sbjct: 1730 GMELEFKRLAHTKANPSRFVSANLPVNKFKNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFIALSIVLERMRYEGVVDLFQTVRMLRTQRPAMVQTEDQYQFCYRAALEY 1990          

HSP 4 Score: 95.9005 bits (237), Expect = 9.558e-16
Identity = 260/1215 (21.40%), Postives = 471/1215 (38.77%), Query Frame = 2
Query:  149 VLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMGTDSQTTKIRVFKHEMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKV-YWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVT--------------GHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLP-FNNLTIEQFVLHYESREQIESVS-IPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKI-LLKSIVLEWNDPDPTKTLNCFGLNLEISY---KSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG---MPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLF-----EKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNL--KGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTDNTISFYKLP------NKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSVPENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLN-SILVTYSGRIIFWSPLNPESVEFVSEKEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNSKFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSHEFSLIELKTNAKQNKLILPILALSRKPIQLFGNQ-PHYDFLFTYNFTKPNKMDRFSDGNFYRSALRACVETDEGHFLCNTSDWSESFQI 3676
            V+ G  + I+C++ G+P+P ++W +    +  +  +                     + K+ LI K V    N    TC + + +G     T+++V     ++  P V LE S       E +A ++K  +    N  +  +  NY+    P+Y+    + V   SI  I+ + E T    V+              G       K           P  NV     ++++  + W  P   N  I  + ++Y  +E+ E+++  P+    N     +   ++ L P  TY + +    S+G     + V+  T + +P+ P  ++         + V W+  E  + I+  Y L +   S    +   Q     ES L+  L P  ++ I + A +  G GP S  V   T+  T S  P+    +I    +I+++W+ P P    N      +I Y   +S     E  +V +   + S  I N+K  T+    ++A  +VG G   +P+ +    A   +  +  V+ +  T+  +  RW  P  D +N  ++ +     + +  S  LI  R    I S  Q+ E  I   T L+P   Y+ ++   V G+ + I   +    + +T  A P+   +F     VNL  +  P V   W+          +  Y L+Y  +     S K+ +I      +   +  L + G  YEF L+    V       + I  P+  P   P    +   +     L WK P     NG++I  E++       +NS    +S  +        N+VY  ++++ T    GPWS  ++F  Y      P  I+  R   + I+V W    +    P      + G+ I+YS+    ++   W++  I    +   I+  +  ++  V+  S+D   R G  S+    EN +      +   +     T+S+ + L  D P+    +   IL   S R I    ++P S   V  +E            ++ + +L   T+Y   I   +   S      TL+             ++  P+  +++    I   +++  R G++DYY ++VVP   KS    +E N    EF   EL+++      I P    +    Q  GN  P    L   N     +  R  +   Y+  LRA    +E      +SD+SE F +
Sbjct:  245 VMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADA--------------------PLGKNVLILKDVQQSAN---YTCFAASDLGNIEAITQVKV----KALPNPPVHLEIS-------EVTATSVKLSWDEGNNDPIDSYIINYK----PKYK----QGVESKSISGIV-ETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLAERPYYTWQNMAVTDKVANIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQP-RNLQTEVRGPDQIYVTWEKPENSDDIITSYELYYQSPSRGKVRVTIQ--PPVESYLLEDLIPATVYNIHVLAKSERGTGPESPVVQATTQEFTPSAPPQDVTGEIEGATAIIIKWSPP-PLNARNGQITEYKIRYVETESGQQLQEASVVTVLGEKDSVVIRNLKIWTKYTIWVQAATRVGPGPNSVPIVVRTDEAVPGRPERVRVETVNSTAIRV--RWSSPAPDKRNGIIRAYVVIYGKIDISSMQLIGSRKRHTI-SGGQVTETVI---TGLQPDSSYKFQVA-AVTGKGDGI---YSKGKIAKTLGAVPERPRSFR----VNLINEDPPMVQLVWQRPRNIYGALQA--YKLEYGKVG----SDKFETIALEAEQYQRTVTSLDR-GAEYEFRLSARNTVDYGEKAVQNIKTPDSVPYGYPMNFTMSAKTSTVAQLSWKPPPADQCNGRIIMYEIEYYKKLDDINSFSLNVSQMETEVSGLETNEVYLFQIKAYTSKGPGPWSPKYQFKTYKQLPAAPTNIKLRRTSHSTIQVTW----NAPNFP------IKGYRIFYSSFPNRDM-DLWTKKTIPPVTATDLIQLTDSCYYVRVQAQSLD--GRFGNLSDQE--ENCEQPPEIPQCVRSFTAVDTSSDYVVLDWDPPLTPGVVKYKILYEGSQRDIL---VHPRSEITVRNQE------------RVKISELFPETRYTFNISAQFLDGSLGPYVYTLAETQRG--------VLERPQFRKMNEDKTIGFQLKSRSRIGKVDYYWVVVVP---KSHFDIKEPN----EFEENELQSD------ISPAYIAA----QFEGNNLPDMFSLSDGNMYGNYRNKRLDENEEYKVFLRAVTTENE----VTSSDYSEPFSL 1332          

HSP 5 Score: 85.8853 bits (211), Expect = 1.321e-12
Identity = 187/922 (20.28%), Postives = 350/922 (37.96%), Query Frame = 2
Query:   50 FLLCLHMYLITIYGYSETESEKPRIIFISDNNKVLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMG-TDSQTTKIRVFKH--EMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQ----CYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVK-------------FNTSE-------------DLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSL------ISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPD-PTK---------TLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKL--LIVSAGKAKINKNV-VDIIGCTSFTIVARWRQP-NKDAKNMTLQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIE--TKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAE--LSTKYRSIYTNKSSHVIQLLEL-PKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNG-----KLIYNEVQIMPLNQILNSTDNTISFYKL---------PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRV 2596
            FL  L +    +    +    +P II    + K   G  +   C ++GNP PDI+W           + N   +   + RYL  +        S L  + V    ++ + TC + N +G   S   ++ V+ +  EM    P + ++ + KS  K  +  A+++C    +   ++YW ++Y  ++  +  IT+ +S    +I N  + D+G Y C     +G                                + +    N        L+   R      SI   ++L+   G      C  +    P   +++ +  L  +  + +GK+V              F  S+              LP  PP  +  S ++ T+V++ W   E  N  +  YI+ +        ++ +  ++KS S +      I+ L    I+   + AVNN+G+G  S+P    T     S  P   RA  +   ++ ++W++P+ P           TL   G NL    + P Y+ +N  V   T++ +  I N+  +   V  +     VG G P +   ++   G  +  +N+  ++ G     I   W +P N D    + +L+ ++     + V    P+          + Y    L P+  Y I +  L   E     ES  +    +  T  A PQ V      TG  ++G   ++ +W   P+  +      Y ++Y      +        ++   K S VI+ L++  KY +  +    R G      SV  ++   E  P   P  ++V  ++   + ++W +P    RNG      +IY ++ I  +  I +   +TIS  ++         P+  Y+ +V + T    G +SK     +       P+  R+FRV
Sbjct:   12 FLATLCLASCRLSEADDGNLHEPSIIQSPQSKKAPNGGIVSFFCKASGNPAPDIKW-----------QKNGNDLGTSKQRYLVFDMPF----GSVLRIEPVRQRRDDAMFTCTATNGVGEAASAQAQLTVYPNDMEMPRTAPKIVVQPNLKSVEK--DRPASMQCATEGTPPPRIYWLKDYIPVDISDPRITVSES-GTLNIMNSRKSDQGKYECVAENEAG--------------------------------VAYSYAAN--------LYVRVRNVAPRFSIQPPEMLDVMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADAPLGKNVLILKDVQQSANYTCFAASDLGNIEAITQVKVKALPN-PPVHLEISEVTATSVKLSWD--EGNNDPIDSYIINYKP------KYKQGVESKSISGIVETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLA---ERPYYTWQNMAV---TDKVA-NIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQPRNLQTEVRGPDQ--IYVTWEKPENSDDIITSYELYYQSPSRGKVRVTIQPPV----------ESYLLEDLIPATVYNIHV--LAKSERGTGPESPVVQATTQEFTPSAPPQDV------TG-EIEGATAIIIKWSPPPLNARNGQITEYKIRYVETESGQQLQEASVVTVLGEKDSVVIRNLKIWTKYTIWVQ-AATRVGPGPN--SVPIVVRTDEAVPGR-PERVRVETVNSTAIRVRWSSPAPDKRNGIIRAYVVIYGKIDISSMQLIGSRKRHTISGGQVTETVITGLQPDSSYKFQVAAVTGKGDGIYSK---GKIAKTLGAVPERPRSFRV 831          

HSP 6 Score: 84.7297 bits (208), Expect = 2.527e-12
Identity = 36/82 (43.90%), Postives = 55/82 (67.07%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  +  + GSDYINA+Y+D Y K  AYI +Q P+  T  DFWR+VW+Q  + IV++ K+EE  +++
Sbjct: 1470 KNRYANVIAYDHSRVILQPLDAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIK 1551          
BLAST of Tyrosine-protein phosphatase Lar-like vs. TrEMBL
Match: A0A1S3HQ57 (tyrosine-protein phosphatase Lar isoform X1 OS=Lingula unguis OX=7574 GN=LOC106157176 PE=4 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 6.784e-103
Identity = 170/346 (49.13%), Postives = 227/346 (65.61%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDR-DHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSR-IHGNATVNKQKTIL 5233
            IP+++LAE+I+ LK+ D L   QE+E +  E  ++++  NSNL  NK KNRYAN+ AYDHS V LQ PLD     +YINANY+DGY KQN YIATQGPL ET  DFW+MVWEQ+S  IVM+ + EE    KC+ YWP +GT  Y  ++VT++  +  A YTIR FQ+ + G+  KR+V Q QFT WPD G+P    P L F++  K  +  DSGP I HCSAGVGRTG FIV+D+ +ERI+H+RTV+IY  +  +R QRN+MVQTE QY FI+D LLE      +EI    L + ++  +Q     +++G E+EF++L        +N SR +  N  VNK K  L
Sbjct: 1440 IPVEQLAEHIDRLKAQDNLKFSQEYESI--EPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQ-PLDAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIKCDQYWPLRGTENYGVMQVTILDIMDLATYTIRTFQLSRQGYPEKREVKQFQFTAWPDHGVPDHPTPLLMFMRRVKASTPPDSGPMITHCSAGVGRTGAFIVIDAMLERIRHERTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEIPARNLYAHLQKLTQPEPGETVTGMELEFKRL----AHTKANPSRFVSANLPVNKFKNRL 1778          

HSP 2 Score: 91.6633 bits (226), Expect = 6.784e-103
Identity = 40/77 (51.95%), Postives = 54/77 (70.13%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   +++P++  RV L  + GVDGSDYINASYID Y    AYI +Q P+  T EDFWR++W+ N +IIV+L K+ E
Sbjct: 1775 KNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLRE 1851          

HSP 3 Score: 199.519 bits (506), Expect = 3.128e-47
Identity = 107/263 (40.68%), Postives = 149/263 (56.65%), Query Frame = 2
Query: 4259 NMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
             M  EF+ L          +++NLP NK KNR  NI  Y+++ V LQ     D  +YINA+YIDGY  +  YIATQGPL ET  DFW+M+WE  STIIVML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R + Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+++  ++ +R QR  MVQTE QY F Y   LE+
Sbjct: 1746 GMELEFKRLAHTKANPSRFVSANLPVNKFKNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFIALSIVLERMRYEGVVDLFQTVRMLRTQRPAMVQTEDQYQFCYRAALEY 2006          

HSP 4 Score: 95.9005 bits (237), Expect = 1.051e-15
Identity = 260/1215 (21.40%), Postives = 471/1215 (38.77%), Query Frame = 2
Query:  149 VLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMGTDSQTTKIRVFKHEMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKV-YWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVT--------------GHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLP-FNNLTIEQFVLHYESREQIESVS-IPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKI-LLKSIVLEWNDPDPTKTLNCFGLNLEISY---KSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG---MPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLF-----EKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNL--KGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTDNTISFYKLP------NKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSVPENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLN-SILVTYSGRIIFWSPLNPESVEFVSEKEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNSKFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSHEFSLIELKTNAKQNKLILPILALSRKPIQLFGNQ-PHYDFLFTYNFTKPNKMDRFSDGNFYRSALRACVETDEGHFLCNTSDWSESFQI 3676
            V+ G  + I+C++ G+P+P ++W +    +  +  +                     + K+ LI K V    N    TC + + +G     T+++V     ++  P V LE S       E +A ++K  +    N  +  +  NY+    P+Y+    + V   SI  I+ + E T    V+              G       K           P  NV     ++++  + W  P   N  I  + ++Y  +E+ E+++  P+    N     +   ++ L P  TY + +    S+G     + V+  T + +P+ P  ++         + V W+  E  + I+  Y L +   S    +   Q     ES L+  L P  ++ I + A +  G GP S  V   T+  T S  P+    +I    +I+++W+ P P    N      +I Y   +S     E  +V +   + S  I N+K  T+    ++A  +VG G   +P+ +    A   +  +  V+ +  T+  +  RW  P  D +N  ++ +     + +  S  LI  R    I S  Q+ E  I   T L+P   Y+ ++   V G+ + I   +    + +T  A P+   +F     VNL  +  P V   W+          +  Y L+Y  +     S K+ +I      +   +  L + G  YEF L+    V       + I  P+  P   P    +   +     L WK P     NG++I  E++       +NS    +S  +        N+VY  ++++ T    GPWS  ++F  Y      P  I+  R   + I+V W    +    P      + G+ I+YS+    ++   W++  I    +   I+  +  ++  V+  S+D   R G  S+    EN +      +   +     T+S+ + L  D P+    +   IL   S R I    ++P S   V  +E            ++ + +L   T+Y   I   +   S      TL+             ++  P+  +++    I   +++  R G++DYY ++VVP   KS    +E N    EF   EL+++      I P    +    Q  GN  P    L   N     +  R  +   Y+  LRA    +E      +SD+SE F +
Sbjct:  261 VMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADA--------------------PLGKNVLILKDVQQSAN---YTCFAASDLGNIEAITQVKV----KALPNPPVHLEIS-------EVTATSVKLSWDEGNNDPIDSYIINYK----PKYK----QGVESKSISGIV-ETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLAERPYYTWQNMAVTDKVANIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQP-RNLQTEVRGPDQIYVTWEKPENSDDIITSYELYYQSPSRGKVRVTIQ--PPVESYLLEDLIPATVYNIHVLAKSERGTGPESPVVQATTQEFTPSAPPQDVTGEIEGATAIIIKWSPP-PLNARNGQITEYKIRYVETESGQQLQEASVVTVLGEKDSVVIRNLKIWTKYTIWVQAATRVGPGPNSVPIVVRTDEAVPGRPERVRVETVNSTAIRV--RWSSPAPDKRNGIIRAYVVIYGKIDISSMQLIGSRKRHTI-SGGQVTETVI---TGLQPDSSYKFQVA-AVTGKGDGI---YSKGKIAKTLGAVPERPRSFR----VNLINEDPPMVQLVWQRPRNIYGALQA--YKLEYGKVG----SDKFETIALEAEQYQRTVTSLDR-GAEYEFRLSARNTVDYGEKAVQNIKTPDSVPYGYPMNFTMSAKTSTVAQLSWKPPPADQCNGRIIMYEIEYYKKLDDINSFSLNVSQMETEVSGLETNEVYLFQIKAYTSKGPGPWSPKYQFKTYKQLPAAPTNIKLRRTSHSTIQVTW----NAPNFP------IKGYRIFYSSFPNRDM-DLWTKKTIPPVTATDLIQLTDSCYYVRVQAQSLD--GRFGNLSDQE--ENCEQPPEIPQCVRSFTAVDTSSDYVVLDWDPPLTPGVVKYKILYEGSQRDIL---VHPRSEITVRNQE------------RVKISELFPETRYTFNISAQFLDGSLGPYVYTLAETQRG--------VLERPQFRKMNEDKTIGFQLKSRSRIGKVDYYWVVVVP---KSHFDIKEPN----EFEENELQSD------ISPAYIAA----QFEGNNLPDMFSLSDGNMYGNYRNKRLDENEEYKVFLRAVTTENE----VTSSDYSEPFSL 1348          

HSP 5 Score: 85.1149 bits (209), Expect = 1.885e-12
Identity = 184/903 (20.38%), Postives = 345/903 (38.21%), Query Frame = 2
Query:  107 SEKPRIIFISDNNKVLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMG-TDSQTTKIRVFKH--EMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQ----CYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVK-------------FNTSE-------------DLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSL------ISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPE-FRASKILLKSIVLEWNDPD-PTK---------TLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKL--LIVSAGKAKINKNV-VDIIGCTSFTIVARWRQP-NKDAKNMTLQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIE--TKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAE--LSTKYRSIYTNKSSHVIQLLEL-PKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNG-----KLIYNEVQIMPLNQILNSTDNTISFYKL---------PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRV 2596
            + +P II    + K   G  +   C ++GNP PDI+W           + N   +   + RYL  +        S L  + V    ++ + TC + N +G   S   ++ V+ +  EM    P + ++ + KS  K  +  A+++C    +   ++YW ++Y  ++  +  IT+ +S    +I N  + D+G Y C     +G                                + +    N        L+   R      SI   ++L+   G      C  +    P   +++ +  L  +  + +GK+V              F  S+              LP  PP  +  S ++ T+V++ W   E  N  +  YI+ +        ++ +  ++KS S +      I+ L    I+   + AVNN+G+G  S+P    T     S  P   RA  +   ++ ++W++P+ P           TL   G NL    + P Y+ +N  V   T++ +  I N+  +   V  +     VG G P +   ++   G  +  +N+  ++ G     I   W +P N D    + +L+ ++     + V    P+          + Y    L P+  Y I +  L   E     ES  +    +  T  A PQ V      TG  ++G   ++ +W   P+  +      Y ++Y      +        ++   K S VI+ L++  KY +  +    R G      SV  ++   E  P   P  ++V  ++   + ++W +P    RNG      +IY ++ I  +  I +   +TIS  ++         P+  Y+ +V + T    G +SK     +       P+  R+FRV
Sbjct:   47 THEPSIIQSPQSKKAPNGGIVSFFCKASGNPAPDIKW-----------QKNGNDLGTSKQRYLVFDMPF----GSVLRIEPVRQRRDDAMFTCTATNGVGEAASAQAQLTVYPNDMEMPRTAPKIVVQPNLKSVEK--DRPASMQCATEGTPPPRIYWLKDYIPVDISDPRITVSES-GTLNIMNSRKSDQGKYECVAENEAG--------------------------------VAYSYAAN--------LYVRVRNVAPRFSIQPPEMLDVMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADAPLGKNVLILKDVQQSANYTCFAASDLGNIEAITQVKVKALPN-PPVHLEISEVTATSVKLSWD--EGNNDPIDSYIINYKP------KYKQGVESKSISGIVETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLA---ERPYYTWQNMAV---TDKVA-NIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQPRNLQTEVRGPDQ--IYVTWEKPENSDDIITSYELYYQSPSRGKVRVTIQPPV----------ESYLLEDLIPATVYNIHV--LAKSERGTGPESPVVQATTQEFTPSAPPQDV------TG-EIEGATAIIIKWSPPPLNARNGQITEYKIRYVETESGQQLQEASVVTVLGEKDSVVIRNLKIWTKYTIWVQ-AATRVGPGPN--SVPIVVRTDEAVPGR-PERVRVETVNSTAIRVRWSSPAPDKRNGIIRAYVVIYGKIDISSMQLIGSRKRHTISGGQVTETVITGLQPDSSYKFQVAAVTGKGDGIYSK---GKIAKTLGAVPERPRSFRV 847          

HSP 6 Score: 84.7297 bits (208), Expect = 2.531e-12
Identity = 36/82 (43.90%), Postives = 55/82 (67.07%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L  +  + GSDYINA+Y+D Y K  AYI +Q P+  T  DFWR+VW+Q  + IV++ K+EE  +++
Sbjct: 1486 KNRYANVIAYDHSRVILQPLDAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIK 1567          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Cavefish
Match: ptprsa (protein tyrosine phosphatase receptor type S [Source:NCBI gene;Acc:103028538])

HSP 1 Score: 310.071 bits (793), Expect = 7.363e-105
Identity = 171/371 (46.09%), Postives = 232/371 (62.53%), Query Frame = 2
Query: 4067 ILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRY---------TIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            +L N  ++ +H     D V V  R NF   DS  +SS + ++ +          IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ+S  +VM+ R EE    KC+ YWP +GT  Y   +VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     ++G E+EF++L
Sbjct: 1316 LLNNADITPHHPT---DPVEVR-RINFQTPDS-GLSSPLSEAAFDYESMMNHPPIPITELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEPGEHVTGMELEFKRL 1679          

HSP 2 Score: 93.5893 bits (231), Expect = 7.363e-105
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYIN+S+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1696 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1776          

HSP 3 Score: 202.601 bits (514), Expect = 1.315e-51
Identity = 117/315 (37.14%), Postives = 177/315 (56.19%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSRYTIP-IDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R     I KLA+    ++  +++  M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YIN+++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1623 MVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQ----VEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1931          

HSP 4 Score: 93.9745 bits (232), Expect = 1.677e-18
Identity = 68/276 (24.64%), Postives = 129/276 (46.74%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGC---TSFTIVARWRQPNKDAKNMTLQLF 1750
            Y++  L P T Y I + + N++G+    + V+  T E  P  PP +I A  IS + + VRW+  E+ NG +K Y + +T     P   W+ ++   S  + I +L  +  + I + A  +VG GP S P+ +    G   +  +F+  ++   +I L W +P   + +  +    E+ YK    S  + +    +   S+ +  ++ +TE  F+L A +  G G     +     +AK +    + I C   +S +++  WR P  +++N  L  +
Sbjct:  379 YSIGGLSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEPEEPNGQIKGYRVFFTMDPSQPVSMWQIHNVHDSVITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSKFQIGEVTDTTIELTW-EPFEKEGITRY----ELHYKE--GSQGSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQAKPSAPPQE-IKCSSPSSTSLLVSWRPPPAESQNGPLAGY 646          

HSP 5 Score: 88.9669 bits (219), Expect = 5.616e-17
Identity = 36/82 (43.90%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYINA+YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ ++EE  +++
Sbjct: 1411 KNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIK 1492          

HSP 6 Score: 73.559 bits (179), Expect = 2.194e-12
Identity = 67/289 (23.18%), Postives = 121/289 (41.87%), Query Frame = 2
Query:  803 ICWKLP---FNNLTIEQFVLHYE-SREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSV--EKINGILKKYILLWT-----EHSDLP--------HQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPT-KTLNCFGLNLEISYKS--PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            + W+ P     N  +  +++ Y  +    ES + P E I       Q  TL++L  +T Y++ + +  ++G      ++   T ED+P  PP  +    I++TA++V W+S+   + +G ++ Y + +      E   LP           W   D      +I  L P+  + IT+ A    G G  SKP  ++TK G +   P     +    S V  W  P+     L+  G  L+   K   P+ ++E         +  + I ++      +F L A ++ GFG
Sbjct:  629 VSWRPPPAESQNGPLAGYIVRYTMAGGGAESRADPAEDIQVPPTSSQI-TLQRLEKWTMYQVTVAAATAVGPGPESLALTCRTDEDVPGAPPRRVEVEVINSTALKVMWRSLLPGRQHGQIRGYQVHYVRVENGEARGLPLIKDVMLADAQWETDDTAEYEMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVVTK-GAVPGPPSLWVHQDSENSAVARWLPPEVVPPGLDILGYRLQFGRKDVLPMATLE-----FGPEEQEYSIPSMHRGATYIFRLSAKSRSGFG 910          

HSP 7 Score: 71.633 bits (174), Expect = 9.329e-12
Identity = 120/601 (19.97%), Postives = 236/601 (39.27%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECP-EFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKI-----VNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIV-----SAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFT--RLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLI-----YNEVQI--MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPY 2656
            T++ L    TY I + +  S+G       +     + +P G P+      +++T +E+ W+  EK  GI  +Y L + E S        +  + S S ++  L  N  ++ ++ AV+N G G  +  ++  T     S  P E + S     S+++ W  P P ++ N       + Y       E++      + +        +  +++ T    T+ A   VG G P  L +          A   +  V++I  T+  ++  WR      ++  ++ ++      +NG++  L + + + +  ++++ D+   Y      L+P   Y I +  +   G+    +       ++ TK A P   G  +L   V+     + +A W    +  +V    +  L YR+ F  +      ++          +  + + G TY F L+            + +++PE  P   P +     ++   V   W  P +  RNG +I     Y E     +PL   L +T+N      L PN +Y +++R+ T V  GP+S   ++    +    PK         T + + W     + R PY
Sbjct:  479 TIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVP-GQPSKFQIGEVTDTTIELTWEPFEK-EGI-TRYELHYKEGSQ--GSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQAKPSAPPQEIKCSSPSSTSLLVSWRPP-PAESQNGPLAGYIVRYTMAGGGAESRADPAEDIQVPPTSSQITLQRLEKWTMYQVTVAAATAVGPG-PESLALTCRTDEDVPGAPPRRVEVEVINSTALKVM--WRSLLPGRQHGQIRGYQVHYVRVENGEARGLPLIKDVMLADAQWETDDTAEYEMVIGGLQPDTTYSITVAAYTTKGDGARSK-----PKLVVTKGAVP---GPPSL--WVHQDSENSAVARW----LPPEVVPPGLDILGYRLQFGRKDVLPMATLEFGPEEQEYSIPSMHR-GATYIFRLSAKSRSGFGEEAVQELSLPEQVPQGYPQITDGSNVTCCSVQFSWLPPVLAERNGAIIEYTLAYQEAGAAGIPLELRLPATENNYVLNSLKPNSIYDVKIRAHTSVGPGPFSPSVQYRTVALTTDVPKNFTVKLATRTTVLLTWKFSDSRFRQPY 1055          

HSP 8 Score: 51.9878 bits (123), Expect = 9.895e-6
Identity = 108/473 (22.83%), Postives = 180/473 (38.05%), Query Frame = 2
Query: 1391 SIVLEWNDPDPTKTLNCFGLNLEISYKS-PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG---MPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYN--------FTRLKPSQKYQIR-LTFLVVGEFNEIRESFYLSNVIETK--KAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGN---------VSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLI-----------YNEVQIMPLNQI-LNSTDNTISFYKLPN-KVYQLRVRSCTRVACGPWSKYFEFSV-YDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYY 2695
            SI + W+  +P    +       I Y++  L S    + +ITT ++S  I  +  +TE    + AFN +G G    PV+        A   +N+   I   S T++ RW +P            E NG+   +  YR    +     +  W+I+N           L  S+ Y IR L F  VG+          S+ I  K  +  P     F +    +      +   WE    F+K   +  Y L Y+      + TK    ++  SS++++ L   +    Y F LA   N         +S+K S        + KPS  P  IK    S   + + W+ P  + +NG L              E +  P   I +  T + I+  +L    +YQ+ V + T V  GP S         DV   PP+ +    +  T ++V W     ++ +P      + G+ ++Y
Sbjct:  339 SITITWDSGNPEPVSHYI-----IQYRAKTLDSKFETMDSITTTRYS--IGGLSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQS-TMMVRWEEPE-----------EPNGQ---IKGYRVFFTMDPSQPVSMWQIHNVHDSVITTIQNLVASETYTIRVLAFTSVGDGP-------FSDPIHVKVLQGVPGQPSKFQIGEVTDT----TIELTWEP---FEKEGITR-YELHYKEGSQGSMVTK---TFSPSSSYMVEGL---RANTEYFFSLAAVSNKGIGAFTNEISQKTS--------QAKPSAPPQEIKCSSPSSTSLLVSWRPPPAESQNGPLAGYIVRYTMAGGGAESRADPAEDIQVPPTSSQITLQRLEKWTMYQVTVAAATAVGPGPESLALTCRTDEDVPGAPPRRVEVEVINSTALKVMW-----RSLLPGRQHGQIRGYQVHY 755          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Cavefish
Match: ptprsa (protein tyrosine phosphatase receptor type S [Source:NCBI gene;Acc:103028538])

HSP 1 Score: 307.375 bits (786), Expect = 4.148e-104
Identity = 167/362 (46.13%), Postives = 226/362 (62.43%), Query Frame = 2
Query: 4067 ILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            +L N  ++ +H     D V V  R NF         +  + +   IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ+S  +VM+ R EE    KC+ YWP +GT  Y   +VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     ++G E+EF++L
Sbjct: 1303 LLNNADITPHHPT---DPVEVR-RINF--------QTPGMMNHPPIPITELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEPGEHVTGMELEFKRL 1650          

HSP 2 Score: 93.9745 bits (232), Expect = 4.148e-104
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYIN+S+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1667 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1747          

HSP 3 Score: 202.601 bits (514), Expect = 1.264e-51
Identity = 117/315 (37.14%), Postives = 177/315 (56.19%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSRYTIP-IDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R     I KLA+    ++  +++  M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YIN+++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1594 MVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQ----VEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1902          

HSP 4 Score: 93.5893 bits (231), Expect = 1.879e-18
Identity = 68/273 (24.91%), Postives = 128/273 (46.89%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGC---TSFTIVARWRQPNKDAKNMTL 1741
            Y++  L P T Y I + + N++G+    + V+  T E  P  PP +I A  IS + + VRW+  E+ NG +K Y + +T     P   W+ ++   S  + I +L  +  + I + A  +VG GP S P+ +    G   +  +F+  ++   +I L W +P   + +  +    E+ YK    S  + +    +   S+ +  ++ +TE  F+L A +  G G     +     +AK +    + I C   +S +++  WR P  +++N  L
Sbjct:  375 YSIGGLSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEPEEPNGQIKGYRVFFTMDPSQPVSMWQIHNVHDSVITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSKFQIGEVTDTTIELTW-EPFEKEGITRY----ELHYKE--GSQGSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQAKPSAPPQE-IKCSSPSSTSLLVSWRPPPAESQNGPL 639          

HSP 5 Score: 88.9669 bits (219), Expect = 5.015e-17
Identity = 36/82 (43.90%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYINA+YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ ++EE  +++
Sbjct: 1382 KNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIK 1463          

HSP 6 Score: 70.4774 bits (171), Expect = 2.251e-11
Identity = 122/599 (20.37%), Postives = 233/599 (38.90%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECP-EFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKI-----VNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIV-----SAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLI-----YNEVQI--MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPY 2656
            T++ L    TY I + +  S+G       +     + +P G P+      +++T +E+ W+  EK  GI  +Y L + E S        +  + S S ++  L  N  ++ ++ AV+N G G  +  ++  T     S  P E + S     S+++ W  P P ++ N       + Y       E++      + +        +  +++ T    T+ A   VG G P  L +          A   +  V++I  T+  ++  WR      ++  ++ ++      +NG++      R LP+I+     D  ++     L+P   Y I +  +   G+    +       ++ TK A P   G  +L   V+     + +A W    +  +V    +  L YR+ F  +      ++          +  + + G TY F L+            + +++PE  P   P +     ++   V   W  P +  RNG +I     Y E     +PL   L +T+N      L PN +Y +++R+ T V  GP+S   ++    +    PK         T + + W     + R PY
Sbjct:  475 TIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVP-GQPSKFQIGEVTDTTIELTWEPFEK-EGI-TRYELHYKEGSQ--GSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQAKPSAPPQEIKCSSPSSTSLLVSWRPP-PAESQNGPLAGYIVRYTMAGGGAESRADPAEDIQVPPTSSQITLQRLEKWTMYQVTVAAATAVGPG-PESLALTCRTDEDVPGAPPRRVEVEVINSTALKVM--WRSLLPGRQHGQIRGYQVHYVRVENGEA------RGLPLIKDVMLADAQEMV-IGGLQPDTTYSITVAAYTTKGDGARSK-----PKLVVTKGAVP---GPPSL--WVHQDSENSAVARW----LPPEVVPPGLDILGYRLQFGRKDVLPMATLEFGPEEQEYSIPSMHR-GATYIFRLSAKSRSGFGEEAVQELSLPEQVPQGYPQITDGSNVTCCSVQFSWLPPVLAERNGAIIEYTLAYQEAGAAGIPLELRLPATENNYVLNSLKPNSIYDVKIRAHTSVGPGPFSPSVQYRTVALTTDVPKNFTVKLATRTTVLLTWKFSDSRFRQPY 1042          

HSP 7 Score: 69.707 bits (169), Expect = 3.288e-11
Identity = 66/281 (23.49%), Postives = 122/281 (43.42%), Query Frame = 2
Query:  803 ICWKLP---FNNLTIEQFVLHYE-SREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSV--EKINGILKKYILLWT-----EHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPT-KTLNCFGLNLEISYKS--PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            + W+ P     N  +  +++ Y  +    ES + P E I       Q  TL++L  +T Y++ + +  ++G      ++   T ED+P  PP  +    I++TA++V W+S+   + +G ++ Y + +      E   LP        A ++  +I  L P+  + IT+ A    G G  SKP  ++TK G +   P     +    S V  W  P+     L+  G  L+   K   P+ ++E         +  + I ++      +F L A ++ GFG
Sbjct:  625 VSWRPPPAESQNGPLAGYIVRYTMAGGGAESRADPAEDIQVPPTSSQI-TLQRLEKWTMYQVTVAAATAVGPGPESLALTCRTDEDVPGAPPRRVEVEVINSTALKVMWRSLLPGRQHGQIRGYQVHYVRVENGEARGLPLIKDVML-ADAQEMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVVTK-GAVPGPPSLWVHQDSENSAVARWLPPEVVPPGLDILGYRLQFGRKDVLPMATLE-----FGPEEQEYSIPSMHRGATYIFRLSAKSRSGFG 897          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Cavefish
Match: ptprsa (protein tyrosine phosphatase receptor type S [Source:NCBI gene;Acc:103028538])

HSP 1 Score: 307.375 bits (786), Expect = 4.433e-104
Identity = 167/362 (46.13%), Postives = 226/362 (62.43%), Query Frame = 2
Query: 4067 ILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            +L N  ++ +H     D V V  R NF         +  + +   IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ+S  +VM+ R EE    KC+ YWP +GT  Y   +VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     ++G E+EF++L
Sbjct: 1316 LLNNADITPHHPT---DPVEVR-RINF--------QTPGMMNHPPIPITELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEPGEHVTGMELEFKRL 1663          

HSP 2 Score: 93.5893 bits (231), Expect = 4.433e-104
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYIN+S+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1680 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1760          

HSP 3 Score: 202.601 bits (514), Expect = 1.179e-51
Identity = 117/315 (37.14%), Postives = 177/315 (56.19%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSRYTIP-IDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R     I KLA+    ++  +++  M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YIN+++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1607 MVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQ----VEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1915          

HSP 4 Score: 93.5893 bits (231), Expect = 1.790e-18
Identity = 68/276 (24.64%), Postives = 129/276 (46.74%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGC---TSFTIVARWRQPNKDAKNMTLQLF 1750
            Y++  L P T Y I + + N++G+    + V+  T E  P  PP +I A  IS + + VRW+  E+ NG +K Y + +T     P   W+ ++   S  + I +L  +  + I + A  +VG GP S P+ +    G   +  +F+  ++   +I L W +P   + +  +    E+ YK    S  + +    +   S+ +  ++ +TE  F+L A +  G G     +     +AK +    + I C   +S +++  WR P  +++N  L  +
Sbjct:  379 YSIGGLSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEPEEPNGQIKGYRVFFTMDPSQPVSMWQIHNVHDSVITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSKFQIGEVTDTTIELTW-EPFEKEGITRY----ELHYKE--GSQGSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQAKPSAPPQE-IKCSSPSSTSLLVSWRPPPAESQNGPLAGY 646          

HSP 5 Score: 88.9669 bits (219), Expect = 5.511e-17
Identity = 36/82 (43.90%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYINA+YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ ++EE  +++
Sbjct: 1395 KNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIK 1476          

HSP 6 Score: 73.559 bits (179), Expect = 2.246e-12
Identity = 67/289 (23.18%), Postives = 121/289 (41.87%), Query Frame = 2
Query:  803 ICWKLP---FNNLTIEQFVLHYE-SREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSV--EKINGILKKYILLWT-----EHSDLP--------HQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPT-KTLNCFGLNLEISYKS--PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            + W+ P     N  +  +++ Y  +    ES + P E I       Q  TL++L  +T Y++ + +  ++G      ++   T ED+P  PP  +    I++TA++V W+S+   + +G ++ Y + +      E   LP           W   D      +I  L P+  + IT+ A    G G  SKP  ++TK G +   P     +    S V  W  P+     L+  G  L+   K   P+ ++E         +  + I ++      +F L A ++ GFG
Sbjct:  629 VSWRPPPAESQNGPLAGYIVRYTMAGGGAESRADPAEDIQVPPTSSQI-TLQRLEKWTMYQVTVAAATAVGPGPESLALTCRTDEDVPGAPPRRVEVEVINSTALKVMWRSLLPGRQHGQIRGYQVHYVRVENGEARGLPLIKDVMLADAQWETDDTAEYEMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVVTK-GAVPGPPSLWVHQDSENSAVARWLPPEVVPPGLDILGYRLQFGRKDVLPMATLE-----FGPEEQEYSIPSMHRGATYIFRLSAKSRSGFG 910          

HSP 7 Score: 71.633 bits (174), Expect = 9.394e-12
Identity = 120/601 (19.97%), Postives = 236/601 (39.27%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECP-EFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKI-----VNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIV-----SAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFT--RLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLI-----YNEVQI--MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPY 2656
            T++ L    TY I + +  S+G       +     + +P G P+      +++T +E+ W+  EK  GI  +Y L + E S        +  + S S ++  L  N  ++ ++ AV+N G G  +  ++  T     S  P E + S     S+++ W  P P ++ N       + Y       E++      + +        +  +++ T    T+ A   VG G P  L +          A   +  V++I  T+  ++  WR      ++  ++ ++      +NG++  L + + + +  ++++ D+   Y      L+P   Y I +  +   G+    +       ++ TK A P   G  +L   V+     + +A W    +  +V    +  L YR+ F  +      ++          +  + + G TY F L+            + +++PE  P   P +     ++   V   W  P +  RNG +I     Y E     +PL   L +T+N      L PN +Y +++R+ T V  GP+S   ++    +    PK         T + + W     + R PY
Sbjct:  479 TIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVP-GQPSKFQIGEVTDTTIELTWEPFEK-EGI-TRYELHYKEGSQ--GSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQAKPSAPPQEIKCSSPSSTSLLVSWRPP-PAESQNGPLAGYIVRYTMAGGGAESRADPAEDIQVPPTSSQITLQRLEKWTMYQVTVAAATAVGPG-PESLALTCRTDEDVPGAPPRRVEVEVINSTALKVM--WRSLLPGRQHGQIRGYQVHYVRVENGEARGLPLIKDVMLADAQWETDDTAEYEMVIGGLQPDTTYSITVAAYTTKGDGARSK-----PKLVVTKGAVP---GPPSL--WVHQDSENSAVARW----LPPEVVPPGLDILGYRLQFGRKDVLPMATLEFGPEEQEYSIPSMHR-GATYIFRLSAKSRSGFGEEAVQELSLPEQVPQGYPQITDGSNVTCCSVQFSWLPPVLAERNGAIIEYTLAYQEAGAAGIPLELRLPATENNYVLNSLKPNSIYDVKIRAHTSVGPGPFSPSVQYRTVALTTDVPKNFTVKLATRTTVLLTWKFSDSRFRQPY 1055          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Cavefish
Match: ptprsa (protein tyrosine phosphatase receptor type S [Source:NCBI gene;Acc:103028538])

HSP 1 Score: 307.375 bits (786), Expect = 4.621e-104
Identity = 167/362 (46.13%), Postives = 226/362 (62.43%), Query Frame = 2
Query: 4067 ILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            +L N  ++ +H     D V V  R NF         +  + +   IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ+S  +VM+ R EE    KC+ YWP +GT  Y   +VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     ++G E+EF++L
Sbjct: 1312 LLNNADITPHHPT---DPVEVR-RINF--------QTPGMMNHPPIPITELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEPGEHVTGMELEFKRL 1659          

HSP 2 Score: 93.5893 bits (231), Expect = 4.621e-104
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYIN+S+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1676 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1756          

HSP 3 Score: 202.216 bits (513), Expect = 1.737e-51
Identity = 117/315 (37.14%), Postives = 177/315 (56.19%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSRYTIP-IDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R     I KLA+    ++  +++  M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YIN+++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1603 MVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQ----VEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1911          

HSP 4 Score: 93.5893 bits (231), Expect = 1.979e-18
Identity = 68/273 (24.91%), Postives = 128/273 (46.89%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGC---TSFTIVARWRQPNKDAKNMTL 1741
            Y++  L P T Y I + + N++G+    + V+  T E  P  PP +I A  IS + + VRW+  E+ NG +K Y + +T     P   W+ ++   S  + I +L  +  + I + A  +VG GP S P+ +    G   +  +F+  ++   +I L W +P   + +  +    E+ YK    S  + +    +   S+ +  ++ +TE  F+L A +  G G     +     +AK +    + I C   +S +++  WR P  +++N  L
Sbjct:  379 YSIGGLSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEPEEPNGQIKGYRVFFTMDPSQPVSMWQIHNVHDSVITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSKFQIGEVTDTTIELTW-EPFEKEGITRY----ELHYKE--GSQGSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQAKPSAPPQE-IKCSSPSSTSLLVSWRPPPAESQNGPL 643          

HSP 5 Score: 88.9669 bits (219), Expect = 5.508e-17
Identity = 36/82 (43.90%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYINA+YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ ++EE  +++
Sbjct: 1391 KNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIK 1472          

HSP 6 Score: 73.559 bits (179), Expect = 2.463e-12
Identity = 67/289 (23.18%), Postives = 121/289 (41.87%), Query Frame = 2
Query:  803 ICWKLP---FNNLTIEQFVLHYE-SREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSV--EKINGILKKYILLWT-----EHSDLP--------HQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPT-KTLNCFGLNLEISYKS--PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            + W+ P     N  +  +++ Y  +    ES + P E I       Q  TL++L  +T Y++ + +  ++G      ++   T ED+P  PP  +    I++TA++V W+S+   + +G ++ Y + +      E   LP           W   D      +I  L P+  + IT+ A    G G  SKP  ++TK G +   P     +    S V  W  P+     L+  G  L+   K   P+ ++E         +  + I ++      +F L A ++ GFG
Sbjct:  629 VSWRPPPAESQNGPLAGYIVRYTMAGGGAESRADPAEDIQVPPTSSQI-TLQRLEKWTMYQVTVAAATAVGPGPESLALTCRTDEDVPGAPPRRVEVEVINSTALKVMWRSLLPGRQHGQIRGYQVHYVRVENGEARGLPLIKDVMLADAQWETDDTAEYEMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVVTK-GAVPGPPSLWVHQDSENSAVARWLPPEVVPPGLDILGYRLQFGRKDVLPMATLE-----FGPEEQEYSIPSMHRGATYIFRLSAKSRSGFG 910          

HSP 7 Score: 71.2478 bits (173), Expect = 1.199e-11
Identity = 120/601 (19.97%), Postives = 236/601 (39.27%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECP-EFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKI-----VNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIV-----SAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFT--RLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLI-----YNEVQI--MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPY 2656
            T++ L    TY I + +  S+G       +     + +P G P+      +++T +E+ W+  EK  GI  +Y L + E S        +  + S S ++  L  N  ++ ++ AV+N G G  +  ++  T     S  P E + S     S+++ W  P P ++ N       + Y       E++      + +        +  +++ T    T+ A   VG G P  L +          A   +  V++I  T+  ++  WR      ++  ++ ++      +NG++  L + + + +  ++++ D+   Y      L+P   Y I +  +   G+    +       ++ TK A P   G  +L   V+     + +A W    +  +V    +  L YR+ F  +      ++          +  + + G TY F L+            + +++PE  P   P +     ++   V   W  P +  RNG +I     Y E     +PL   L +T+N      L PN +Y +++R+ T V  GP+S   ++    +    PK         T + + W     + R PY
Sbjct:  479 TIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVP-GQPSKFQIGEVTDTTIELTWEPFEK-EGI-TRYELHYKEGSQ--GSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQAKPSAPPQEIKCSSPSSTSLLVSWRPP-PAESQNGPLAGYIVRYTMAGGGAESRADPAEDIQVPPTSSQITLQRLEKWTMYQVTVAAATAVGPG-PESLALTCRTDEDVPGAPPRRVEVEVINSTALKVM--WRSLLPGRQHGQIRGYQVHYVRVENGEARGLPLIKDVMLADAQWETDDTAEYEMVIGGLQPDTTYSITVAAYTTKGDGARSK-----PKLVVTKGAVP---GPPSL--WVHQDSENSAVARW----LPPEVVPPGLDILGYRLQFGRKDVLPMATLEFGPEEQEYSIPSMHR-GATYIFRLSAKSRSGFGEEAVQELSLPEQVPQGYPQITDGSNVTCCSVQFSWLPPVLAERNGAIIEYTLAYQEAGAAGIPLELRLPATENNYVLNSLKPNSIYDVKIRAHTSVGPGPFSPSVQYRTVALTTDVPKNFTVKLATRTTVLLTWKFSDSRFRQPY 1055          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Cavefish
Match: ptprsa (protein tyrosine phosphatase receptor type S [Source:NCBI gene;Acc:103028538])

HSP 1 Score: 307.375 bits (786), Expect = 4.699e-104
Identity = 167/362 (46.13%), Postives = 226/362 (62.43%), Query Frame = 2
Query: 4067 ILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            +L N  ++ +H     D V V  R NF         +  + +   IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ+S  +VM+ R EE    KC+ YWP +GT  Y   +VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     ++G E+EF++L
Sbjct: 1312 LLNNADITPHHPT---DPVEVR-RINF--------QTPGMMNHPPIPITELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEPGEHVTGMELEFKRL 1659          

HSP 2 Score: 93.5893 bits (231), Expect = 4.699e-104
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYIN+S+ID Y + KAYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1676 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1756          

HSP 3 Score: 202.601 bits (514), Expect = 1.325e-51
Identity = 117/315 (37.14%), Postives = 177/315 (56.19%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSRYTIP-IDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R     I KLA+    ++  +++  M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YIN+++IDGY +Q  YIATQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1603 MVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQ----VEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1911          

HSP 4 Score: 93.5893 bits (231), Expect = 1.979e-18
Identity = 68/276 (24.64%), Postives = 129/276 (46.74%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDA-KSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGC---TSFTIVARWRQPNKDAKNMTLQLF 1750
            Y++  L P T Y I + + N++G+    + V+  T E  P  PP +I A  IS + + VRW+  E+ NG +K Y + +T     P   W+ ++   S  + I +L  +  + I + A  +VG GP S P+ +    G   +  +F+  ++   +I L W +P   + +  +    E+ YK    S  + +    +   S+ +  ++ +TE  F+L A +  G G     +     +AK +    + I C   +S +++  WR P  +++N  L  +
Sbjct:  375 YSIGGLSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEPEEPNGQIKGYRVFFTMDPSQPVSMWQIHNVHDSVITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSKFQIGEVTDTTIELTW-EPFEKEGITRY----ELHYKE--GSQGSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQAKPSAPPQE-IKCSSPSSTSLLVSWRPPPAESQNGPLAGY 642          

HSP 5 Score: 88.9669 bits (219), Expect = 5.554e-17
Identity = 36/82 (43.90%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYINA+YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ ++EE  +++
Sbjct: 1391 KNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIK 1472          

HSP 6 Score: 73.559 bits (179), Expect = 2.422e-12
Identity = 67/289 (23.18%), Postives = 121/289 (41.87%), Query Frame = 2
Query:  803 ICWKLP---FNNLTIEQFVLHYE-SREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSV--EKINGILKKYILLWT-----EHSDLP--------HQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPT-KTLNCFGLNLEISYKS--PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            + W+ P     N  +  +++ Y  +    ES + P E I       Q  TL++L  +T Y++ + +  ++G      ++   T ED+P  PP  +    I++TA++V W+S+   + +G ++ Y + +      E   LP           W   D      +I  L P+  + IT+ A    G G  SKP  ++TK G +   P     +    S V  W  P+     L+  G  L+   K   P+ ++E         +  + I ++      +F L A ++ GFG
Sbjct:  625 VSWRPPPAESQNGPLAGYIVRYTMAGGGAESRADPAEDIQVPPTSSQI-TLQRLEKWTMYQVTVAAATAVGPGPESLALTCRTDEDVPGAPPRRVEVEVINSTALKVMWRSLLPGRQHGQIRGYQVHYVRVENGEARGLPLIKDVMLADAQWETDDTAEYEMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVVTK-GAVPGPPSLWVHQDSENSAVARWLPPEVVPPGLDILGYRLQFGRKDVLPMATLE-----FGPEEQEYSIPSMHRGATYIFRLSAKSRSGFG 906          

HSP 7 Score: 71.2478 bits (173), Expect = 1.149e-11
Identity = 120/601 (19.97%), Postives = 236/601 (39.27%), Query Frame = 2
Query:  938 TLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECP-EFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKI-----VNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIV-----SAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFE------KNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFT--RLKPSQKYQIRLT-FLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLI-----YNEVQI--MPLNQILNSTDNTISFYKL-PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPY 2656
            T++ L    TY I + +  S+G       +     + +P G P+      +++T +E+ W+  EK  GI  +Y L + E S        +  + S S ++  L  N  ++ ++ AV+N G G  +  ++  T     S  P E + S     S+++ W  P P ++ N       + Y       E++      + +        +  +++ T    T+ A   VG G P  L +          A   +  V++I  T+  ++  WR      ++  ++ ++      +NG++  L + + + +  ++++ D+   Y      L+P   Y I +  +   G+    +       ++ TK A P   G  +L   V+     + +A W    +  +V    +  L YR+ F  +      ++          +  + + G TY F L+            + +++PE  P   P +     ++   V   W  P +  RNG +I     Y E     +PL   L +T+N      L PN +Y +++R+ T V  GP+S   ++    +    PK         T + + W     + R PY
Sbjct:  475 TIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVP-GQPSKFQIGEVTDTTIELTWEPFEK-EGI-TRYELHYKEGSQ--GSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQAKPSAPPQEIKCSSPSSTSLLVSWRPP-PAESQNGPLAGYIVRYTMAGGGAESRADPAEDIQVPPTSSQITLQRLEKWTMYQVTVAAATAVGPG-PESLALTCRTDEDVPGAPPRRVEVEVINSTALKVM--WRSLLPGRQHGQIRGYQVHYVRVENGEARGLPLIKDVMLADAQWETDDTAEYEMVIGGLQPDTTYSITVAAYTTKGDGARSK-----PKLVVTKGAVP---GPPSL--WVHQDSENSAVARW----LPPEVVPPGLDILGYRLQFGRKDVLPMATLEFGPEEQEYSIPSMHR-GATYIFRLSAKSRSGFGEEAVQELSLPEQVPQGYPQITDGSNVTCCSVQFSWLPPVLAERNGAIIEYTLAYQEAGAAGIPLELRLPATENNYVLNSLKPNSIYDVKIRAHTSVGPGPFSPSVQYRTVALTTDVPKNFTVKLATRTTVLLTWKFSDSRFRQPY 1051          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Sea Lamprey
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 240.35 bits (612), Expect = 1.712e-83
Identity = 137/348 (39.37%), Postives = 198/348 (56.90%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKF--SKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNS--LSGFEIEFQKLNLQSTTINSNMSRIHGNATVNKQKTIL 5233
            IP+ + A ++  LK+ D +   QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YINANYIDGY + N YIA+QGPLA+T  DFW+MVWEQ+S+ IVM+ + EE    KC+ YWP +G+  Y  ++VTL   +  A Y+ R F + ++G + +R V Q QFT WPD G+P    P L+FL+  +    S +D GP IVHC       G F V     E      TV++Y Q+  +R QRN+MVQTE QY F++  L+E      +E     L + ++  SQ V +     +G  +EFQ+L +    +++  S   G    NK K  L
Sbjct:  180 IPVSEFAGHVERLKANDNMLFSQEYESIDPG--QQFTWDHSNLEINKHKNRYANVVAYDHSRVILHTIDGVPGSDYINANYIDGYRRHNAYIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVKCDQYWPNRGSESYGLVQVTLTDTVELATYSTRSFTLTRSGCTERRDVRQFQFTAWPDHGVPEFPTPVLAFLRRVRAAWGSSADGGPLIVHCRQRSDVCGCFFVGLFMQEGHYGCITVSLYLQVTCMRAQRNYMVQTEEQYAFVHTALVEAVSSGCTETPARSLHAHLQRLSQSVSHTEPRTTGLHLEFQRLQMSKLRVSTAPS---GALPCNKLKNRL 522          

HSP 2 Score: 89.7373 bits (221), Expect = 1.712e-83
Identity = 41/85 (48.24%), Postives = 57/85 (67.06%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYL-KTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMK 5460
            C   KN    +IP D +RVAL ++ G  GSDYINASYID Y  + +AYI +Q P+  T ED WR++W+QN +I+V+L K+ E  +
Sbjct:  515 CNKLKNRLLTVIPPDSSRVALQAIRGTQGSDYINASYIDGYRSQQRAYIATQGPLPETTEDLWRMLWEQNSTIVVMLTKLREMGR 599          

HSP 3 Score: 95.9005 bits (237), Expect = 3.564e-20
Identity = 49/103 (47.57%), Postives = 62/103 (60.19%), Query Frame = 2
Query: 4271 EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGY-GKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEE 4576
            EF+ L    L   ++ +  LP NK+KNR   +   D S V LQ        +YINA+YIDGY  +Q  YIATQGPL ET  D W+M+WEQ STI+VML +  E
Sbjct:  494 EFQRLQMSKLRVSTAPSGALPCNKLKNRLLTVIPPDSSRVALQAIRGTQGSDYINASYIDGYRSQQRAYIATQGPLPETTEDLWRMLWEQNSTIVVMLTKLRE 596          

HSP 4 Score: 94.3597 bits (233), Expect = 8.872e-20
Identity = 42/82 (51.22%), Postives = 59/82 (71.95%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   +++ +D +RV L ++ GV GSDYINA+YID Y +  AYI SQ P+A TV DFWR+VW+Q  S IV++ K+EE  +V+
Sbjct:  226 KNRYANVVAYDHSRVILHTIDGVPGSDYINANYIDGYRRHNAYIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVK 307          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 213.386 bits (542), Expect = 3.871e-69
Identity = 120/329 (36.47%), Postives = 185/329 (56.23%), Query Frame = 2
Query: 4199 TIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDH-CNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW--------NQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNL 5158
             + +  L E+I  +K+ +     +E+E   +     +     +  +N+ KNRY NI AYDHS V L N LD +   +YINANY+DGY + + YIATQGPL +T   FW+M+W+++S  I+M+    E    KC  YWP  G+ +Y DI+VTL      + Y IR F++++ G    R+V Q  FTGWPD G+P      L+F++  K      +GP +VHCSAG GRTG ++V+D  ++  + +  ++IY+ ++ +R +R  MVQTE QY FI+D +LE           G++     +ML    +S S  +++        EFQ LN+
Sbjct:  897 AVRVADLLEHIGQMKTGEGYGFKEEYESFFEGQSAPWDVAKRD--ENRAKNRYGNIIAYDHSRVML-NVLDEEQNSDYINANYVDGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYWPD-GSDVYGDIKVTLADTEMLSEYIIRTFRVERAGQEDIREVRQFHFTGWPDHGVPYHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLDMAESEGVIDIYNCVRELRTRRVNMVQTEEQYVFIHDAMLEACLCGDTCIPAGDFRAAYAEMLRPDPQSSSNHIKD--------EFQTLNM 1213          

HSP 2 Score: 68.5514 bits (166), Expect = 3.871e-69
Identity = 33/76 (43.42%), Postives = 54/76 (71.05%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIE 5448
            KN    ++P D     L +++G D S+YINA+ +DSY +  A+IV+Q P+ +TV+DFWRLV+D +C+ IV+L +++
Sbjct: 1234 KNRYHDVLPPDRCLPFLITING-DSSNYINAALMDSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVMLNELD 1308          

HSP 3 Score: 102.834 bits (255), Expect = 5.885e-22
Identity = 80/265 (30.19%), Postives = 120/265 (45.28%), Query Frame = 2
Query: 4271 EFEELNKET--LEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQI-----KQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSD---SGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            EF+ LN  T  L       + LP+N  KNRY ++   D  + P    ++ D  NYINA  +D Y + + +I TQ PL  T  DFW++V++   T IVML  NE   +K C  YWP++G   +  I+V  V+F        R F+I      Q+G    R V Q  + GWP              L +  +  + +    G T+VHC     R     ++        H   + I + ++ I      +V  ++QY F YDV LE+
Sbjct: 1207 EFQTLNMVTPPLRVEDCSIALLPRNHEKNRYHDVLPPDRCL-PFLITINGDSSNYINAALMDSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVML--NELDSNKYCPQYWPEEGMLCHGPIQVEFVAFNMEGDIITRTFRICNVARPQDGC---RMVEQFHYLGWPAGREVPTSRHSFLRLVLAAERWREEYGMDGRTVVHCLNPPPRLLSLPLLSLMATANNHMYQIIITELVEKIMAIYKGLVNLQSQYQFCYDVALEY 1465          

HSP 4 Score: 73.1738 bits (178), Expect = 6.643e-13
Identity = 36/107 (33.64%), Postives = 59/107 (55.14%), Query Frame = 1
Query: 5164 YNYQFEHVSNSW---KCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVRSIK 5475
            Y   FE  S  W   K +    KN   ++I +D +RV L+ +     SDYINA+Y+D Y +T  YI +Q P+  TV  FWR++W +  + I+++  + E  +++  K
Sbjct:  922 YESFFEGQSAPWDVAKRDENRAKNRYGNIIAYDHSRVMLNVLDEEQNSDYINANYVDGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCK 1028          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 194.126 bits (492), Expect = 2.795e-66
Identity = 126/348 (36.21%), Postives = 185/348 (53.16%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQG--PLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNG----FSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRIH-GNATVNKQK 5224
            + +D+L E  N   + D     +EF  L    ++      S   +NK KNRY NI  YD+  V L +       +YINA+Y++GY ++N++IA QG  P  ET  D+W+M+WE  +  IVM+   +E +  KC  YWP +G   Y ++ V++        YTIRKF I+  G        R + Q  FT WPD G+P   +  L FLK  K  +   +GP +VHCSAGVGRTG FIV+D+ ++ I+ +R V+++  +  IR QR  MVQT+ QY FIY  LLE+     +E+    L S ++           +G E EF+KL    TT+     ++  GN   N +K
Sbjct:  167 LAVDRLEEEFNRRSADDNKLFREEFNSLPSCPIQATCEAASK-EENKEKNRYVNILPYDNFRVHLTSLEGVPDSDYINASYVNGYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQGCWTYGNLRVSVEDVTVLVDYTIRKFLIQVVGDIPNKKPPRLITQFHFTSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAMLDMIQTERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLEFQLYGDTELEVTSLESHLQKLYNKNTPTGCTGLEDEFKKL----TTVKIQNEKMRTGNLPANMKK 509          

HSP 2 Score: 78.1814 bits (191), Expect = 2.795e-66
Identity = 36/78 (46.15%), Postives = 54/78 (69.23%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWD-QNCSIIVVLGKIEE 5451
            KN    +IP+D+NRV +    G + +DYIN S+ID Y +  A++  Q P+  TVEDFWR+VW+ ++CS IV+L ++EE
Sbjct:  509 KNRVLQIIPYDFNRVIIPMKRGEEFTDYINGSFIDGYRQKDAFLAGQGPLQQTVEDFWRMVWEWRSCS-IVMLTELEE 585          

HSP 3 Score: 183.726 bits (465), Expect = 7.511e-48
Identity = 98/258 (37.98%), Postives = 144/258 (55.81%), Query Frame = 2
Query: 4271 EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHS--IVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXX-XXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            EF++L    ++       NLP N  KNR   I  YD +  I+P++     +  +YIN ++IDGY +++ ++A QGPL +T  DFW+MVWE +S  IVML   EE   +KC  YWP +GT  Y DI + L    S   YT+R F +     +  RQ+ Q  F GWP+ GIP            + K+   + + P  VHCSAG GRTG F  + + +ER+K +  ++++  +K++R QR  MVQT  QY F Y V+ E+
Sbjct:  484 EFKKLTTVKIQNEKMRTGNLPANMKKNRVLQIIPYDFNRVIIPMKR--GEEFTDYINGSFIDGYRQKDAFLAGQGPLQQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWPTEGTITYGDIIIELKQENSHDSYTVRDFSVSNTRENKSRQIRQFHFHGWPEIGIPEDGKGMISLIAAVQKQQQHTGNHPITVHCSAGAGRTGTFCALCTILERVKTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEY 739          

HSP 4 Score: 69.3218 bits (168), Expect = 7.491e-12
Identity = 31/79 (39.24%), Postives = 52/79 (65.82%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQ--DPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   +++P+D  RV L+S+ GV  SDYINASY++ Y +   +I +Q   P   T+ D+WR++W+ N + IV++  ++E
Sbjct:  214 KNRYVNILPYDNFRVHLTSLEGVPDSDYINASYVNGYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKE 292          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Sea Lamprey
Match: ca16b (carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE-080818-1])

HSP 1 Score: 228.794 bits (582), Expect = 4.505e-63
Identity = 131/311 (42.12%), Postives = 180/311 (57.88%), Query Frame = 2
Query: 4199 TIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLE-KYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPL---DRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIK-------------QNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHC--SAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDML 5074
             +P+   A ++ ++      +  QEFEE+ + T +   ++ +SN P+NK KNRY NI AYDHS V L+ PL   D  H +YINANY+DGY +Q  YIA QGPL  T  DFW+MVWEQ + IIVM+    E   +KC+ YWP +    Y +I VTL S  + A YT+R F I+               G   +R V Q  +T WPD G P   LP L+F++          GP +VHC  SAGVGRTG +IV+DS +++I+   TVN+   +K IR QRN++VQ + QY FI++ LLE      +E+ P  L
Sbjct:   70 ALPVKLFARHVGEMHEGALHSFSQEFEEVQRCTADLGITAEHSNHPENKHKNRYVNIVAYDHSRVRLR-PLPGKDSKHSDYINANYVDGYNRQKAYIAAQGPLKATFADFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWPSESNEEYGNILVTLKSTRTLACYTVRHFTIRNTKLRKGTSQKSSARGRQNERLVVQFHYTQWPDMGTPDYALPVLTFVRKSSATRTDLMGPVVVHCRRSAGVGRTGTYIVLDSMLQQIRDSGTVNVLGFLKHIRTQRNYLVQPQEQYTFIHESLLEAVLTGETEVAPGQL 379          

HSP 2 Score: 96.2857 bits (238), Expect = 3.286e-20
Identity = 65/237 (27.43%), Postives = 108/237 (45.57%), Query Frame = 2
Query: 4337 NKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYY-DIEVTLV-----SFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLL 5029
            NK KNR ++I   + S V L +    +  +YINA+YI GY + NE+I TQ PL  T  DFW+M+W+  + IIVML   +     +  +YWP +   +   D  VTL+        +     I  F ++        +V   Q   WPD             + + ++ + +  GPTI+H   G    G F  + + + +++   +V+++   K +   R  +     QY F+Y   L
Sbjct:  432 NKEKNRNSSIVPVERSRVGLSSLSGLEGTDYINASYITGYYRSNEFIVTQHPLPHTTRDFWRMIWDHNAQIIVMLPDGQGLAEDE-SVYWPGREEAMNCDDFTVTLINEDRLCLANEEQLVIHDFILECLQDDYVLEVRHYQCPRWPD--TEGPLSNAFEIINVIREEATTRDGPTILHDEFGGVSAGTFCALTTLLHQLEEQESVDVFQVCKMVNLMRPGVFTDIEQYHFVYRAAL 665          

HSP 3 Score: 92.0485 bits (227), Expect = 5.979e-19
Identity = 41/88 (46.59%), Postives = 61/88 (69.32%), Query Frame = 1
Query: 5173 QFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVL 5436
            Q E  S +  CN +  +N+S  ++P + +RV LSS+SG++G+DYINASYI  Y ++  +IV+Q P+  T  DFWR++WD N  IIV+L
Sbjct:  421 QSEFFSATKHCNKEKNRNSS--IVPVERSRVGLSSLSGLEGTDYINASYITGYYRSNEFIVTQHPLPHTTRDFWRMIWDHNAQIIVML 506          

HSP 4 Score: 78.9518 bits (193), Expect = 6.841e-15
Identity = 36/79 (45.57%), Postives = 53/79 (67.09%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDG--SDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   +++ +D +RV L  + G D   SDYINA+Y+D Y + KAYI +Q P+ +T  DFWR+VW+QN  IIV++  + E
Sbjct:  120 KNRYVNIVAYDHSRVRLRPLPGKDSKHSDYINANYVDGYNRQKAYIAAQGPLKATFADFWRMVWEQNTGIIVMITNLVE 198          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008162.1 (pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-1 gene:ENSPMAG00000007379.1 transcript:ENSPMAT00000008162.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.904 bits (507), Expect = 2.726e-56
Identity = 139/367 (37.87%), Postives = 191/367 (52.04%), Query Frame = 2
Query: 4202 IPIDKLAEYINDL--KSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFST----KRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEA-------------------QYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRIHGNATVNKQK 5224
            +PI +L E   DL  +S D   + + EF  L  E  +      S   +NK KNRY NI  YD S V L         +YINA+YI+GY ++N++IA QGP  ET  DFW+M+WEQ ++ IVM+   +E +  KC  YWP KG   Y  + V++        YTIRKF ++  G        R V Q  FT WPD G+P   +  L FLK  K  + S SGP +VHCSAGVGRTG FIV+D+ ++ I+ ++ V+++  +  IR QR  MVQT+                    QY FIY  LLE+     +E+    L S ++  S    +  L G E EF+KL   S  I ++  R  GN   N +K
Sbjct:   15 VPIGRLEE---DLIRRSADECKLFRDEFNGLPSEHPQLMCEAASQ-EENKDKNRYINILPYDQSRVQLSPIESVPGSDYINASYINGYREKNKFIAAQGPKEETINDFWRMIWEQNTSTIVMVTNLQERKHTKCSQYWPDKGCWTYGSVRVSVEDITVLVDYTIRKFCVQLVGEGPGKHQARLVTQFHFTSWPDFGVPFTPIGMLKFLKKVKTSNPSYSGPIVVHCSAGVGRTGTFIVIDAMLDMIQAEQRVDVFGFVSRIRAQRCQMVQTDLQPLDCYLDSDFEQLASILIQYVFIYQALLEFQLYGDTELEVTSLESHLQRLSLRSPDTGLIGLEEEFRKLT--SVKIQNDRMR-AGNLPANMKK 374          

HSP 2 Score: 82.8037 bits (203), Expect = 1.282e-16
Identity = 35/77 (45.45%), Postives = 53/77 (68.83%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   +++P+D +RV LS +  V GSDYINASYI+ Y +   +I +Q P   T+ DFWR++W+QN S IV++  ++E
Sbjct:   62 KNRYINILPYDQSRVQLSPIESVPGSDYINASYINGYREKNKFIAAQGPKEETINDFWRMIWEQNTSTIVMVTNLQE 138          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 98.2117 bits (243), Expect = 3.734e-22
Identity = 91/295 (30.85%), Postives = 130/295 (44.07%), Query Frame = 2
Query: 4277 EELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYI--DGYGKQNE---YIATQGPLAETAYDFWQMVWEQ---KSTIIVMLVRNEETESKKCEIYWPKKG--------------------TRIYYDIEVTLVSFIS-RAYYTIRKFQIKQNG--FSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQM----------ERIKH-DRTVNIYDQ------IKAIRKQRNFMVQTEAQYGFIY 5017
            E  N     ++S   S  P+N  +NRY NI  Y+ + V L+     D   YINA+Y+  +  G+  E   YIATQGP  +T   FWQM +      + +IVM+    E   +KC  YWP+ G                    T+   D+++  V+    + YYT+   ++          + V+   F  W D   P   +P +     +     S   P IVHCSAGVGRTG FI +D  M          ER +H DR    Y +      +  +R QR  MVQT+ Q+ FIY
Sbjct:   32 EATNGTVNSRWSLGVSIEPRNDARNRYVNIMPYERNRVHLKTLSGND---YINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCA-HSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIY 322          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 87.0409 bits (214), Expect = 1.721e-17
Identity = 90/331 (27.19%), Postives = 137/331 (41.39%), Query Frame = 2
Query: 4334 QNKMKNRYANITAYDHSIVPLQN------------------------PLD-RDH-C---NYINANYID--GYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKG-TRIYYDIEVTLVSFISRAYYTIRKFQIKQ----------------NG--------FSTKRQVYQLQFTGWPDQ-GXXXXXXXXXXXXK-------------IYKKFSKSD---------------SGPTIVHCSAGVGRTGVFIVVDSQMERIK----HDRTVNIYDQ--------IKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            Q+  KNRY+NI  Y+HS V L +                        P+D ++H C   +YINANY+         +YIATQ PL  T  DFW+++   K  +I+ L  ++E   +K +IYW     +     ++ T  +  +     +R FQ+K+                NG         S    VYQLQ+  W D  G+ +  +  L  +K             + K   K D               S P +VHCSAG GRTGVF+ +D  +  +     H   +++++         +  +RKQR  MVQ   QY   Y+ LL +
Sbjct:  407 QSFTKNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYWNNLSYSNHTIKLQNTWENICNINGCVLRVFQVKKTAPQNDNISQDCDLPHNGDLTSITMAVSEPFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLNY 737          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 60.4622 bits (145), Expect = 2.398e-9
Identity = 54/196 (27.55%), Postives = 83/196 (42.35%), Query Frame = 2
Query: 4682 IRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKI---------YKKFSKSDSGPTI-VHCSAGVGRTGVFIVVDS-----------QMERIKHDRTVNIYDQIK----AIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRI 5194
            IRK  +  +      ++ Q+Q   WPD G  +  +  L  + +          + + ++D  PTI VHCSAG GRTG    +DS           Q E +K      ++D I       RKQR  MVQ   Q+ FIYD LL      Y  +  D +  +        +N SLS    + +KL +  T ++  +  +
Sbjct:  736 IRKILLTYHDQEKPYELLQIQVKNWPDLGTLLNPISILQAINVKNHIIDTLFARNYYQNDQLPTILVHCSAGCGRTGTLCTIDSILSNFEMFEMLQKEFVKLKYPAKLFDPISWTINIFRKQRISMVQNINQFIFIYDCLLF-----YFRLRLDDITERTDGDGSNKDNISLSALIEQIEKLEILQTFVDDKLKEL 926          

HSP 2 Score: 49.2914 bits (116), Expect = 7.116e-6
Identity = 34/117 (29.06%), Postives = 49/117 (41.88%), Query Frame = 2
Query: 4346 KNRYANITAYDHSIVPLQNPLD------RDHC--------NYINANYID----------------GYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYW 4606
            KNRY +I  Y+HS V L+  L         H         NYINANY+                    ++  YIATQ P+  T +DF+  +      +++ L  + E   +KC  YW
Sbjct:  530 KNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMPSTVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYW 646          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 269.24 bits (687), Expect = 5.868e-90
Identity = 144/318 (45.28%), Postives = 202/318 (63.52%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLN 5155
            I +  L ++I  LK+ +     QE+E +  E  + +++ +S +  NK KNRY NI AYDHS V L      +  +YINAN+ DGY K+  YIATQGP+  TA DFW+MVWEQ++  IVML R EE    KC+ YWP  GT +Y  IEV+LV ++  A YTI   QI + G S  R+V   QFTGWPD G+P    PFL+FL+  K ++  D+GP +VHCSAGVGRTG FIV+DS +ER++H+ TV+IY  +  +R QRN+MVQT+ QY F +D +LE      +E+    L+  IK  +++     ++G E EF+ ++
Sbjct: 1300 ISVLDLPKHIAILKADNNSQFTQEYESI--EPGQTFTADSSQMECNKGKNRYPNIHAYDHSRVRLSYINGIEGSDYINANFCDGYRKERAYIATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWPTDGTDVYEGIEVSLVDWVELANYTISTLQICKEGASQPREVKHFQFTGWPDHGVPAHPTPFLAFLRRVKFYNPPDAGPIVVHCSAGVGRTGCFIVIDSMLERLRHEETVDIYGHVTVLRTQRNYMVQTQEQYIFSHDAILEAVSCGNTEVHARNLLHHIKKLTEL-GKGEVTGLEEEFKVVD 1614          

HSP 2 Score: 83.1889 bits (204), Expect = 5.868e-90
Identity = 35/77 (45.45%), Postives = 56/77 (72.73%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   +++P++  RV +S + GV+GSDYINAS+ID Y +   +I +Q P+  TV+DFWR++ +QN +IIV+L ++ E
Sbjct: 1634 KNRLANILPYETTRVHISPVRGVEGSDYINASFIDGYRQRGLFIATQGPLQDTVDDFWRMLMEQNSNIIVMLTQLHE 1710          

HSP 3 Score: 168.703 bits (426), Expect = 9.841e-42
Identity = 97/274 (35.40%), Postives = 151/274 (55.11%), Query Frame = 2
Query: 4229 INDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPK-KGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            + +L   +   + +EF+ ++    +K+    + L  N+ KNR ANI  Y+ + V +      +  +YINA++IDGY ++  +IATQGPL +T  DFW+M+ EQ S IIVML +  E E +KC  YWP  +  R  Y I V  ++      + IR F++K     T R + Q  F GWP+ G+P              + Y++  + + GP  VHCS GVGRTGVF  +   +ER++ +  V+++  +K +R QR  MVQ++ QY F Y   LE+
Sbjct: 1595 LTELGKGEVTGLEEEFKVVDPSQAKKHKYGAATLAINRPKNRLANILPYETTRVHISPVRGVEGSDYINASFIDGYRQRGLFIATQGPLQDTVDDFWRMLMEQNSNIIVMLTQLHEGEWEKCYKYWPTDRSARHQYYI-VDPIAEHEYPQFVIRDFKVKDARSDTVRNIKQFHFLGWPETGVPKSGEGIIDLIGQVQRAYEQ--QEEEGPITVHCSDGVGRTGVFTALFIVLERMRSEGVVDLFQTVKLLRTQRPAMVQSQEQYLFCYKTALEY 1865          

HSP 4 Score: 90.5077 bits (223), Expect = 5.699e-18
Identity = 41/93 (44.09%), Postives = 62/93 (66.67%), Query Frame = 1
Query: 5188 SNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            ++S +  C   KN  P++  +D +RV LS ++G++GSDYINA++ D Y K +AYI +Q PM  T  DFWR+VW+Q    IV+L + EE  +V+
Sbjct: 1335 ADSSQMECNKGKNRYPNIHAYDHSRVRLSYINGIEGSDYINANFCDGYRKERAYIATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVK 1427          

HSP 5 Score: 85.5001 bits (210), Expect = 2.025e-16
Identity = 85/360 (23.61%), Postives = 154/360 (42.78%), Query Frame = 2
Query:  353 LLEDNNNLLTCESENVMGT--DSQTTKIRVFKH-EMSV--NFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDP 1417
            L E +N   +C + N +G    SQ    R+F +  +SV  + P  +L    K+     ++   +KC    S    + W  +   I+    E+          I+ I R   G Y C +   + G++     + +  +P   +       TS +  I W  P     +  + + Y  + + E     +++I N   G Q   +  L PF++Y   + ++NSLG+S+     ++ TSE  P   P +I A  +S+T+ +  W      NG ++ Y L ++         WR   + + S+ ++ LT    H+  I A N  G GPLS+ VA+ T+ G   +    + S +   +I + W+ P
Sbjct:  163 LRESDNGKYSCVARNALGMVFSSQAMPARLFIYLTLSVVRSKPEFTLRPQDKTV--DPDTDVELKCSARGSPTPSIVWEVDGSRISGQNGELI---------IRGIQR--SGNYSC-IADSNMGRVQAYAYVTVRLLPFAPSRPNAASITSDAIKITWH-PRGAHVVTSYEVQYRLKGKTE-----WQEITN-VRGMQSLVVSGLRPFSSYEFRVFAVNSLGRSRPSLMAEYTTSETKPGSAPRNIEAMGVSDTSFKAGWLPPISANGRIRGYRLYYSLDLLEDISQWRFMASSTNSTTVTGLTRQTTHFFRILAYNIAGDGPLSEVVAVKTQKGVPGQPRSVQLSVLSSTAIRVTWSPP 501          

HSP 6 Score: 53.5286 bits (127), Expect = 1.146e-6
Identity = 55/218 (25.23%), Postives = 83/218 (38.07%), Query Frame = 2
Query:  803 ICWKLP---FNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRW-KSVEKINGILKKYILLWTEHSD-----LPHQHWRQYDAKSESSLISHLT---PNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEF----RASKILLKSIVLEW 1408
            I W  P     N  I  F + Y ++ Q  +      K L          L  L  FT Y IW+ +    G          +T+ED+P G P  +     ++T + V+W     K +G +  Y++ +T   D      P       D+ SE +   HLT   P   + I + A    G G  ++ V  L K+   S  P F    RAS   +  + L W
Sbjct:  592 ISWDPPRPEHRNGLITHFTIKYRAKGQRGA------KYLTVDATKTSVVLHNLDKFTNYFIWVQASTKQGDGPFSDKHTVSTAEDVPNGAPRDVRIRVHNSTTMTVKWNPPTTKQDGKILGYMVFYTRVDDQGNQLRPPAQPESKDSMSEENHKVHLTGLAPETTYQIEVAAYTIKGDG--ARSVTRLAKTMAQSPDPPFVYLERASGDPISDVTLAW 801          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Nematostella
Match: EDO48187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK45])

HSP 1 Score: 246.899 bits (629), Expect = 9.171e-86
Identity = 142/344 (41.28%), Postives = 195/344 (56.69%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFE---IEFQKLNLQSTTINSNMSRIHGNATVNKQK 5224
            I ID   +++  ++    L    E+E +     E  ++ +S  P N+ KNRY NI AYDHS V LQ+  D    +YINAN++ GY + N YIA QGPLAET  DFW+MVWEQ S  I+ML   +E    KC  YWP +G+  Y DI VTL S      Y +R   +++ G    RQV Q  FT WPD G+P      L+F++   +     +GP +VHCSAGVGRTG FIV+D  +++I  ++TV+I   +  +R+ RN MVQTE QY FI+D LL+      +E     L S I+   ++ E +  SG+     EFQKL   S  INS++S       VNK+K
Sbjct:    1 ISIDDFEQHVARMRRSGDLFFTTEYERI--PVPEHVTATHSLDPVNQHKNRYINIVAYDHSRVKLQDFEDEPGSDYINANFLPGYRRDNAYIAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWPSRGSLSYEDITVTLDSVTELTPYIVRTLSVQREGCDDVRQVKQFHFTSWPDHGVPTSVCNLLAFVRDSTRADPPGAGPMVVHCSAGVGRTGTFIVIDVMLQQIHEEKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLDAIISGETETSASDLRSHIR---RLQEQDPESGYTPMFTEFQKL---SRCINSSLSLNAATHPVNKRK 336          

HSP 2 Score: 91.6633 bits (226), Expect = 9.171e-86
Identity = 39/82 (47.56%), Postives = 55/82 (67.07%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   +++P+D  RV LS   GV+GSDYINA+YID Y+  + +I +Q P+  T+ DFWR+VW+QNC  IV L +  E  K +
Sbjct:  336 KNRYANVLPYDVTRVRLSMQVGVEGSDYINANYIDGYMAKRTFIATQAPIPETIPDFWRMVWEQNCCTIVTLAQEVEQAKAK 417          

HSP 3 Score: 185.652 bits (470), Expect = 2.734e-49
Identity = 113/355 (31.83%), Postives = 171/355 (48.17%), Query Frame = 2
Query: 4028 INSSVTINNYDSPILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSN-----------VLKSRYTIPIDKLAEYINDLKSYD----YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYK--KFSKSDSG--PTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            ++ S  +    + I+ +  +   H+  T DI+          N  VQ               ++          L  +I  L+  D    Y  M  EF++L++      S   +  P NK KNRYAN+  YD + V L   +  +  +YINANYIDGY  +  +IATQ P+ ET  DFW+MVWEQ    IV L +  E    K   YWP K    +  + V +   +   +  +R F++     S  R V Q  +T W ++      L     + +    ++ +++SG  P IVHCSAGVGRTGVF  V   +ER+K +  V+++  +K +R+QR  MVQT+ QY F Y V+LE+
Sbjct:  215 VHCSAGVGRTGTFIVIDVMLQQIHEEKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLDAIISGETETSASDLRSHIRRLQEQDPESGYTPMFTEFQKLSRCINSSLSLNAATHPVNKRKNRYANVLPYDVTRVRLSMQVGVEGSDYINANYIDGYMAKRTFIATQAPIPETIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWPGKQPITFGSLVVEMQDKVKSGHLVVRIFKLTNTEVSASRDVRQFHYTSWTEENPLEDGLSRCQLIDLIGQVQYWQAESGRHPIIVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKGQYDFCYQVVLEY 569          

HSP 4 Score: 75.485 bits (184), Expect = 1.106e-13
Identity = 32/77 (41.56%), Postives = 49/77 (63.64%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   +++ +D +RV L       GSDYINA+++  Y +  AYI +Q P+A T  DFWR+VW+QN   I++L  ++E
Sbjct:   47 KNRYINIVAYDHSRVKLQDFEDEPGSDYINANFLPGYRRDNAYIAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKE 123          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Nematostella
Match: EDO45382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT25])

HSP 1 Score: 250.366 bits (638), Expect = 2.104e-85
Identity = 142/344 (41.28%), Postives = 205/344 (59.59%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEEL-NKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHC-NYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKS-DSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRIHGNATVNKQK 5224
            +P+D+  E++  L +   L   QE+    + +T+  + S+N     N+ KNRY NITA+DH  V LQ P++ D   +YINANY+DGY KQ EYIA QGPL ET +DFW+MVWEQ S +IVM+   EE    KC  YWP  G++ Y  I V ++S +  + YTIR F +K++G   +R V Q  +T WPD G+P      L+F++     + + D GP +VHCSAGVGRTG ++V+D+Q++RI+ + TV++Y+ +  +R QRN MVQ E QY  I+DVLLE      +EI    L  +IK   +   +   +  + EFQ+L+      +   S    N  VNK K
Sbjct:    1 MPVDEFEEHVRRLHANGELLFSQEYGAFRSPDTVTSHHSLNQ---ANRFKNRYNNITAFDHCRVLLQ-PIEGDPTSDYINANYLDGYRKQREYIAAQGPLPETCHDFWRMVWEQNSRVIVMVTNCEERGRIKCHQYWPSSGSQNYGVIHVNMMSTVELSDYTIRSFGVKRSGSPEERMVLQYHYTAWPDHGVPNSVTSVLNFVRKSSAVNLTEDYGPMVVHCSAGVGRTGTYVVIDAQLKRIQAEATVDVYNYVMMLRGQRNLMVQVEDQYVLIHDVLLEAIACGDTEIQARDLRQRIKELMRPSTDTGQTEMDAEFQRLSRNKAPPSKFQS---ANLPVNKHK 337          

HSP 2 Score: 86.6557 bits (213), Expect = 2.104e-85
Identity = 37/82 (45.12%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   +++P+D  RV L+  +  +GSDYINA+YID Y+  KA+I +Q P+  T+ DFWR++W+Q+C  IV+L +  E  KV+
Sbjct:  337 KNRYANVLPYDDTRVRLTMQAVTEGSDYINANYIDGYMSKKAFIATQAPIPDTIPDFWRMIWEQDCCTIVMLSQEMESGKVK 418          

HSP 3 Score: 181.03 bits (458), Expect = 9.191e-48
Identity = 106/261 (40.61%), Postives = 145/261 (55.56%), Query Frame = 2
Query: 4262 MMQEFEEL--NKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKF-SKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            M  EF+ L  NK    K+ S  +NLP NK KNRYAN+  YD + V L      +  +YINANYIDGY  +  +IATQ P+ +T  DFW+M+WEQ    IVML +  E+   K   YWP K      ++ V ++       Y +R+F++     S  R V Q QFT WPD G P      +  +   +++  K     T VHCSAGVGRTGVF  V   +ER+K +  V+++  +K +R+QR  MVQT+ QY F Y  L E+
Sbjct:  309 MDAEFQRLSRNKAPPSKFQS--ANLPVNKHKNRYANVLPYDDTRVRLTMQAVTEGSDYINANYIDGYMSKKAFIATQAPIPDTIPDFWRMIWEQDCCTIVMLSQEMESGKVKVHRYWPGKQPTSIGNLVVEMLHDKQFDDYIMREFKVTNTKESASRVVRQYQFTAWPDIGSPDSGGGLIDLIGQVQRWQQKCGVQLTAVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKEQYEFCYQTLGEY 567          

HSP 4 Score: 79.7221 bits (195), Expect = 5.518e-15
Identity = 35/82 (42.68%), Postives = 51/82 (62.20%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++  FD  RV L  + G   SDYINA+Y+D Y K + YI +Q P+  T  DFWR+VW+QN  +IV++   EE  +++
Sbjct:   47 KNRYNNITAFDHCRVLLQPIEGDPTSDYINANYLDGYRKQREYIAAQGPLPETCHDFWRMVWEQNSRVIVMVTNCEERGRIK 128          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Nematostella
Match: EDO31736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX30])

HSP 1 Score: 218.394 bits (555), Expect = 6.809e-71
Identity = 125/319 (39.18%), Postives = 180/319 (56.43%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGY-GKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLN 5155
            IPI    EY+  +++   + +  E+++ +    +++    +  P NK KNRYANI AYDHS V L+     +  +YINA++I GY G    +IA+QGPL     DFW+MVWEQ S  IVML    E    KC  YWP K T  Y  + VTL      A Y IR F + +   S  R V Q  FT WPD+G+P      L+F +  +  +  D+GP IVHCSAGVGRTG +IV+D+ +E+ K  RTV+I + + A+RK R  MVQT+ QY FI+  +LE      +EI  +     ++  + +     ++G+ +EFQK +
Sbjct:    2 IPIALFPEYVAKMQANGGIRLETEYKKFDNG--QQFPWEAARKPANKNKNRYANIVAYDHSRVVLERVNGDEDSDYINASFIHGYDGTPRSFIASQGPLPPAFEDFWRMVWEQNSQSIVMLTNLVELGKTKCHKYWPDK-TETYGGVTVTLHQSEIFAEYEIRTFILSKAKQSGSRMVRQFHFTVWPDKGVPQYATAVLAFRRKVRALNPRDAGPVIVHCSAGVGRTGAYIVIDAMLEQAKKSRTVDIRNYLIALRKDRPHMVQTKEQYSFIHSAVLEALTCGNTEIQSENCNQAMQKLASVNRKFQMTGYALEFQKFD 317          

HSP 2 Score: 70.4774 bits (171), Expect = 6.809e-71
Identity = 31/78 (39.74%), Postives = 50/78 (64.10%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEF 5454
            KN   +++ +D +R+ L  ++G + SDYINAS+I ++    A+I +Q P+  TVEDFWR+V D +   IV+L  + E 
Sbjct:  335 KNRYANIVAYDHSRLVLERVNGNEDSDYINASFIHAHRGRNAFIATQHPLLETVEDFWRMVTDYDIGTIVMLNNLHEL 412          

HSP 3 Score: 133.265 bits (334), Expect = 6.531e-32
Identity = 78/233 (33.48%), Postives = 120/233 (51.50%), Query Frame = 2
Query: 4331 PQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGX-XXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVL 5026
            P NK KNRYANI AYDHS + L+     +  +YINA++I  +  +N +IATQ PL ET  DFW+MV +     IVML    E + +  + YWP  G   Y  I V+++S   +      K ++ +       +V  L    WPD+ I  +         +      +  + P +V CS GVGR+G F  + S +ER+K ++ ++++  IK IR      V++  QY F Y ++
Sbjct:  330 PANKNKNRYANIVAYDHSRLVLERVNGNEDSDYINASFIHAHRGRNAFIATQHPLLETVEDFWRMVTDYDIGTIVMLNNLHELDQEYPK-YWPDHGPTKYGHIGVSVLSKQEQGDVICTKLKVTRKKVRRTHEVRHLHHVSWPDKCIPEVACSVLDLLDEAQTSQQQCGNAPVLVQCSNGVGRSGTFCAISSVLERLKTEQVIDVFQVIKRIRVNLPGAVESPTQYMFCYQII 561          

HSP 4 Score: 74.3294 bits (181), Expect = 2.869e-13
Identity = 36/86 (41.86%), Postives = 54/86 (62.79%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKT-KAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVRSIK 5475
            KN   +++ +D +RV L  ++G + SDYINAS+I  Y  T +++I SQ P+    EDFWR+VW+QN   IV+L  + E  K +  K
Sbjct:   48 KNRYANIVAYDHSRVVLERVNGDEDSDYINASFIHGYDGTPRSFIASQGPLPPAFEDFWRMVWEQNSQSIVMLTNLVELGKTKCHK 133          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Nematostella
Match: EDO43854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI9])

HSP 1 Score: 248.825 bits (634), Expect = 1.227e-70
Identity = 141/353 (39.94%), Postives = 203/353 (57.51%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEEL--NKETLEKYSSINSNLPQNKMKNRYANITAYDHS---IVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQ-NGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLN---LQSTTINSNMSRIHGNATVNKQKTIL 5233
            IP++  A ++  +     +   +E+E +  N ET   + S++   P NK KNRYANI AYDHS   + PL+  L+ D   YINANYIDGY +   +IA+QGPL ET  DFW+MVWEQ S IIVML + EE   +KC+ YWP +GTR Y  + VT       +YY +R F +         RQV Q  +T WPD G+P    P LS ++     +   +GP IVHCSAGVGRTG FI +DS ++R   + T++++  ++ +R +RN MVQTE+QY FI+D L+E      +E+  + L S+I+   ++  N   +  ++EF++L       T   S M  +  NA  N+   IL
Sbjct:    2 IPVEAFAMHVRRMHMDGDIGFSEEYEMVQPNDETFTWHHSLH---PANKYKNRYANIVAYDHSRVLLTPLEGVLESD---YINANYIDGYNRSGAFIASQGPLPETFDDFWRMVWEQGSAIIVMLTQLEERGRRKCDQYWPDRGTRNYGALRVTANETFHMSYYVLRTFLVSHMQEEEEPRQVRQYHYTSWPDHGVPAHPAPLLSMVRTVSSANPPTAGPMIVHCSAGVGRTGTFITLDSMLQRAAQEGTIDVFGFVRQMRNKRNLMVQTESQYVFIHDALVEAVICGVTEVDANKLASRIRELREVDPNIGTTYMDLEFERLTRDERHPTQFKSAM--LSCNAAKNRYANIL 346          

HSP 2 Score: 190.66 bits (483), Expect = 6.589e-51
Identity = 110/313 (35.14%), Postives = 168/313 (53.67%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYD------YLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTI-VHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V    ++ F ++  V+    V+     +  +KLA  I +L+  D      Y+++  EFE L ++        ++ L  N  KNRYANI  Y+ + V L         +YINA++IDG  +   YIATQ P+  T  DFW+M+WEQ+S +IVML R EE    KC  YWP  G+R+Y  I V L   ++ + Y +R+F +      + R V Q Q T WPD G+P   +  +  +   +K+ +      I VHCS GVGRTGVF  V   +ER+K +  ++++  ++ +R QR  MVQT+ QY F Y  + E+
Sbjct:  262 MVQTESQYVFIHDALVEA---VICGVTEVDANKLASRIRELREVDPNIGTTYMDL--EFERLTRDERHPTQFKSAMLSCNAAKNRYANILPYERTRVALHMRPGEVGSDYINASFIDGNHRLKAYIATQAPVPRTFEDFWRMLWEQESAVIVMLTREEEAGKLKCHRYWPSDGSRLYDKILVELTEELTYSDYVLRQFSLTHTEEKSSRIVRQFQCTDWPDSGLPESGVGLIDLIGQVEKWQQQSGNTCITVHCSGGVGRTGVFCAVSILIERVKAEGLIDVFQTVQHLRLQRPAMVQTKDQYEFCYTTIQEY 569          

HSP 3 Score: 86.6557 bits (213), Expect = 3.890e-17
Identity = 39/87 (44.83%), Postives = 58/87 (66.67%), Query Frame = 1
Query: 5206 NCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            +C   KN   +++P++  RVAL    G  GSDYINAS+ID   + KAYI +Q P+  T EDFWR++W+Q  ++IV+L + EE  K++
Sbjct:  334 SCNAAKNRYANILPYERTRVALHMRPGEVGSDYINASFIDGNHRLKAYIATQAPVPRTFEDFWRMLWEQESAVIVMLTREEEAGKLK 420          

HSP 4 Score: 85.5001 bits (210), Expect = 9.737e-17
Identity = 37/77 (48.05%), Postives = 56/77 (72.73%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   +++ +D +RV L+ + GV  SDYINA+YID Y ++ A+I SQ P+  T +DFWR+VW+Q  +IIV+L ++EE
Sbjct:   49 KNRYANIVAYDHSRVLLTPLEGVLESDYINANYIDGYNRSGAFIASQGPLPETFDDFWRMVWEQGSAIIVMLTQLEE 125          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 303.908 bits (777), Expect = 5.089e-103
Identity = 165/362 (45.58%), Postives = 226/362 (62.43%), Query Frame = 2
Query: 4067 ILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            +L N  ++ +H     D V V  R NF         +  + +   IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ++  +VM+ + EE    KC+ YWP +GT  Y   +VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     ++G E+EF++L
Sbjct: 1158 LLNNADITPHHPT---DPVEVR-RINF--------QTPGMLNHPPIPISELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQVESGEHVTGMELEFKRL 1505          

HSP 2 Score: 93.5893 bits (231), Expect = 5.089e-103
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYINAS+ID Y + +AYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1522 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1602          

HSP 3 Score: 202.986 bits (515), Expect = 8.189e-52
Identity = 119/316 (37.66%), Postives = 180/316 (56.96%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSR--YTIPIDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R  Y+  I KLA+    ++S +++  M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YI+TQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1449 MVQTEDQYSFIHDALLEAVACGNTEVAARSLYSY-IQKLAQ----VESGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYHAALEY 1757          

HSP 4 Score: 90.1225 bits (222), Expect = 2.102e-17
Identity = 37/82 (45.12%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYINA+YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ K+EE  +++
Sbjct: 1237 KNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIK 1318          

HSP 5 Score: 88.9669 bits (219), Expect = 4.719e-17
Identity = 54/224 (24.11%), Postives = 106/224 (47.32%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAK-SESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            Y++  L+P T Y I ++++N++G+    + V+  T E  P  PP ++    +    + V W+  E+ NG +K Y + +T  +  P  +W  ++ + S  + I  LTP   + I + A  +VG GP S P+ +    G   +  +F+   +   SI L W      + +  +    E+ Y+   +  +  I+       S+ + +++ +TE  F+L A +  G G
Sbjct:  367 YSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPEEPNGQIKGYRVYYTMDASQPMSNWHIHNVQDSVITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIWEPAHDKEAIRRY----ELRYRESNHGNQVGILKTFDPTKSYVVESLRPNTEYYFSLAAISDKGIG 586          

HSP 6 Score: 81.2629 bits (199), Expect = 1.027e-14
Identity = 80/330 (24.24%), Postives = 142/330 (43.03%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVE--KINGILKKYILLWT-----EHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYK--SPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG-MPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNG--KSFTLIVYR---TLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            L++L  +T Y I +++   +G     + +   T ED+P  PP  +    +++TA++V W+S+   K NG ++ Y + +      E   LP        A ++  +I  L P+  + IT+ A    G G  SKP  ++TK G +   P    ++    S V+ W+ PD T  ++  G  L+   K  +PL ++E         +  + + N+      +F + A ++ GFG   V  L V          + +    T  +++  W  P          L E+NG    +TL VY+   T  I R          Y    LKP+  Y++++
Sbjct:  671 LQRLGKWTQYHITVSAATVVGLGPESEPIICRTDEDVPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQNGQIRGYQVHYVRVENGESRGLPLIKDVML-ADAQEMVIGGLKPDTTYSITVAAYTTKGDGARSKPKLVVTK-GAVPGPPYLSVAQNSKTSAVVHWDPPDLTNGMDLQGYRLQFGRKDITPLATLE-----FAPQERRYSVDNIHRGATYLFKMAAKSRGGFGEEAVAELSVPENTPGGYPQIKEGSNVTCCSVLLSWSPP---------VLAERNGVITEYTL-VYKEAGTGEIPRELRLHPSLSSYVLNSLKPNSAYEVKM 983          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 304.294 bits (778), Expect = 5.528e-103
Identity = 156/317 (49.21%), Postives = 210/317 (66.25%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ++  +VM+ + EE    KC+ YWP +GT  Y   +VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     ++G E+EF++L
Sbjct: 1330 IPISELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQVESGEHVTGMELEFKRL 1644          

HSP 2 Score: 93.2041 bits (230), Expect = 5.528e-103
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYINAS+ID Y + +AYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1661 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1741          

HSP 3 Score: 203.371 bits (516), Expect = 7.288e-52
Identity = 119/316 (37.66%), Postives = 180/316 (56.96%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSR--YTIPIDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R  Y+  I KLA+    ++S +++  M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YI+TQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1588 MVQTEDQYSFIHDALLEAVACGNTEVAARSLYSY-IQKLAQ----VESGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYHAALEY 1896          

HSP 4 Score: 90.1225 bits (222), Expect = 2.434e-17
Identity = 37/82 (45.12%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYINA+YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ K+EE  +++
Sbjct: 1376 KNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIK 1457          

HSP 5 Score: 86.2705 bits (212), Expect = 3.542e-16
Identity = 55/224 (24.55%), Postives = 106/224 (47.32%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAK-SESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            Y++  L+P T Y I ++++N++G+    + V+  T E  P  PP ++    +    + V W+  E+ NG +K Y + +T  +  P  +W  ++ + S  + I  LTP   + I + A  +VG GP S P+ +    G   +  +F+   +   SI L W      + +  +    E+ Y+   +  + K     T   S+ + +++ +TE  F+L A +  G G
Sbjct:  380 YSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPEEPNGQIKGYRVYYTMDASQPMSNWHIHNVQDSVITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIWEPAHDKEAIRRY----ELRYRESNHGNQMKKTFDPTK--SYVVESLRPNTEYYFSLAAISDKGIG 597          

HSP 6 Score: 81.6481 bits (200), Expect = 9.688e-15
Identity = 80/330 (24.24%), Postives = 142/330 (43.03%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVE--KINGILKKYILLWT-----EHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYK--SPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG-MPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNG--KSFTLIVYR---TLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            L++L  +T Y I +++   +G     + +   T ED+P  PP  +    +++TA++V W+S+   K NG ++ Y + +      E   LP        A ++  +I  L P+  + IT+ A    G G  SKP  ++TK G +   P    ++    S V+ W+ PD T  ++  G  L+   K  +PL ++E         +  + + N+      +F + A ++ GFG   V  L V          + +    T  +++  W  P          L E+NG    +TL VY+   T  I R          Y    LKP+  Y++++
Sbjct:  682 LQRLGKWTQYHITVSAATVVGLGPESEPIICRTDEDVPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQNGQIRGYQVHYVRVENGESRGLPLIKDVML-ADAQEMVIGGLKPDTTYSITVAAYTTKGDGARSKPKLVVTK-GAVPGPPYLSVAQNSKTSAVVHWDPPDLTNGMDLQGYRLQFGRKDITPLATLE-----FAPQERRYSVDNIHRGATYLFKMAAKSRGGFGEEAVAELSVPENTPGGYPQIKEGSNVTCCSVLLSWSPP---------VLAERNGVITEYTL-VYKEAGTGEIPRELRLHPSLSSYVLNSLKPNSAYEVKM 994          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 304.294 bits (778), Expect = 5.860e-103
Identity = 156/317 (49.21%), Postives = 210/317 (66.25%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ++  +VM+ + EE    KC+ YWP +GT  Y   +VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     ++G E+EF++L
Sbjct: 1339 IPISELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQVESGEHVTGMELEFKRL 1653          

HSP 2 Score: 93.2041 bits (230), Expect = 5.860e-103
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYINAS+ID Y + +AYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1670 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1750          

HSP 3 Score: 203.371 bits (516), Expect = 7.901e-52
Identity = 119/316 (37.66%), Postives = 180/316 (56.96%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSR--YTIPIDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R  Y+  I KLA+    ++S +++  M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YI+TQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1597 MVQTEDQYSFIHDALLEAVACGNTEVAARSLYSY-IQKLAQ----VESGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYHAALEY 1905          

HSP 4 Score: 89.7373 bits (221), Expect = 2.765e-17
Identity = 37/82 (45.12%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYINA+YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ K+EE  +++
Sbjct: 1385 KNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIK 1466          

HSP 5 Score: 86.2705 bits (212), Expect = 3.637e-16
Identity = 55/224 (24.55%), Postives = 106/224 (47.32%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAK-SESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            Y++  L+P T Y I ++++N++G+    + V+  T E  P  PP ++    +    + V W+  E+ NG +K Y + +T  +  P  +W  ++ + S  + I  LTP   + I + A  +VG GP S P+ +    G   +  +F+   +   SI L W      + +  +    E+ Y+   +  + K     T   S+ + +++ +TE  F+L A +  G G
Sbjct:  380 YSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPEEPNGQIKGYRVYYTMDASQPMSNWHIHNVQDSVITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIWEPAHDKEAIRRY----ELRYRESNHGNQMKKTFDPTK--SYVVESLRPNTEYYFSLAAISDKGIG 597          

HSP 6 Score: 85.5001 bits (210), Expect = 6.181e-16
Identity = 81/338 (23.96%), Postives = 141/338 (41.72%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVE--KINGILKKYILLWT-----EHSDLP--------HQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYK--SPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG-MPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNG--KSFTLIVYR---TLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            L++L  +T Y I +++   +G     + +   T ED+P  PP  +    +++TA++V W+S+   K NG ++ Y + +      E   LP           W   D      +I  L P+  + IT+ A    G G  SKP  ++TK G +   P    ++    S V+ W+ PD T  ++  G  L+   K  +PL ++E         +  + + N+      +F + A ++ GFG   V  L V          + +    T  +++  W  P          L E+NG    +TL VY+   T  I R          Y    LKP+  Y++++
Sbjct:  682 LQRLGKWTQYHITVSAATVVGLGPESEPIICRTDEDVPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQNGQIRGYQVHYVRVENGESRGLPLIKDVMLADAQWETDDTAEYEMVIGGLKPDTTYSITVAAYTTKGDGARSKPKLVVTK-GAVPGPPYLSVAQNSKTSAVVHWDPPDLTNGMDLQGYRLQFGRKDITPLATLE-----FAPQERRYSVDNIHRGATYLFKMAAKSRGGFGEEAVAELSVPENTPGGYPQIKEGSNVTCCSVLLSWSPP---------VLAERNGVITEYTL-VYKEAGTGEIPRELRLHPSLSSYVLNSLKPNSAYEVKM 1003          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 303.908 bits (777), Expect = 6.693e-103
Identity = 156/317 (49.21%), Postives = 210/317 (66.25%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ++  +VM+ + EE    KC+ YWP +GT  Y   +VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     ++G E+EF++L
Sbjct: 1335 IPISELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQVESGEHVTGMELEFKRL 1649          

HSP 2 Score: 93.2041 bits (230), Expect = 6.693e-103
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYINAS+ID Y + +AYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1666 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1746          

HSP 3 Score: 202.986 bits (515), Expect = 8.802e-52
Identity = 119/316 (37.66%), Postives = 180/316 (56.96%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSR--YTIPIDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R  Y+  I KLA+    ++S +++  M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YI+TQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1593 MVQTEDQYSFIHDALLEAVACGNTEVAARSLYSY-IQKLAQ----VESGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYHAALEY 1901          

HSP 4 Score: 89.7373 bits (221), Expect = 2.834e-17
Identity = 37/82 (45.12%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYINA+YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ K+EE  +++
Sbjct: 1381 KNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIK 1462          

HSP 5 Score: 85.8853 bits (211), Expect = 4.090e-16
Identity = 55/224 (24.55%), Postives = 106/224 (47.32%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAK-SESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG 1603
            Y++  L+P T Y I ++++N++G+    + V+  T E  P  PP ++    +    + V W+  E+ NG +K Y + +T  +  P  +W  ++ + S  + I  LTP   + I + A  +VG GP S P+ +    G   +  +F+   +   SI L W      + +  +    E+ Y+   +  + K     T   S+ + +++ +TE  F+L A +  G G
Sbjct:  376 YSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPEEPNGQIKGYRVYYTMDASQPMSNWHIHNVQDSVITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIWEPAHDKEAIRRY----ELRYRESNHGNQMKKTFDPTK--SYVVESLRPNTEYYFSLAAISDKGIG 593          

HSP 6 Score: 85.1149 bits (209), Expect = 7.373e-16
Identity = 81/338 (23.96%), Postives = 141/338 (41.72%), Query Frame = 2
Query:  941 LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVE--KINGILKKYILLWT-----EHSDLP--------HQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYK--SPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFG-MPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNG--KSFTLIVYR---TLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRL 1885
            L++L  +T Y I +++   +G     + +   T ED+P  PP  +    +++TA++V W+S+   K NG ++ Y + +      E   LP           W   D      +I  L P+  + IT+ A    G G  SKP  ++TK G +   P    ++    S V+ W+ PD T  ++  G  L+   K  +PL ++E         +  + + N+      +F + A ++ GFG   V  L V          + +    T  +++  W  P          L E+NG    +TL VY+   T  I R          Y    LKP+  Y++++
Sbjct:  678 LQRLGKWTQYHITVSAATVVGLGPESEPIICRTDEDVPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQNGQIRGYQVHYVRVENGESRGLPLIKDVMLADAQWETDDTAEYEMVIGGLKPDTTYSITVAAYTTKGDGARSKPKLVVTK-GAVPGPPYLSVAQNSKTSAVVHWDPPDLTNGMDLQGYRLQFGRKDITPLATLE-----FAPQERRYSVDNIHRGATYLFKMAAKSRGGFGEEAVAELSVPENTPGGYPQIKEGSNVTCCSVLLSWSPP---------VLAERNGVITEYTL-VYKEAGTGEIPRELRLHPSLSSYVLNSLKPNSAYEVKM 999          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 304.294 bits (778), Expect = 7.402e-103
Identity = 156/317 (49.21%), Postives = 210/317 (66.25%), Query Frame = 2
Query: 4202 IPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKL 5152
            IPI +LAE+   LK+ D L + QE+E ++    ++++  +SNL  NK KNRYAN+ AYDHS V L         +YINANYIDGY KQN YIATQGPL ET  DFW+MVWEQ++  +VM+ + EE    KC+ YWP +GT  Y   +VTL+  I  A + +R F + +NG S KR+V Q QFT WPD G+P    PFL+FL+  K  +  D+GP I HCSAGVGRTG FIV+D+ +ERIKH++TV+IY  +  +R QRN+MVQTE QY FI+D LLE      +E+    L S I+  +Q+     ++G E+EF++L
Sbjct:  921 IPISELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQVESGEHVTGMELEFKRL 1235          

HSP 2 Score: 92.8189 bits (229), Expect = 7.402e-103
Identity = 38/81 (46.91%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 5209 CQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            C   KN   +++P++  RV L  + G++GSDYINAS+ID Y + +AYI +Q P+A T EDFWR++W+ N +I+V+L K+ E
Sbjct: 1252 CNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLRE 1332          

HSP 3 Score: 203.371 bits (516), Expect = 6.009e-52
Identity = 119/316 (37.66%), Postives = 180/316 (56.96%), Query Frame = 2
Query: 4118 IVNVSDRFNFFNN---DSVQVSSNVLKSR--YTIPIDKLAEYINDLKSYDYLNMMQ-EFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXX----XXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
            +V   D+++F ++   ++V   +  + +R  Y+  I KLA+    ++S +++  M+ EF+ L          I++NLP NK KNR  NI  Y+ + V LQ     +  +YINA++IDGY +Q  YI+TQGPLAET  DFW+M+WE  STI+VML +  E   +KC  YWP + +  Y    V  ++  +   Y +R+F++        R V Q QFT WP+QG+P              K  ++F +   GP  VHCSAGVGRTGVFI +   +ER++++  V+I+  +K +R QR  MVQTE +Y F Y   LE+
Sbjct: 1179 MVQTEDQYSFIHDALLEAVACGNTEVAARSLYSY-IQKLAQ----VESGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQ--DGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYHAALEY 1487          

HSP 4 Score: 90.5077 bits (223), Expect = 1.575e-17
Identity = 62/259 (23.94%), Postives = 120/259 (46.33%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAK-SESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWR 1708
            Y++  L+P T Y I ++++N++G+    + V+  T E  P  PP ++    +    + V W+  E+ NG +K Y + +T  +  P  +W  ++ + S  + I  LTP   + I + A  +VG GP S P+ +    G   +  +F+   +   SI L W      + +  +    E+ Y+   +  + K     T   S+ + +++ +TE  F+L A +  G G     ++    +A + KN   +   T  T+V  W+
Sbjct:  380 YSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPEEPNGQIKGYRVYYTMDASQPMSNWHIHNVQDSVITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIWEPAHDKEAIRRY----ELRYRESNHGNQMKKTFDPTK--SYVVESLRPNTEYYFSLAAISDKGIGAFTNEILQKTLQANVPKNFT-VKWATKTTVVLGWK 631          

HSP 5 Score: 89.3521 bits (220), Expect = 3.253e-17
Identity = 37/82 (45.12%), Postives = 57/82 (69.51%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV L+ + G+ GSDYINA+YID Y K  AYI +Q P+  T  DFWR+VW+Q  + +V++ K+EE  +++
Sbjct:  967 KNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIK 1048          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Planmine SMEST
Match: SMESG000042151.1 (SMESG000042151.1)

HSP 1 Score: 3399.37 bits (8813), Expect = 0.000e+0
Identity = 1716/1719 (99.83%), Postives = 1716/1719 (99.83%), Query Frame = 2
Query:   68 MYLITIYGYSETESEKPRIIFISDNNKVLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMGTDSQTTKIRVFKHEMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTDNTISFYKLPNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSVPENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSEKEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNSKFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSHEFSLIELKTNAKQNKLILPILALSRKPIQLFGNQPHYDFLFTYNFTKPNKMDRFSDGNFYRSALRACVETDEGHFLCNTSDWSESFQINFILQDELKVQNSKNTENILKPKHNDKAVXXXXXXXXXXXXAIVGIIIGCVVHKRKLPSKKWENSCRSSTPKIQQDAQMTPLVDLDTPKLDQEPYYLRTDQNYGFDTNNEVINYKNYINSSVTINNYDSPILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRIHGNATVNKQK 5224
            MYLITIYGYSETESEKPRIIFISDNNKVLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMGTDSQTTKIRVFKHEMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQISKPIKIIISDIPPPTTNVTVTERTSTSSVICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTDNTISFYKLPNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSVPENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSEKEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNSKFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSS EFSLIELKTNAKQNKLILPILALSRKPIQLFGNQPHYDFLFTYNFTKPNKMDRFSDGNFYRSALRACVETDEGHFLCNTSDWSESFQINFILQDELKVQNSKNTE ILKPKHNDKAVITLSLTLSGITLAIVGIIIGCVVHKRKLPSKKWENSCRSSTPKIQQDAQMTPLVDLDTPKLDQEPYYLRTDQNYGFDTNNEVINYKNYINSSVTINNYDSPILKNT VSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGIPILFLPFLSFLKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRIHGNATVNKQK
Sbjct:    1 MYLITIYGYSETESEKPRIIFISDNNKVLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMGTDSQTTKIRVFKHEMSVNFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQISKPIKIIISDIPPPTTNVTVTERTSTSSVICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTDNTISFYKLPNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSVPENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSEKEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNSKFDSNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSREFSLIELKTNAKQNKLILPILALSRKPIQLFGNQPHYDFLFTYNFTKPNKMDRFSDGNFYRSALRACVETDEGHFLCNTSDWSESFQINFILQDELKVQNSKNTEKILKPKHNDKAVITLSLTLSGITLAIVGIIIGCVVHKRKLPSKKWENSCRSSTPKIQQDAQMTPLVDLDTPKLDQEPYYLRTDQNYGFDTNNEVINYKNYINSSVTINNYDSPILKNTKVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGIPILFLPFLSFLKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIEFQKLNLQSTTINSNMSRIHGNATVNKQK 1719          

HSP 2 Score: 172.94 bits (437), Expect = 1.034e-42
Identity = 86/107 (80.37%), Postives = 90/107 (84.11%), Query Frame = 1
Query: 5152 QSSIYNYQFEHVSNSWKCNCQ*TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVRSI 5472
            QS+  N     +  +   N Q  KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMK  S+
Sbjct: 1698 QSTTINSNMSRIHGNATVNKQ--KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKELSL 1802          

HSP 3 Score: 132.88 bits (333), Expect = 1.835e-30
Identity = 81/261 (31.03%), Postives = 142/261 (54.41%), Query Frame = 2
Query: 4271 EFEELNKETL---EKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWP-KKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYK-KFSKSDSG---PTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLL 5029
            EF++LN ++       S I+ N   NK KN   ++  +D + V L +    D  +YINA+YID Y K   YI +Q P+A T  DFW++VW+Q  +IIV+L + EE   +    YWP +K  R  + +   +V + + + Y +R+F++        + V Q  ++ W +               I++ + +K + G   P +VHCS G G++G+FI +++ +E++  +  +++YD +K +++QR  +VQT  QY F Y  +L
Sbjct: 1691 EFQKLNLQSTTINSNMSRIHGNATVNKQKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKELSLPYWPVQKSIRYQFFVVDPMVEY-NMSNYIMREFKVTDARDGEFKTVRQFHYSKWLNN--ICPCDAHSFLEFIHQVQLTKENFGHGNPLLVHCSYGTGKSGIFIALNNILEKLNQESLIDVYDTVKLLQQQRVGLVQTVDQYKFCYLSIL 1948          

HSP 4 Score: 67.3958 bits (163), Expect = 1.222e-10
Identity = 33/77 (42.86%), Postives = 48/77 (62.34%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            KN   ++  +D + V L +    D  +YINA+YID Y K   YI +Q P+A T  DFW++VW+Q  +IIV+L + EE
Sbjct: 1427 KNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEE 1503          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Planmine SMEST
Match: SMESG000053906.1 (SMESG000053906.1)

HSP 1 Score: 436.417 bits (1121), Expect = 3.991e-147
Identity = 340/1108 (30.69%), Postives = 547/1108 (49.37%), Query Frame = 2
Query: 1967 PQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMP------LNQILNSTDNTISFYKLPNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILP-PKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLL-----GFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSE--PSVPENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSEKEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNSKFDSNITLSTNTHCDTKPIAPVLVLPPKIVQIST--FFIILQLMRTDERNGRIDYYHLIVVPYMSK--SKMVFEEYNKSSHEFSLIELKTNAKQNKLILPILALSRKPIQLF--GNQPHYDFLFTYNFTKPNKM--DRFSDGNF-YRSALRACVETDEGHFLCNTSDWSESFQINFILQDELKVQNSKNTENILKPKHNDKAVXXXXXXXXXXXXAIVGIIIGCVVHKRKLPSKKW-----ENSCRSSTPKIQQDAQMTPLVDLDTPKLDQEPYYLRTDQNYGFDTNNEVINYKNYINSSVTINNYDSPILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQ--IVENNSLSGFEIEFQKLNLQSTTINSNMSRIHG 5200
            P++V +  + TG + +  P +   W     F  +     Y ++YRI  P     +Y      ++S  +   + P +GVTYEF +A++       S  K I + E  PS+SP  + V  +      + WK       NG + + EV+           + +N ++ +     L    Y + VR+ T+V  G WS    +   ++E  P P  I+  R  +T+I + W        +P +  KNL      GF+I Y+  ++   +  W +  +        IK +E    Y  ++++ +     G +SE    +P+N    + ++KT  +L+C   +SN +++    P  +T L    + YSG + + + +  +  EF+  +  S+++      + + L++L  N  Y I +  IY     ++S+      T CDT P  P LV PP IV +      +I++L R  +RNG+I YY +IV  +      ++ F+E  +S   ++ +EL  N + N      +A+ +    +F    + H   L        N +  ++  + NF YR   R C++      LC +S WSE F+I+    D +  +N   + +         + I + L + G+ LA+  IIIGC+V KRK   +++      +  RSS     + + +  L+  D   +  E      D+ +  D     ++ K  I S   + N DS       +  +    +P +V+ S +    +  S  +S      R +I I  L +Y+ DLK+ D   +  EFE LN    ++++   SN+  NK KNRYAN+ AYDH+ V L    D    +YINANYIDGY +QN YIATQGPL +T  DFW+MVWEQ+S  IVM+ R EE    KC  YWP +G   Y  + V+ +     AYYTIR F+I+ + +S KR++   QFT WPD G+P L  P L F++  +   K +S P IVHCSAGVGRTG FIVVD+Q+ERIK ++ +++++ +  IR QRN+MVQT+AQY FI + LLE  +   +E++     + +   SQ  I  +N LSGFE+EF KLN    ++ SN  R HG
Sbjct:   37 PKTVTHIQISTGCS-EIRPCIEIHWNSSQHFSDI-DPIRYRIQYRITSPKSFKKEYPIQILTETSFRLNTHDKPGFGVTYEFRIAKFHKGKYGNSTIKSITLKESVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISW-------ELPVLSEKNLAHAAIEGFIILYAPVES---SPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKN--FPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESH----RETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTES---YTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNS-LCKSSPWSEPFRIS----DLILNRNVSLSSSKSSKDSYSNSSIIIILLVCGVILAVASIIIGCIV-KRKKSKERFMHLGNHDDIRSSIG--MKSSMLNGLMAADKIFVSAE-----VDEPFNSDKKYTSMSLKPDIKSIPDLVNADS-----VQMCQDGTKLSPVLVSDSIKLRIGSQKSENISD-----RPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLN----SLASNRGR-HG 1095          

HSP 2 Score: 107.457 bits (267), Expect = 3.991e-147
Identity = 43/78 (55.13%), Postives = 62/78 (79.49%), Query Frame = 1
Query: 5218 TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            TKN   ++IP++WNRV L+++ G++GSDYINASYID Y   +AYI +Q P+ STVEDFWR++WDQ+C +++VL +  E
Sbjct: 1113 TKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE 1190          

HSP 3 Score: 144.821 bits (364), Expect = 3.223e-34
Identity = 89/258 (34.50%), Postives = 136/258 (52.71%), Query Frame = 2
Query: 4298 LEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSG---PTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIV 5062
            L  +     N   N  KNR  NI  Y+ + V L      +  +YINA+YIDGY  +  YIA Q P+  T  DFW+M+W+Q   ++++L +  E +S    IYWP   +  Y    V  V   +   Y +R+F++        R + Q QFT WP+ G P      L F++   K +K   G   P ++HC+ G GRTGVFI +   ++R++ +  V++Y  +K + KQR  +VQTE QY F Y  +L++   NY +I+
Sbjct: 1098 LADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKS---HIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHK-TKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDY-LSNYEKIL 1350          

HSP 4 Score: 79.337 bits (194), Expect = 2.620e-14
Identity = 34/78 (43.59%), Postives = 53/78 (67.95%), Query Frame = 1
Query: 5218 TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            +KN   +++ +D   V L+ +  V GSDYINA+YID Y +  AYI +Q P+  T +DFWR+VW+Q  + IV++ ++EE
Sbjct:  813 SKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEE 890          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Planmine SMEST
Match: SMESG000053906.1 (SMESG000053906.1)

HSP 1 Score: 407.142 bits (1045), Expect = 2.610e-138
Identity = 315/1010 (31.19%), Postives = 505/1010 (50.00%), Query Frame = 2
Query: 2261 LIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMP------LNQILNSTDNTISFYKLPNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILP-PKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLL-----GFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSE--PSVPENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSEKEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNSKFDSNITLSTNTHCDTKPIAPVLVLPPKIVQIS--TFFIILQLMRTDERNGRIDYYHLIVVPYMSK--SKMVFEEYNKSSHEFSLIELKTNAKQNKLILPILALSRKPIQLF--GNQPHYDFLFTYNFTKPNKM--DRFSDGNF-YRSALRACVETDEGHFLCNTSDWSESFQINFILQDELKVQNSKNTENILKPKHNDKAVXXXXXXXXXXXXAIVGIIIGCVVHKRKLPSKKW-----ENSCRSSTPKIQQDAQMTPLVDLDTPKLDQEPYYLRTDQNYGFDTNNEVINYKNYINSSVTINNYDSPILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQ--IVENNSLSGFEIEFQKLNLQSTTINSNMSRIHG 5200
            L++  +  PS+SP  + V  +      + WK       NG + + EV+           + +N ++ +     L    Y + VR+ T+V  G WS    +   ++E  P P  I+  R  +T+I + W        +P +  KNL      GF+I Y+  ++   +  W +  +        IK +E    Y  ++++ +     G +SE    +P+N    + ++KT  +L+C   +SN +++    P  +T L    + YSG + + + +  +  EF+  +  S+++      + + L++L  N  Y I +  IY     ++S+      T CDT P  P LV PP IV +      +I++L R  +RNG+I YY +IV  +      ++ F+E  +S   ++ +EL  N + N      +A+ +    +F    + H   L        N +  ++  + NF YR   R C++      LC +S WSE F+I+    D +  +N   + +         + I + L + G+ LA+  IIIGC+V KRK   +++      +  RSS     + + +  L+  D   +  E      D+ +  D     ++ K  I S   + N DS       +  +    +P +V+ S +    +  S  +S      R +I I  L +Y+ DLK+ D   +  EFE LN    ++++   SN+  NK KNRYAN+ AYDH+ V L    D    +YINANYIDGY +QN YIATQGPL +T  DFW+MVWEQ+S  IVM+ R EE    KC  YWP +G   Y  + V+ +     AYYTIR F+I+ + +S KR++   QFT WPD G+P L  P L F++  +   K +S P IVHCSAGVGRTG FIVVD+Q+ERIK ++ +++++ +  IR QRN+MVQT+AQY FI + LLE  +   +E++     + +   SQ  I  +N LSGFE+EF KLN    ++ SN  R HG
Sbjct:  628 LVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISW-------ELPVLSEKNLAHAAIEGFIILYAPVES---SPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKN--FPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESH----RETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTES---YTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNS-LCKSSPWSEPFRIS----DLILNRNVSLSSSKSSKDSYSNSSIIIILLVCGVILAVASIIIGCIV-KRKKSKERFMHLGNHDDIRSSIG--MKSSMLNGLMAADKIFVSAE-----VDEPFNSDKKYTSMSLKPDIKSIPDLVNADS-----VQMCQDGTKLSPVLVSDSIKLRIGSQKSENISD-----RPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLN----SLASNRGR-HG 1590          

HSP 2 Score: 107.457 bits (267), Expect = 2.610e-138
Identity = 43/78 (55.13%), Postives = 62/78 (79.49%), Query Frame = 1
Query: 5218 TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            TKN   ++IP++WNRV L+++ G++GSDYINASYID Y   +AYI +Q P+ STVEDFWR++WDQ+C +++VL +  E
Sbjct: 1608 TKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE 1685          

HSP 3 Score: 271.937 bits (694), Expect = 5.070e-73
Identity = 225/792 (28.41%), Postives = 395/792 (49.87%), Query Frame = 2
Query:   98 ETESEKPRIIFISDNNKVLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMGTDSQTTKIRVFKHEMSV--NFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLPFNNLT-IEQFVLHYESREQIESVSIPFEKILNDF--------NGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTK-------TLNCFGLNLEI----SYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTL---QLF--EKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIY-HLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVS----EKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRN 2377
            +   E P+I  I  +  VL  +S+ ++C STG+PVP I W ++  PI  +       + + QN      F +K    S L+  +++  D+N++L CE+EN  G DS+  +++V   E  +   FP+   +++    +K  NS  T+ CQ + +    + WF+NYE INE   +I +    +   ++ + R+D+G YHC     +G ++S P  + I+  P    ++ +    S +  I W+   N++T  E F+LHY  RE  E+++   ++I++ F             Y LK L PFTTY IW+ S N LG S    ++   T    PQ  P SITA++ISNTA+ V W+  E+  G  K Y +++T +     QHWRQ+  K ++ +++HL  + +++I ++ VN +G GPLSK ++I T +GT+S+CP+F+ ++I    I L+W  PDP K        L C+ + L+I    +  S L+ + N   N++ N+  + ++ +K + EI   L A N  G GMP ++   +  K    +N++ I    S  I  +WR P+K + +  L   Q+F  EK  ++  L   + + I  S    + W +YN+T    S +Y + L +L     + +RE  + S+++ T K+ P       +   ++     + +  W+ +   D+V S+ I  H + R   P +  +  R I  +++S ++  L+   Y V Y     + G  S    +    + L   P       P+ IK    SE ++ + W+ P +  +N
Sbjct:    3 DKHKEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEEL----KSPLKKLQNP--PRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPV--FQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQ-VTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHY--REVPENIT--EKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNH--NLSMNEMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIK-INISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSN---SALVSWKPL---DQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHY-VIYVRAFTKVGGGSWSNPKNYYRQNLEEFP------IPTTIKGERKSETEINISWELPVLSEKN 764          

HSP 4 Score: 146.362 bits (368), Expect = 1.310e-34
Identity = 89/258 (34.50%), Postives = 136/258 (52.71%), Query Frame = 2
Query: 4298 LEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSG---PTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIV 5062
            L  +     N   N  KNR  NI  Y+ + V L      +  +YINA+YIDGY  +  YIA Q P+  T  DFW+M+W+Q   ++++L +  E +S    IYWP   +  Y    V  V   +   Y +R+F++        R + Q QFT WP+ G P      L F++   K +K   G   P ++HC+ G GRTGVFI +   ++R++ +  V++Y  +K + KQR  +VQTE QY F Y  +L++   NY +I+
Sbjct: 1593 LADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKS---HIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHK-TKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDY-LSNYEKIL 1845          

HSP 5 Score: 79.337 bits (194), Expect = 3.210e-14
Identity = 34/78 (43.59%), Postives = 53/78 (67.95%), Query Frame = 1
Query: 5218 TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            +KN   +++ +D   V L+ +  V GSDYINA+YID Y +  AYI +Q P+  T +DFWR+VW+Q  + IV++ ++EE
Sbjct: 1308 SKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEE 1385          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Planmine SMEST
Match: SMESG000053906.1 (SMESG000053906.1)

HSP 1 Score: 406.371 bits (1043), Expect = 4.672e-138
Identity = 315/1010 (31.19%), Postives = 505/1010 (50.00%), Query Frame = 2
Query: 2261 LIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMP------LNQILNSTDNTISFYKLPNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILP-PKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLL-----GFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSE--PSVPENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSEKEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNSKFDSNITLSTNTHCDTKPIAPVLVLPPKIVQIS--TFFIILQLMRTDERNGRIDYYHLIVVPYMSK--SKMVFEEYNKSSHEFSLIELKTNAKQNKLILPILALSRKPIQLF--GNQPHYDFLFTYNFTKPNKM--DRFSDGNF-YRSALRACVETDEGHFLCNTSDWSESFQINFILQDELKVQNSKNTENILKPKHNDKAVXXXXXXXXXXXXAIVGIIIGCVVHKRKLPSKKW-----ENSCRSSTPKIQQDAQMTPLVDLDTPKLDQEPYYLRTDQNYGFDTNNEVINYKNYINSSVTINNYDSPILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQ--IVENNSLSGFEIEFQKLNLQSTTINSNMSRIHG 5200
            L++  +  PS+SP  + V  +      + WK       NG + + EV+           + +N ++ +     L    Y + VR+ T+V  G WS    +   ++E  P P  I+  R  +T+I + W        +P +  KNL      GF+I Y+  ++   +  W +  +        IK +E    Y  ++++ +     G +SE    +P+N    + ++KT  +L+C   +SN +++    P  +T L    + YSG + + + +  +  EF+  +  S+++      + + L++L  N  Y I +  IY     ++S+      T CDT P  P LV PP IV +      +I++L R  +RNG+I YY +IV  +      ++ F+E  +S   ++ +EL  N + N      +A+ +    +F    + H   L        N +  ++  + NF YR   R C++      LC +S WSE F+I+    D +  +N   + +         + I + L + G+ LA+  IIIGC+V KRK   +++      +  RSS     + + +  L+  D   +  E      D+ +  D     ++ K  I S   + N DS       +  +    +P +V+ S +    +  S  +S      R +I I  L +Y+ DLK+ D   +  EFE LN    ++++   SN+  NK KNRYAN+ AYDH+ V L    D    +YINANYIDGY +QN YIATQGPL +T  DFW+MVWEQ+S  IVM+ R EE    KC  YWP +G   Y  + V+ +     AYYTIR F+I+ + +S KR++   QFT WPD G+P L  P L F++  +   K +S P IVHCSAGVGRTG FIVVD+Q+ERIK ++ +++++ +  IR QRN+MVQT+AQY FI + LLE  +   +E++     + +   SQ  I  +N LSGFE+EF KLN    ++ SN  R HG
Sbjct:  660 LVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISW-------ELPVLSEKNLAHAAIEGFIILYAPVES---SPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKN--FPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESH----RETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTES---YTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNS-LCKSSPWSEPFRIS----DLILNRNVSLSSSKSSKDSYSNSSIIIILLVCGVILAVASIIIGCIV-KRKKSKERFMHLGNHDDIRSSIG--MKSSMLNGLMAADKIFVSAE-----VDEPFNSDKKYTSMSLKPDIKSIPDLVNADS-----VQMCQDGTKLSPVLVSDSIKLRIGSQKSENISD-----RPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLN----SLASNRGR-HG 1622          

HSP 2 Score: 107.457 bits (267), Expect = 4.672e-138
Identity = 43/78 (55.13%), Postives = 62/78 (79.49%), Query Frame = 1
Query: 5218 TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            TKN   ++IP++WNRV L+++ G++GSDYINASYID Y   +AYI +Q P+ STVEDFWR++WDQ+C +++VL +  E
Sbjct: 1640 TKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE 1717          

HSP 3 Score: 271.552 bits (693), Expect = 6.776e-73
Identity = 226/797 (28.36%), Postives = 396/797 (49.69%), Query Frame = 2
Query:   83 IYGYSETESEKPRIIFISDNNKVLAGESLFISCISTGNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLIFKKVLLEDNNNLLTCESENVMGTDSQTTKIRVFKHEMSV--NFPMVSLEDSSKSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKFSIKNIMRKDEGTYHCFVTGHSGGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICWKLPFNNLT-IEQFVLHYESREQIESVSIPFEKILNDF--------NGWQCYTLKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPDPTK-------TLNCFGLNLEI----SYKSPLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMTL---QLF--EKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFNLKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIY-HLKYRIIFPAELSTKYRSIYTNKSSHVIQLLELPKYGVTYEFVLARYGNVS----EKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRN 2377
            I    +   E P+I  I  +  VL  +S+ ++C STG+PVP I W ++  PI  +       + + QN      F +K    S L+  +++  D+N++L CE+EN  G DS+  +++V   E  +   FP+   +++    +K  NS  T+ CQ + +    + WF+NYE INE   +I +    +   ++ + R+D+G YHC     +G ++S P  + I+  P    ++ +    S +  I W+   N++T  E F+LHY  RE  E+++   ++I++ F             Y LK L PFTTY IW+ S N LG S    ++   T    PQ  P SITA++ISNTA+ V W+  E+  G  K Y +++T +     QHWRQ+  K ++ +++HL  + +++I ++ VN +G GPLSK ++I T +GT+S+CP+F+ ++I    I L+W  PDP K        L C+ + L+I    +  S L+ + N   N++ N+  + ++ +K + EI   L A N  G GMP ++   +  K    +N++ I    S  I  +WR P+K + +  L   Q+F  EK  ++  L   + + I  S    + W +YN+T    S +Y + L +L     + +RE  + S+++ T K+ P       +   ++     + +  W+ +   D+V S+ I  H + R   P +  +  R I  +++S ++  L+   Y V Y     + G  S    +    + L   P       P+ IK    SE ++ + W+ P +  +N
Sbjct:   30 INAMKDKHKEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEEL----KSPLKKLQNP--PRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPV--FQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQ-VTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHY--REVPENIT--EKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNH--NLSMNEMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIK-INISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSN---SALVSWKPL---DQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHY-VIYVRAFTKVGGGSWSNPKNYYRQNLEEFP------IPTTIKGERKSETEINISWELPVLSEKN 796          

HSP 4 Score: 146.362 bits (368), Expect = 1.367e-34
Identity = 89/258 (34.50%), Postives = 136/258 (52.71%), Query Frame = 2
Query: 4298 LEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSG---PTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIV 5062
            L  +     N   N  KNR  NI  Y+ + V L      +  +YINA+YIDGY  +  YIA Q P+  T  DFW+M+W+Q   ++++L +  E +S    IYWP   +  Y    V  V   +   Y +R+F++        R + Q QFT WP+ G P      L F++   K +K   G   P ++HC+ G GRTGVFI +   ++R++ +  V++Y  +K + KQR  +VQTE QY F Y  +L++   NY +I+
Sbjct: 1625 LADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKS---HIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHK-TKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDY-LSNYEKIL 1877          

HSP 5 Score: 79.337 bits (194), Expect = 3.063e-14
Identity = 34/78 (43.59%), Postives = 53/78 (67.95%), Query Frame = 1
Query: 5218 TKNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEE 5451
            +KN   +++ +D   V L+ +  V GSDYINA+YID Y +  AYI +Q P+  T +DFWR+VW+Q  + IV++ ++EE
Sbjct: 1340 SKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEE 1417          
BLAST of Tyrosine-protein phosphatase Lar-like vs. Planmine SMEST
Match: SMESG000041927.1 (SMESG000041927.1)

HSP 1 Score: 421.394 bits (1082), Expect = 2.532e-136
Identity = 397/1496 (26.54%), Postives = 677/1496 (45.25%), Query Frame = 2
Query:  935 YTLKKLHPFTTYRIWINSLN-SLGKSQVGKSVKFNTSEDLPQGPPTSITASAISNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLISHLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLKSIVLEWNDPD-PTKTLNCFGLNLEISYKS------PLYSMENKIVNITTNQFSFEIHNVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFTIVARWRQPNKDAKNMT--------LQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIYNFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAH--PQSVGNFNL-------KTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAEL--STKYRSIYT-------NKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPSESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMP--LNQILNSTDNTISFYKL-----PNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAFRVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQIKIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSVPENVDLSSYSIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNPESVEFVSE-KEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTN--SKFDSNITLSTNTHCDTKPIAPVLVLPPKIVQI--STFFIILQLMRTDERNGRIDYYHLIVVPYMSKSKMVFEEYNKSSHEFSLIELKTNAKQNKLILPILALSRKPIQLFGNQPHYDF-----LFTYNFTKP--------NKMDRFSDGNFYRSALRACVETD------EGHFLCNTSDWSESFQINFILQDELKVQNSKNTENILKPKHNDK-AVXXXXXXXXXXXXAIVGIIIGCVVHKRKLPSKKWENSCR----SSTPKIQQDAQMTPLVDLDTPKLDQEPYYLRTDQNYGFDTNNEVINYKNYINSSVTINNYDSPILKNTTVSANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDLKSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYD--IEVTLVSFISRAYYTIRKFQIKQ------NGFSTKRQVYQLQFTGWPDQGXXXXXXXXXXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIV-------ENNSLSGFEIEFQKLNLQST 5167
            Y +  L P+T Y + + + + +LG S   K++   T E  P  PP S+ A+A + T++ V+W    + NG +  Y + ++ +   P   W++ +   +   I+ L  N  ++I + AVN+ G GP+S+P  I+ + G   +   FR + I   SI L W+ P  P+K +    L+  + YK       P  + + + + I  ++  + +  +  +T    +L A  + G G+   + + +  +   +   +D+   +  +I  RWR+   + ++++        L+  E    S  + V       +++ Q D ++ Y    L+  Q Y+I L    VG       + ++ ++++T+  +  P    N  L       ++G+ L     ++A+    P  +   +   Y +++ ++ P  L  S K RS+           +++  +  EL  YG  YEF +A        L VK  ++  E  P   P  I +  ++   V + W+ P ++  NG L+  +V      L      T +T + Y L      N +Y  +VR+ T+V  GPWS    F    +   PP  I A R+ + +I+V W + +  N         ++GF IYY  +       + + + +   ++   + N++    Y V + S    NR G  S  +  +  +L      + S+L+C +    S+E++   P  +  L+   VT +G   +      E  +F S  K   +D+  K   F L LKD++ N  Y I +  +Y  +  S F   I    NT C T    P  V  P+I+ +  ++  I L+++R  E  G I  Y+LI+   +   K  F +Y+     F  ++  +    +  IL +   S     +F    +  F     ++   ++KP         +   F     Y+  LRAC+ T+      +  + C  S WS  F  NF        + S     +L  K  D   V  +++ +    +A++ I +GC + +R+   K++ NS +    +  P ++Q         L +  +   P Y+    + G  T+                         ++++ +N +NT                        ++     IP   LA+YI  LK+ D     +E+E ++      ++ I SNL  NK KNRYAN+ AYDHS V L    D    +YINANY DGY KQN YIATQGPL ET   FW+MVWE +  +IVM+ + EE    KC+ YWP +G+  Y +  + +  +  +  AYYT+RKF + +      NG    R V+  QFTGWPD G+P   LP L F+K  +    SDSGP +VHCSAGVGRTG +IV+DSQ+ +I+H++ V++Y  +  +R QRN+MVQTE QY FIYD LLE +    +E+    L + +    Q +        N   +G E+EF+ L+  ST
Sbjct:  356 YNVTDLRPYTKYSVKVIAFSKTLGDSDPSKTIVIETKELPPSSPPQSVYATADTFTSITVKWAPPIEANGKITDYNVYYSRNLQHPINQWQKSETTRQHVRITDLFTNNTYHIKVNAVNSAGPGPVSEPFPIIVRPGVPPQPHNFRGAGITSTSINLIWSPPQLPSKLVL---LDYVLKYKVISGKHIPTLTNKEEEIKILPDRTDYRMTELWPNTLYHISLAARTEHGVGVSNTMNVRTENRVPNSPIGIDVRTLSPTSIAIRWRKGMDNEESISSFKIKVIKLKSIETVDNSNEMHVQIQSVPAKTKNQSDIYE-YIINDLETGQNYKIVL--WSVGSSG--LSAPFIFDIVKTRPGNIVPSPPLNIRLNQLRQKTESGLTL-----LLADIAWDPPINSHGTIKAYRIRHNLVGPQNLIESLKRRSLSVKVYEKNVTGTNYCTEFGEL-GYGKVYEFSVAAMNTADIGLEVKLNVSTRESAPDSYPVSIDITGITSHSVNISWQPPLVENHNGILVNYQVAYFTYGLKNTTIRTTSTPNLYALIEGLQENMLYTFQVRAFTKVGQGPWSSDVNFRTVVLLPDPPINIEASRINENQIKVTWELSHTNN-------IKVVGFKIYYCLQTIPKDIESCNTLDV-GPVTMVTLGNVQYNSDYQVGIKSKGIDNRYGLISNIATAKISELPVIRDLSVSSLKC-EGKVRSMEIQWQKPKTHDNLSKFRVTINGYASYTKETG-EVEKFKSSFKPREVDFVDKYIKFVLGLKDMSPNMVYDISVQTVYKRDGESSFYGAIQ---NTSCRTLMARPKFVSTPEIILVNRTSLSIYLRILRVTEHLGIIRTYYLIIEESIHTQKTNFSKYS-----FESLQSASKPISDSPIL-VAEFSN---DIFKKGSNISFWVGQDIWRSQYSKPIYNTDSLLMRPIMFDMKKSYKMFLRACIFTEITSFANDDFYPCTDSSWSRLF--NF--------EESPAINKLLPKKQTDVFTVSIIAIIIGLGVIALISIAVGCFMKRRR--PKRYYNSPQELIMNGDPSLKQA--------LISQAVSGPPSYVPLSHSNGIVTD------------------------MDSSIKSNFKNT------------------------IVNKHPPIPSGHLADYIAALKTNDNAKFTEEYESIDPG--HHFTWIQSNLEINKPKNRYANVIAYDHSRVVLSTLNDIPGSDYINANYCDGYRKQNAYIATQGPLPETFEAFWRMVWESRCALIVMMTKLEERLRVKCDQYWPTRGSEAYAESGLSINHLETVELAYYTMRKFSLTKKLSSDPNGSKETRDVFHFQFTGWPDHGVPDTALPLLMFIKRVRSCCPSDSGPIVVHCSAGVGRTGAYIVLDSQLSQIQHEKVVDVYGIVSRLRAQRNYMVQTEEQYVFIYDALLEASLCGNTEVSIRHLHAHVTKLKQPLPVLGVTPSNQYSTGMELEFKHLSELST 1745          

HSP 2 Score: 86.6557 bits (213), Expect = 2.532e-136
Identity = 37/80 (46.25%), Postives = 55/80 (68.75%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMK 5460
            KN   +++P++  RV L  +   DGSDYINAS+ID Y   KAYI +Q P+A+T+ DFWR++W  N SI+V+L ++ E  +
Sbjct: 1761 KNRLINILPYENRRVCLQPIRNQDGSDYINASFIDGYRSQKAYIATQGPLANTIVDFWRMLWQHNSSIVVMLSQLREMGR 1840          

HSP 3 Score: 189.504 bits (480), Expect = 1.031e-47
Identity = 99/264 (37.50%), Postives = 154/264 (58.33%), Query Frame = 2
Query: 4259 NMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIVPLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQKSTIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRKFQIKQNGFSTK-RQVYQLQFTGWPDQGXXXXXXXX----XXXXKIYKKFSKSDSGPTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQTEAQYGFIYDVLLEW 5035
             M  EF+ L++ +        +NLP+N++KNR  NI  Y++  V LQ   ++D  +YINA++IDGY  Q  YIATQGPLA T  DFW+M+W+  S+I+VML +  E   +KC  YWP + +  +  I V  +   +   + +R+F+++ +   T  R + Q QF  W +QG+P              K  ++F +   GP  VHCSAGVGRTGVF+ +   ++R++ + T++++  ++ +R QR  MVQTE QY F Y   LE+
Sbjct: 1732 GMELEFKHLSELSTRPRQFNTANLPENRLKNRLINILPYENRRVCLQPIRNQDGSDYINASFIDGYRSQKAYIATQGPLANTIVDFWRMLWQHNSSIVVMLSQLREMGREKCSQYWPTERSATFGQIIVEPMVEYNMPSFILREFRVRHSDSETHNRTIRQFQFLDWAEQGVPRSGESLIDFIGQVHKTKEQFGQ--EGPITVHCSAGVGRTGVFLALSIVLDRMRSEGTIDLFQTVRLLRMQRPCMVQTEDQYQFCYLTALEY 1993          

HSP 4 Score: 90.8929 bits (224), Expect = 9.129e-18
Identity = 38/82 (46.34%), Postives = 59/82 (71.95%), Query Frame = 1
Query: 5221 KNNSPHLIPFDWNRVALSSMSGVDGSDYINASYIDSYLKTKAYIVSQDPMASTVEDFWRLVWDQNCSIIVVLGKIEEFMKVR 5466
            KN   ++I +D +RV LS+++ + GSDYINA+Y D Y K  AYI +Q P+  T E FWR+VW+  C++IV++ K+EE ++V+
Sbjct: 1457 KNRYANVIAYDHSRVVLSTLNDIPGSDYINANYCDGYRKQNAYIATQGPLPETFEAFWRMVWESRCALIVMMTKLEERLRVK 1538          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRS1.309e-10244.86protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS2.084e-10247.99protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRD4.371e-10245.79protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD4.371e-10245.79protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD4.557e-10245.79protein tyrosine phosphatase receptor type D [Sour... [more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp-31.900e-9144.93Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-32.115e-9144.80Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-32.376e-9144.80Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-32.606e-9144.93Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-33.789e-9144.93Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lar3.586e-7845.40gene:FBgn0000464 transcript:FBtr0081260[more]
Lar4.000e-7845.40gene:FBgn0000464 transcript:FBtr0305950[more]
Lar4.086e-7845.40gene:FBgn0000464 transcript:FBtr0331239[more]
Lar4.175e-7845.40gene:FBgn0000464 transcript:FBtr0331241[more]
Lar4.176e-7845.40gene:FBgn0000464 transcript:FBtr0331240[more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprsa4.141e-10546.09protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptprsa2.969e-10449.84protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptprfa3.169e-10242.90protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa3.169e-10242.90protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa3.332e-10242.90protein tyrosine phosphatase receptor type Fa [Sou... [more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema6d1.958e-10344.22semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d2.218e-10344.13semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d7.339e-10343.80semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d7.525e-10343.80semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d7.779e-10343.80semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprs4.648e-10347.84protein tyrosine phosphatase, receptor type, S [So... [more]
Ptprf7.101e-10347.37protein tyrosine phosphatase, receptor type, F [So... [more]
Ptprs9.749e-10347.84protein tyrosine phosphatase, receptor type, S [So... [more]
Ptprs1.033e-10247.84protein tyrosine phosphatase, receptor type, S [So... [more]
Ptprf1.383e-10247.37protein tyrosine phosphatase, receptor type, F [So... [more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1NWE3|PTPRS_CHICK1.169e-10345.58Receptor-type tyrosine-protein phosphatase S OS=Ga... [more]
sp|B0V2N1|PTPRS_MOUSE2.840e-10247.84Receptor-type tyrosine-protein phosphatase S OS=Mu... [more]
sp|A2A8L5|PTPRF_MOUSE4.340e-10247.37Receptor-type tyrosine-protein phosphatase F OS=Mu... [more]
sp|Q13332|PTPRS_HUMAN5.804e-10244.86Receptor-type tyrosine-protein phosphatase S OS=Ho... [more]
sp|A7MBJ4|PTPRF_BOVIN7.027e-10244.70Receptor-type tyrosine-protein phosphatase F OS=Bo... [more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HQ463.320e-10348.86receptor-type tyrosine-protein phosphatase delta i... [more]
A0A1S3HQ625.377e-10349.13receptor-type tyrosine-protein phosphatase F isofo... [more]
A0A1S3HSZ85.699e-10349.13receptor-type tyrosine-protein phosphatase delta i... [more]
A0A1S3HRJ86.295e-10349.13tyrosine-protein phosphatase Lar isoform X2 OS=Lin... [more]
A0A1S3HQ576.784e-10349.13tyrosine-protein phosphatase Lar isoform X1 OS=Lin... [more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprsa7.363e-10546.09protein tyrosine phosphatase receptor type S [Sour... [more]
ptprsa4.148e-10446.13protein tyrosine phosphatase receptor type S [Sour... [more]
ptprsa4.433e-10446.13protein tyrosine phosphatase receptor type S [Sour... [more]
ptprsa4.621e-10446.13protein tyrosine phosphatase receptor type S [Sour... [more]
ptprsa4.699e-10446.13protein tyrosine phosphatase receptor type S [Sour... [more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprsa1.712e-8339.37protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptprk3.871e-6936.47protein tyrosine phosphatase receptor type K [Sour... [more]
ptpra2.795e-6636.21protein tyrosine phosphatase receptor type A [Sour... [more]
ca16b4.505e-6342.12carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000008162.12.726e-5637.87pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-... [more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PTP13.734e-2230.85Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP21.721e-1727.19Nuclear phosphotyrosine-specific phosphatase invol... [more]
PTP32.398e-927.55Phosphotyrosine-specific protein phosphatase; invo... [more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469615.868e-9045.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481879.171e-8641.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453822.104e-8541.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317366.809e-7139.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438541.227e-7039.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprsa5.089e-10345.58receptor-type tyrosine-protein phosphatase S [Sour... [more]
ptprsa5.528e-10349.21receptor-type tyrosine-protein phosphatase S [Sour... [more]
ptprsa5.860e-10349.21receptor-type tyrosine-protein phosphatase S [Sour... [more]
ptprsa6.693e-10349.21receptor-type tyrosine-protein phosphatase S [Sour... [more]
ptprsa7.402e-10349.21receptor-type tyrosine-protein phosphatase S [Sour... [more]
back to top
BLAST of Tyrosine-protein phosphatase Lar-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042151.11.034e-4299.83SMESG000042151.1[more]
SMESG000053906.13.991e-14730.69SMESG000053906.1[more]
SMESG000053906.12.610e-13831.19SMESG000053906.1[more]
SMESG000053906.14.672e-13831.19SMESG000053906.1[more]
SMESG000041927.12.532e-13626.54SMESG000041927.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001408 ID=SMED30001408|Name=Tyrosine-protein phosphatase Lar-like|organism=Schmidtea mediterranea sexual|type=transcript|length=5798bp
CAATCTACACTGACTCCTCTTTTTAAAACTAAAAAGGAAAATGAATTCCT
TTTTATTATGCTTGCATATGTACCTTATTACGATCTATGGATACTCAGAA
ACTGAATCAGAGAAACCGAGAATAATTTTTATTAGTGACAATAATAAAGT
TCTTGCAGGAGAATCGTTATTTATCAGTTGCATCAGTACGGGGAATCCGG
TTCCCGACATTCAGTGGTACGTCGACCGGATGCCTATCGTTAGAATTATG
AAATCCAACAGTGAATCCATAAGTCGGTTTCAAAATCGTTATTTGTCTAT
GAACTTCAAGATGAAAAAAATTGCTAAAAGCACTTTAATTTTCAAGAAGG
TTCTTTTGGAGGACAATAACAATTTGTTAACATGTGAATCCGAAAATGTT
ATGGGCACAGATAGTCAGACAACAAAAATTAGAGTTTTTAAACACGAAAT
GAGTGTCAATTTCCCAATGGTTTCGTTGGAAGATAGTTCAAAGTCCACTC
TGAAGAGAGAAAATAGTGCAGCAACCATTAAATGTCAATATCATAACTCT
TTAAATGCAAAGGTCTATTGGTTCAGAAACTATGAATTTATCAATGAACC
CGAATATGAAATTACTTTAGATAAAAGCGTATCGAAGTTCTCTATAAAGA
ATATCATGAGAAAAGATGAAGGAACTTATCACTGTTTCGTCACAGGTCAT
TCAGGAGGTCAGATTTCTAAACCAATAAAAATTATTATATCAGATATTCC
TCCTCCGACAACAAATGTAACAGTTACAGAAAGAACGTCAACTTCTTCTG
TAATTTGTTGGAAATTGCCGTTTAATAATCTTACGATTGAACAATTTGTT
CTTCATTACGAATCTCGAGAACAAATAGAGTCTGTTTCTATTCCATTTGA
AAAGATTCTGAATGACTTTAACGGATGGCAATGTTATACATTGAAGAAAT
TACATCCATTTACCACGTACCGGATTTGGATTAATTCCTTAAATTCTTTG
GGAAAGTCACAAGTTGGAAAATCTGTAAAGTTCAACACATCAGAAGATTT
ACCTCAAGGACCTCCTACATCAATTACTGCTTCTGCAATTAGCAACACTG
CGGTAGAGGTTAGATGGAAATCCGTTGAAAAAATAAATGGGATTCTAAAA
AAATACATATTGCTGTGGACCGAGCATTCTGACTTACCTCATCAACATTG
GCGCCAATACGATGCCAAATCTGAATCCTCTCTCATCAGTCATTTGACTC
CAAACAGAATTCATTATATAACAATTCAAGCAGTTAATAATGTTGGTAAA
GGACCTCTTTCAAAACCAGTGGCTATTTTAACCAAATCAGGAACTATATC
TGAATGTCCTGAATTCCGAGCCTCAAAGATCCTCCTCAAATCTATTGTAT
TAGAATGGAACGATCCAGATCCAACCAAGACACTCAATTGTTTTGGATTA
AATTTGGAAATATCCTACAAAAGTCCATTATATTCAATGGAGAACAAAAT
TGTAAATATTACTACCAATCAATTTTCATTCGAAATTCACAATGTCAAAG
AAGACACGGAAATAGTTTTTACTTTAAGAGCTTTTAATCAGGTCGGATTT
GGAATGCCAGTTAAATTATTAATTGTTTCGGCTGGGAAAGCGAAAATTAA
CAAAAATGTCGTAGACATAATTGGTTGCACTTCATTCACAATTGTCGCAC
GGTGGCGTCAGCCAAACAAAGATGCAAAAAATATGACGTTGCAATTGTTT
GAGAAAAATGGCAAATCTTTTACTTTAATAGTTTATCGCACTTTGCCAAT
TATCAGATCAGAATTTCAAATTGATGAATGGAAAATTTATAATTTCACCA
GATTGAAGCCCAGCCAGAAATATCAGATTCGCTTAACTTTTCTCGTTGTG
GGTGAATTTAACGAAATTCGCGAGTCGTTTTATTTGAGCAATGTTATCGA
AACGAAAAAAGCTCATCCTCAGTCAGTTGGAAATTTTAATTTAAAAACTG
GAGTTAATCTAAAAGGACATCCGAATGTTATGGCTGAATGGGAAGAAATT
CCGATCTTTGACAAGGTTTTTTCATCAGCCATTTATCATTTGAAATATAG
AATCATTTTTCCCGCTGAACTGTCGACAAAGTATAGATCAATTTATACGA
ACAAATCTTCCCATGTGATTCAATTATTAGAATTACCAAAATATGGAGTA
ACTTACGAGTTTGTCTTAGCAAGATATGGCAATGTAAGTGAAAAGCTTTC
TGTGAAAAAGCTAATCGCCATGCCCGAAGGAAAGCCAAGTGAATCTCCGT
CTGTTATAAAAGTTATTTATATGTCGGAAAGAAAAGTCACATTAAAATGG
AAAAATCCGCATATTAAATTCAGAAATGGAAAACTTATTTACAATGAAGT
CCAAATCATGCCATTAAACCAAATATTAAATTCCACAGATAATACAATTT
CGTTTTATAAACTCCCAAACAAGGTGTACCAGCTTAGGGTTCGTTCATGC
ACCAGAGTGGCCTGCGGTCCGTGGTCTAAGTACTTTGAATTTTCTGTTTA
TGACGTCGAAATATTACCTCCCAAAGAAATTAGAGCATTCCGAGTGATGG
ACACAAAGATTCGTGTAGAGTGGTCAATTGGATATGATCAAAATAGAATG
CCATATGTTTTTTCAAAAAATCTGTTAGGATTTGTAATCTACTACAGCAC
AAGGGATACTTTAAATGTTACTTCGGCTTGGAGTCAAATAAAAATTTATG
ATAACATATCCAGATATGAAATTAAAAATATCGAAAAAAAGTTTTTCTAC
ATTGTCAGAATGAGTTCTATTGACCAGTACAACAGAACCGGGAAGTGGTC
GGAGCCATCAGTTCCTGAAAATGTAGATTTATCAAGTTATAGCATCAAAA
CATTTAGCAATTTGCAATGTTACCAAACCACTTCAAATTCTATAGAACTT
CGGGCAGATTATCCAGTTGACAATACGTTTTTGAACAGTATTTTAGTAAC
ATATAGTGGGAGAATAATTTTTTGGTCTCCCCTTAATCCAGAATCGGTTG
AGTTTGTTTCTGAAAAAGAGATCTCCTTGGATTACAACAAGAAAGAAACA
ATTTTTAAATTAAATCTTAAAGATTTGAACGTCAATACCAAATATATCAT
CCGAATTTTTCCAATTTATTCCACCAATTCCAAGTTTGATTCAAACATAA
CTCTATCAACAAATACTCATTGCGACACGAAACCAATAGCTCCAGTACTT
GTTTTGCCACCAAAGATTGTTCAAATTTCAACTTTTTTCATAATTTTACA
ATTAATGCGAACTGATGAGCGAAACGGAAGAATAGATTATTATCATTTAA
TTGTCGTTCCCTACATGTCAAAGTCGAAAATGGTGTTTGAAGAATATAAC
AAATCCTCACATGAATTCAGTTTAATAGAATTGAAAACAAATGCTAAACA
AAACAAATTAATTCTTCCTATTTTGGCACTTAGTAGAAAACCAATTCAAT
TATTTGGTAACCAGCCCCATTATGATTTTCTGTTCACATACAATTTCACA
AAACCCAACAAAATGGACAGGTTTTCTGATGGAAATTTCTACAGATCTGC
TCTAAGAGCTTGTGTTGAAACCGATGAAGGTCACTTTCTTTGCAACACAA
GCGATTGGTCAGAATCCTTTCAAATTAATTTCATTTTACAGGACGAACTA
AAGGTCCAAAACAGCAAAAACACTGAAAATATTTTGAAACCAAAACATAA
TGATAAAGCAGTCATTACGCTTTCATTAACATTATCTGGTATCACATTAG
CTATTGTAGGAATTATAATTGGATGTGTTGTACACAAAAGGAAATTACCA
TCTAAAAAATGGGAAAATTCCTGCCGATCTAGTACTCCTAAAATTCAACA
AGATGCTCAAATGACACCATTAGTTGACCTAGACACGCCAAAGCTGGACC
AGGAGCCGTATTATTTAAGAACTGATCAAAATTACGGATTTGATACAAAC
AACGAAGTCATTAATTATAAAAATTATATTAACAGCAGTGTGACAATAAA
TAATTATGATTCTCCTATACTAAAGAATACCACAGTATCTGCCAACCATC
AAAATACAACTCCAGATATCGTCAATGTCAGTGATAGATTCAACTTTTTC
AACAATGATTCCGTTCAAGTGTCTTCGAATGTTTTGAAGTCAAGATATAC
AATTCCAATTGATAAATTAGCAGAATATATCAATGATTTAAAAAGCTATG
ATTACCTCAACATGATGCAAGAGTTCGAAGAATTGAACAAAGAGACTTTA
GAAAAATATTCCTCAATAAATTCTAATCTGCCTCAAAATAAAATGAAAAA
TAGATATGCCAATATTACCGCGTACGACCACAGTATTGTTCCCTTGCAGA
ATCCACTGGACCGAGACCATTGCAATTATATCAATGCTAATTACATTGAT
GGTTATGGAAAACAAAACGAATATATTGCAACTCAGGGCCCTTTAGCTGA
AACTGCATATGACTTTTGGCAAATGGTCTGGGAGCAAAAATCAACAATAA
TTGTTATGCTTGTTCGAAATGAAGAAACAGAATCTAAAAAATGTGAAATA
TACTGGCCGAAAAAAGGAACTAGAATTTACTACGATATTGAGGTGACTCT
TGTTTCATTTATCAGTCGAGCTTATTATACAATCAGGAAATTCCAAATTA
AACAAAATGGATTTTCAACAAAGCGGCAAGTTTACCAGTTACAATTTACC
GGATGGCCAGATCAAGGCATTCCCATTCTATTTCTGCCGTTCCTTTCCTT
TCTTAAAATATATAAGAAATTTAGTAAAAGCGATTCCGGTCCGACAATTG
TACATTGCTCTGCTGGAGTTGGGAGGACAGGTGTTTTCATAGTCGTTGAC
AGTCAGATGGAAAGAATAAAACATGATCGTACTGTAAATATTTACGATCA
AATAAAAGCCATTCGGAAACAAAGAAATTTTATGGTCCAAACTGAGGCCC
AATATGGTTTCATTTACGATGTTTTATTGGAGTGGAATCAGGGCAACTAT
TCAGAAATTGTTCCTGACATGCTCATTTCTCAGATCAAGTCAAAGTCCCA
AATTGTTGAAAATAATTCTCTTAGCGGTTTTGAAATAGAATTTCAAAAGC
TCAATCTTCAATCTACAACTATCAATTCGAACATGTCTCGAATTCATGGA
AATGCAACTGTCAATAAACAAAAAACAATTCTCCACATTTAATACCTTTT
GACTGGAATCGTGTAGCGTTATCCTCAATGTCCGGTGTTGATGGATCAGA
TTATATCAATGCGTCCTATATTGATAGCTATCTGAAAACTAAAGCATACA
TTGTGTCACAAGATCCCATGGCTTCTACAGTTGAAGACTTTTGGCGGCTC
GTTTGGGATCAGAATTGTTCTATTATTGTTGTATTGGGGAAAATCGAAGA
GTTTATGAAAGTAAGATCTATTAAGCTGGTTTTATTTCGGATGGTTATTA
TCAATTGCAAAGACCACTTGTATAAATAACAAGTTAAGTCTACGTTAATT
AAAAAATCCTTAATGCTTAGGATGATATTCAATCTGAATCCGAAAACGCG
TTTTTCCTCTAACTCAGAAGAAATATTGCACTCAATTGTTAAGAAAAATA
TTCTGTGAATAAATAGAAACAATAACATTTTTCTTTACAATAACCACTTC
TTGATTGTTTCTAGTCTTCGGTATATAGTGACTAAATCTTAGGAATTATC
AAACGGAATACCTCATTTAAACTGGTAATTTTCCGTATTATTGTTATG
back to top

protein sequence of SMED30001408-orf-1

>SMED30001408-orf-1 ID=SMED30001408-orf-1|Name=SMED30001408-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1734bp
MNSFLLCLHMYLITIYGYSETESEKPRIIFISDNNKVLAGESLFISCIST
GNPVPDIQWYVDRMPIVRIMKSNSESISRFQNRYLSMNFKMKKIAKSTLI
FKKVLLEDNNNLLTCESENVMGTDSQTTKIRVFKHEMSVNFPMVSLEDSS
KSTLKRENSAATIKCQYHNSLNAKVYWFRNYEFINEPEYEITLDKSVSKF
SIKNIMRKDEGTYHCFVTGHSGGQISKPIKIIISDIPPPTTNVTVTERTS
TSSVICWKLPFNNLTIEQFVLHYESREQIESVSIPFEKILNDFNGWQCYT
LKKLHPFTTYRIWINSLNSLGKSQVGKSVKFNTSEDLPQGPPTSITASAI
SNTAVEVRWKSVEKINGILKKYILLWTEHSDLPHQHWRQYDAKSESSLIS
HLTPNRIHYITIQAVNNVGKGPLSKPVAILTKSGTISECPEFRASKILLK
SIVLEWNDPDPTKTLNCFGLNLEISYKSPLYSMENKIVNITTNQFSFEIH
NVKEDTEIVFTLRAFNQVGFGMPVKLLIVSAGKAKINKNVVDIIGCTSFT
IVARWRQPNKDAKNMTLQLFEKNGKSFTLIVYRTLPIIRSEFQIDEWKIY
NFTRLKPSQKYQIRLTFLVVGEFNEIRESFYLSNVIETKKAHPQSVGNFN
LKTGVNLKGHPNVMAEWEEIPIFDKVFSSAIYHLKYRIIFPAELSTKYRS
IYTNKSSHVIQLLELPKYGVTYEFVLARYGNVSEKLSVKKLIAMPEGKPS
ESPSVIKVIYMSERKVTLKWKNPHIKFRNGKLIYNEVQIMPLNQILNSTD
NTISFYKLPNKVYQLRVRSCTRVACGPWSKYFEFSVYDVEILPPKEIRAF
RVMDTKIRVEWSIGYDQNRMPYVFSKNLLGFVIYYSTRDTLNVTSAWSQI
KIYDNISRYEIKNIEKKFFYIVRMSSIDQYNRTGKWSEPSVPENVDLSSY
SIKTFSNLQCYQTTSNSIELRADYPVDNTFLNSILVTYSGRIIFWSPLNP
ESVEFVSEKEISLDYNKKETIFKLNLKDLNVNTKYIIRIFPIYSTNSKFD
SNITLSTNTHCDTKPIAPVLVLPPKIVQISTFFIILQLMRTDERNGRIDY
YHLIVVPYMSKSKMVFEEYNKSSHEFSLIELKTNAKQNKLILPILALSRK
PIQLFGNQPHYDFLFTYNFTKPNKMDRFSDGNFYRSALRACVETDEGHFL
CNTSDWSESFQINFILQDELKVQNSKNTENILKPKHNDKAVITLSLTLSG
ITLAIVGIIIGCVVHKRKLPSKKWENSCRSSTPKIQQDAQMTPLVDLDTP
KLDQEPYYLRTDQNYGFDTNNEVINYKNYINSSVTINNYDSPILKNTTVS
ANHQNTTPDIVNVSDRFNFFNNDSVQVSSNVLKSRYTIPIDKLAEYINDL
KSYDYLNMMQEFEELNKETLEKYSSINSNLPQNKMKNRYANITAYDHSIV
PLQNPLDRDHCNYINANYIDGYGKQNEYIATQGPLAETAYDFWQMVWEQK
STIIVMLVRNEETESKKCEIYWPKKGTRIYYDIEVTLVSFISRAYYTIRK
FQIKQNGFSTKRQVYQLQFTGWPDQGIPILFLPFLSFLKIYKKFSKSDSG
PTIVHCSAGVGRTGVFIVVDSQMERIKHDRTVNIYDQIKAIRKQRNFMVQ
TEAQYGFIYDVLLEWNQGNYSEIVPDMLISQIKSKSQIVENNSLSGFEIE
FQKLNLQSTTINSNMSRIHGNATVNKQKTILHI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR036179Ig-like_dom_sf
IPR000242PTPase_domain
IPR003598Ig_sub2
IPR003961FN3_dom
IPR003599Ig_sub
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR016130Tyr_Pase_AS
IPR007110Ig-like_dom
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0008201heparin binding
GO:0016787hydrolase activity
GO:0035374chondroitin sulfate binding
GO:0043395heparan sulfate proteoglycan binding
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0061000negative regulation of dendritic spine development
GO:0090557establishment of endothelial intestinal barrier
GO:0007155cell adhesion
GO:0010977negative regulation of neuron projection development
GO:0021510spinal cord development
GO:0021549cerebellum development
GO:0021766hippocampus development
GO:0021987cerebral cortex development
GO:0022038corpus callosum development
GO:0030517negative regulation of axon extension
GO:0032687negative regulation of interferon-alpha production
GO:0032688negative regulation of interferon-beta production
GO:0034164negative regulation of toll-like receptor 9 signaling pathway
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0048671negative regulation of collateral sprouting
GO:0048681negative regulation of axon regeneration
Vocabulary: cellular component
TermDefinition
GO:0070062extracellular exosome
GO:0099061integral component of postsynaptic density membrane
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030285integral component of synaptic vesicle membrane
GO:0030424axon
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 1648..1658
score: 64.06
coord: 1632..1647
score: 30.0
coord: 1601..1619
score: 68.11
coord: 1462..1469
score: 70.44
coord: 1562..1579
score: 45.39
coord: 1478..1498
score: 67.0
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 1407..1667
e-value: 9.4E-113
score: 390.6
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 1433..1664
e-value: 1.6E-77
score: 260.2
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 1408..1665
score: 54.082
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 150..234
e-value: 5.5E-8
score: 42.5
coord: 32..133
e-value: 0.027
score: 23.6
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 841..934
e-value: 26.0
score: 7.8
coord: 436..521
e-value: 0.075
score: 22.2
coord: 339..421
e-value: 9.3E-6
score: 35.1
coord: 750..826
e-value: 13.0
score: 10.5
coord: 237..323
e-value: 3.8E-8
score: 43.1
coord: 972..1047
e-value: 92.0
score: 3.1
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 238..323
e-value: 4.3E-6
score: 27.0
coord: 341..424
e-value: 1.3E-9
score: 38.3
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 752..839
score: 9.973
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 239..336
score: 14.872
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 341..434
score: 19.045
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 843..948
score: 9.626
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 439..534
score: 10.927
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 954..1066
score: 7.243
IPR003961Fibronectin type IIICDDcd00063FN3coord: 340..431
e-value: 4.83445E-13
score: 64.4399
IPR003961Fibronectin type IIICDDcd00063FN3coord: 451..529
e-value: 0.0011041
score: 37.8611
IPR003961Fibronectin type IIICDDcd00063FN3coord: 237..333
e-value: 5.03735E-8
score: 50.1875
IPR003961Fibronectin type IIICDDcd00063FN3coord: 753..834
e-value: 9.08257E-4
score: 38.2463
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 1563..1664
e-value: 3.0E-37
score: 139.7
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 156..222
e-value: 0.0022
score: 27.2
coord: 38..122
e-value: 0.032
score: 21.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 235..336
e-value: 5.4E-12
score: 47.9
coord: 737..838
e-value: 2.1E-8
score: 36.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 437..534
e-value: 7.1E-7
score: 31.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 839..946
e-value: 1.1E-5
score: 27.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 140..234
e-value: 2.0E-10
score: 42.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 337..434
e-value: 2.2E-19
score: 71.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 23..134
e-value: 1.7E-12
score: 49.5
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 150..227
e-value: 9.5E-8
score: 32.0
NoneNo IPR availablePFAMPF13927Ig_3coord: 25..119
e-value: 1.6E-7
score: 31.8
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 1327..1729
coord: 205..567
NoneNo IPR availablePANTHERPTHR19134:SF203RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE Fcoord: 1327..1729
coord: 205..567
NoneNo IPR availableCDDcd14553R-PTPc-LAR-1coord: 1433..1664
e-value: 1.44084E-112
score: 354.395
NoneNo IPR availableCDDcd00096Igcoord: 161..218
e-value: 2.37811E-6
score: 44.9256
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.584
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 1381..1676
e-value: 3.0E-103
score: 347.2
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 1387..1665
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 1604..1614
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 142..230
score: 10.608
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 26..131
score: 10.444
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 1582..1656
score: 19.952
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 843..941
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 450..835
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 235..432
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 957..1133
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 25..132
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 151..241