Dual specificity tyrosine-phosphorylation-regulated kinase 2

Overview
NameDual specificity tyrosine-phosphorylation-regulated kinase 2
Smed IDSMED30001404
Length (bp)2081
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30001404) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30001404) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30001404) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30001404) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:HGNC Symbol;Acc:HGNC:3093])

HSP 1 Score: 491.5 bits (1264), Expect = 3.136e-167
Identity = 259/423 (61.23%), Postives = 319/423 (75.41%), Query Frame = 1
Query:  118 SEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGT 1386
            + P+ P  AMK +M K+T FE HEIF YP++Y+LG NA+K + +T   NN             G+DD+QGSY+ V  DH+AYRYEV+K+IGKGSFGQVVKAYDHK+  +VALK+VRNEKRF RQAAEEIRILEHL++ DK++  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE DQL+CMIELLG+P   LL   KR   F +S   PRYC V     +     L G  ++RGK RGPP S+   N LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+ +P    GEK+  K     T
Sbjct:   78 ATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNN------------GGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTT--LSDGSVVLNGGRSRRGKLRGPPESREWGNALKGC-DDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRR-LPKPPTGEKTSVKRITEST 484          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:HGNC Symbol;Acc:HGNC:3093])

HSP 1 Score: 493.426 bits (1269), Expect = 6.297e-167
Identity = 258/417 (61.87%), Postives = 318/417 (76.26%), Query Frame = 1
Query:  118 SEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQK 1368
            + P+ P  AMK +M K+T FE HEIF YP++Y+LG NA+K + +T   NN             G+DD+QGSY+ V  DH+AYRYEV+K+IGKGSFGQVVKAYDHK+  +VALK+VRNEKRF RQAAEEIRILEHL++ DK++  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE DQL+CMIELLG+P   LL   KR   F +S   PRYC V     +     L G  ++RGK RGPP S+   N LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+ +P    GEK+  K
Sbjct:  151 ATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNN------------GGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTT--LSDGSVVLNGGRSRRGKLRGPPESREWGNALKGC-DDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRR-LPKPPTGEKTSVK 551          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 443.351 bits (1139), Expect = 8.312e-148
Identity = 239/409 (58.44%), Postives = 298/409 (72.86%), Query Frame = 1
Query:   97 TSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRR 1323
            +S + P   PL P  A+K + + +T +E+ EI  YP++Y++G NA+K   +    NN             G+DD  G+YIHV  DH+AYRYEV+K+IGKGSFGQV + YDHKL  YVALK+VRNEKRF RQAAEEIRILEHL++ DK    N++H+ E FTFRNHVC+ FELL+ +L+ELIKKNKF+GFS+ LVRKFA SILQ LDAL KN+IIHCDLKPENILL+H  RSS KVIDFGSSC+E Q++YTYIQSRFYRAPE+ILG +Y  PID+WSFGCILAEL+TG PLFPGEDE DQL+CM+ELLG+PP  LL   KR   F  S  IPRYC V        +  L G  ++RGK RGPPGSK     LK   +D LF++F++R L ++P  R+ P +A++H WI +
Sbjct:  111 SSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNN------------GGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVV--LVGGRSRRGKKRGPPGSKDWGTALKGC-DDYLFIEFLKRCLHWDPSARLTPAQALRHPWISK 504          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 443.351 bits (1139), Expect = 8.312e-148
Identity = 239/409 (58.44%), Postives = 298/409 (72.86%), Query Frame = 1
Query:   97 TSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRR 1323
            +S + P   PL P  A+K + + +T +E+ EI  YP++Y++G NA+K   +    NN             G+DD  G+YIHV  DH+AYRYEV+K+IGKGSFGQV + YDHKL  YVALK+VRNEKRF RQAAEEIRILEHL++ DK    N++H+ E FTFRNHVC+ FELL+ +L+ELIKKNKF+GFS+ LVRKFA SILQ LDAL KN+IIHCDLKPENILL+H  RSS KVIDFGSSC+E Q++YTYIQSRFYRAPE+ILG +Y  PID+WSFGCILAEL+TG PLFPGEDE DQL+CM+ELLG+PP  LL   KR   F  S  IPRYC V        +  L G  ++RGK RGPPGSK     LK   +D LF++F++R L ++P  R+ P +A++H WI +
Sbjct:  111 SSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNN------------GGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVV--LVGGRSRRGKKRGPPGSKDWGTALKGC-DDYLFIEFLKRCLHWDPSARLTPAQALRHPWISK 504          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 443.736 bits (1140), Expect = 1.108e-147
Identity = 241/413 (58.35%), Postives = 300/413 (72.64%), Query Frame = 1
Query:   97 TSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIP 1335
            +S + P   PL P  A+K + + +T +E+ EI  YP++Y++G NA+K   +    NN             G+DD  G+YIHV  DH+AYRYEV+K+IGKGSFGQV + YDHKL  YVALK+VRNEKRF RQAAEEIRILEHL++ DK    N++H+ E FTFRNHVC+ FELL+ +L+ELIKKNKF+GFS+ LVRKFA SILQ LDAL KN+IIHCDLKPENILL+H  RSS KVIDFGSSC+E Q++YTYIQSRFYRAPE+ILG +Y  PID+WSFGCILAEL+TG PLFPGEDE DQL+CM+ELLG+PP  LL   KR   F  S  IPRYC V        +  L G  ++RGK RGPPGSK     LK   +D LF++F++R L ++P  R+ P +A++H WI  K +P
Sbjct:  131 SSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNN------------GGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVV--LVGGRSRRGKKRGPPGSKDWGTALKGC-DDYLFIEFLKRCLHWDPSARLTPAQALRHPWI-SKSVP 527          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 448.358 bits (1152), Expect = 1.329e-151
Identity = 238/398 (59.80%), Postives = 300/398 (75.38%), Query Frame = 1
Query:  133 PRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK 1326
            P  A++ F  K+  FE++EI+ Y +V+++G +A+K   +    NN             G+DDE GSY  V+ DHIAYRYEV+K+IGKGSFGQV+KA+DHK   YVALK+VRNEKRF RQA EEIRIL+HL++ D +   NI+H+ ++F FRNH CITFELL+ NL+ELIK+NKF+GFSL+LVRKFA S+L CLD L+KN++IHCDLKPEN+LL+   RS IKVIDFGSSC+++QR+YTYIQSRFYRAPEVILG KYG+PIDMWS GCILAEL+TGYPL PGEDE+DQL+ +IELLG+PP   L   KR   F TS   PRYC     P    +  L G+ +KRGK RGPP S+S    LK  G D LFVDF++R LD++PETRM P +A+KH+W+RR+
Sbjct:   68 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANN------------GGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVV--LAGARSKRGKMRGPPASRSWSTALKNMG-DELFVDFLKRCLDWDPETRMTPAQALKHKWLRRR 450          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 448.358 bits (1152), Expect = 1.329e-151
Identity = 238/398 (59.80%), Postives = 300/398 (75.38%), Query Frame = 1
Query:  133 PRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK 1326
            P  A++ F  K+  FE++EI+ Y +V+++G +A+K   +    NN             G+DDE GSY  V+ DHIAYRYEV+K+IGKGSFGQV+KA+DHK   YVALK+VRNEKRF RQA EEIRIL+HL++ D +   NI+H+ ++F FRNH CITFELL+ NL+ELIK+NKF+GFSL+LVRKFA S+L CLD L+KN++IHCDLKPEN+LL+   RS IKVIDFGSSC+++QR+YTYIQSRFYRAPEVILG KYG+PIDMWS GCILAEL+TGYPL PGEDE+DQL+ +IELLG+PP   L   KR   F TS   PRYC     P    +  L G+ +KRGK RGPP S+S    LK  G D LFVDF++R LD++PETRM P +A+KH+W+RR+
Sbjct:   68 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANN------------GGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVV--LAGARSKRGKMRGPPASRSWSTALKNMG-DELFVDFLKRCLDWDPETRMTPAQALKHKWLRRR 450          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 448.358 bits (1152), Expect = 1.329e-151
Identity = 238/398 (59.80%), Postives = 300/398 (75.38%), Query Frame = 1
Query:  133 PRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK 1326
            P  A++ F  K+  FE++EI+ Y +V+++G +A+K   +    NN             G+DDE GSY  V+ DHIAYRYEV+K+IGKGSFGQV+KA+DHK   YVALK+VRNEKRF RQA EEIRIL+HL++ D +   NI+H+ ++F FRNH CITFELL+ NL+ELIK+NKF+GFSL+LVRKFA S+L CLD L+KN++IHCDLKPEN+LL+   RS IKVIDFGSSC+++QR+YTYIQSRFYRAPEVILG KYG+PIDMWS GCILAEL+TGYPL PGEDE+DQL+ +IELLG+PP   L   KR   F TS   PRYC     P    +  L G+ +KRGK RGPP S+S    LK  G D LFVDF++R LD++PETRM P +A+KH+W+RR+
Sbjct:   68 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANN------------GGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVV--LAGARSKRGKMRGPPASRSWSTALKNMG-DELFVDFLKRCLDWDPETRMTPAQALKHKWLRRR 450          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 448.358 bits (1152), Expect = 1.557e-151
Identity = 241/419 (57.52%), Postives = 308/419 (73.51%), Query Frame = 1
Query:  133 PRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGTC 1389
            P  A++ F  K+  FE++EI+ Y +V+++G +A+K   +    NN             G+DDE GSY  V+ DHIAYRYEV+K+IGKGSFGQV+KA+DHK   YVALK+VRNEKRF RQA EEIRIL+HL++ D +   NI+H+ ++F FRNH CITFELL+ NL+ELIK+NKF+GFSL+LVRKFA S+L CLD L+KN++IHCDLKPEN+LL+   RS IKVIDFGSSC+++QR+YTYIQSRFYRAPEVILG KYG+PIDMWS GCILAEL+TGYPL PGEDE+DQL+ +IELLG+PP   L   KR   F TS   PRYC     P    +  L G+ +KRGK RGPP S+S    LK  G D LFVDF++R LD++PETRM P +A+KH+W+RR+     + G +S    +++  C
Sbjct:   68 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANN------------GGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVV--LAGARSKRGKMRGPPASRSWSTALKNMG-DELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESMGGLADHEVC 471          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 448.358 bits (1152), Expect = 1.557e-151
Identity = 241/419 (57.52%), Postives = 308/419 (73.51%), Query Frame = 1
Query:  133 PRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGTC 1389
            P  A++ F  K+  FE++EI+ Y +V+++G +A+K   +    NN             G+DDE GSY  V+ DHIAYRYEV+K+IGKGSFGQV+KA+DHK   YVALK+VRNEKRF RQA EEIRIL+HL++ D +   NI+H+ ++F FRNH CITFELL+ NL+ELIK+NKF+GFSL+LVRKFA S+L CLD L+KN++IHCDLKPEN+LL+   RS IKVIDFGSSC+++QR+YTYIQSRFYRAPEVILG KYG+PIDMWS GCILAEL+TGYPL PGEDE+DQL+ +IELLG+PP   L   KR   F TS   PRYC     P    +  L G+ +KRGK RGPP S+S    LK  G D LFVDF++R LD++PETRM P +A+KH+W+RR+     + G +S    +++  C
Sbjct:   68 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANN------------GGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVV--LAGARSKRGKMRGPPASRSWSTALKNMG-DELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESMGGLADHEVC 471          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100406)

HSP 1 Score: 437.958 bits (1125), Expect = 8.818e-143
Identity = 238/400 (59.50%), Postives = 304/400 (76.00%), Query Frame = 1
Query:  127 LNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK 1326
            ++P+  M  +MNK+T +E+ EI  YPQ+Y++G NA+K   +    N+              +D+EQG+YIHV  DH+AYRYE++K+IGKGSFGQV+KAYDHK   +VALKIVRNEKRF RQA EEIRIL HL+++DK +  NI+H++++FTFRNH CITFELL+ NL+ELIKKN F+GFSL LVRKFA S+LQCLDAL KN IIHCD+KPEN+LL+   RS IKVIDFGSSC+ENQR+YTYIQSRFYRAPEVILGGKYG  IDMWS GCILAEL++G+ LFPGE+ESDQL+C+IE+LG+P  N+L + KR+  FF+    PRYC V     +  M  L G  ++RGK RGPP SKS+   L     DPLF++FIR  L+++ + R+ P EA+KH W+RR+
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYGPNNSE-------------YDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRT--MSDGMVVLIGGQSRRGKQRGPPCSKSLSKALD-GCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRR 592          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100404)

HSP 1 Score: 437.958 bits (1125), Expect = 8.818e-143
Identity = 238/400 (59.50%), Postives = 304/400 (76.00%), Query Frame = 1
Query:  127 LNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK 1326
            ++P+  M  +MNK+T +E+ EI  YPQ+Y++G NA+K   +    N+              +D+EQG+YIHV  DH+AYRYE++K+IGKGSFGQV+KAYDHK   +VALKIVRNEKRF RQA EEIRIL HL+++DK +  NI+H++++FTFRNH CITFELL+ NL+ELIKKN F+GFSL LVRKFA S+LQCLDAL KN IIHCD+KPEN+LL+   RS IKVIDFGSSC+ENQR+YTYIQSRFYRAPEVILGGKYG  IDMWS GCILAEL++G+ LFPGE+ESDQL+C+IE+LG+P  N+L + KR+  FF+    PRYC V     +  M  L G  ++RGK RGPP SKS+   L     DPLF++FIR  L+++ + R+ P EA+KH W+RR+
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYGPNNSE-------------YDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRT--MSDGMVVLIGGQSRRGKQRGPPCSKSLSKALD-GCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRR 592          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100402)

HSP 1 Score: 437.958 bits (1125), Expect = 8.818e-143
Identity = 238/400 (59.50%), Postives = 304/400 (76.00%), Query Frame = 1
Query:  127 LNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK 1326
            ++P+  M  +MNK+T +E+ EI  YPQ+Y++G NA+K   +    N+              +D+EQG+YIHV  DH+AYRYE++K+IGKGSFGQV+KAYDHK   +VALKIVRNEKRF RQA EEIRIL HL+++DK +  NI+H++++FTFRNH CITFELL+ NL+ELIKKN F+GFSL LVRKFA S+LQCLDAL KN IIHCD+KPEN+LL+   RS IKVIDFGSSC+ENQR+YTYIQSRFYRAPEVILGGKYG  IDMWS GCILAEL++G+ LFPGE+ESDQL+C+IE+LG+P  N+L + KR+  FF+    PRYC V     +  M  L G  ++RGK RGPP SKS+   L     DPLF++FIR  L+++ + R+ P EA+KH W+RR+
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYGPNNSE-------------YDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRT--MSDGMVVLIGGQSRRGKQRGPPCSKSLSKALD-GCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRR 592          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0100447)

HSP 1 Score: 339.732 bits (870), Expect = 2.670e-106
Identity = 192/399 (48.12%), Postives = 265/399 (66.42%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIR 1320
            P+ P   +K F N +T  E  E+  Y +V+Y GQ+A K         NY +        N G+DD+ G+Y  +  DHIA+RYE++++IGKGSFGQV++A DHK   +VA+KI+RN+KRF  QA  E+ IL+ L++ D +   N++H+ ++  FR H+CITFEL++ NL+ELIKKN + GFS+ L+R+F  SI++CL  L K  IIHCDLKPENILL+    SSIKVIDFGSSCY ++++YTYIQSRFYR+PEVILG +YG  IDMWS GCILAEL TG+PLFPGE+E +QL+C++E+LGLPP  L+   +R   FF S   PR                      +G+ R  PGSKS+ + L     D  F+DF++R L+++P  RM P EA  H++++
Sbjct:  126 PMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASK---------NYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCIT-----------------NTKGRKRS-PGSKSLAHILHC--QDRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0089289)

HSP 1 Score: 339.732 bits (870), Expect = 2.670e-106
Identity = 192/399 (48.12%), Postives = 265/399 (66.42%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIR 1320
            P+ P   +K F N +T  E  E+  Y +V+Y GQ+A K         NY +        N G+DD+ G+Y  +  DHIA+RYE++++IGKGSFGQV++A DHK   +VA+KI+RN+KRF  QA  E+ IL+ L++ D +   N++H+ ++  FR H+CITFEL++ NL+ELIKKN + GFS+ L+R+F  SI++CL  L K  IIHCDLKPENILL+    SSIKVIDFGSSCY ++++YTYIQSRFYR+PEVILG +YG  IDMWS GCILAEL TG+PLFPGE+E +QL+C++E+LGLPP  L+   +R   FF S   PR                      +G+ R  PGSKS+ + L     D  F+DF++R L+++P  RM P EA  H++++
Sbjct:  126 PMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASK---------NYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCIT-----------------NTKGRKRS-PGSKSLAHILHC--QDRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 475.322 bits (1222), Expect = 2.511e-160
Identity = 260/438 (59.36%), Postives = 327/438 (74.66%), Query Frame = 1
Query:   73 GNSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGT 1386
            G+S   ++T  + P   PL P  AMK +M+K+++FE  EI  Y ++Y++G NA+K + +    NN             G+DD+QGSYIHV  DHIAYRYEV+K+IGKGSFGQVVKAYDHK   +VALK+VRNEKRF RQAAEEIRILEHL++ DK+S  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCL++L KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE DQL+C+IE+LG+P   LL + KR   F +S   PRYC V   P    +  L G  ++RGK RGPPGS+     LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+ +P K   EK+  K    GT
Sbjct:  114 GSSTSIKSTESK-PKPAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNN------------GGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTVTTLPDASVV--LNGGRSRRGKLRGPPGSRDWVTALKGC-DDPLFLDFLKQCLEWDPSQRMTPSQALRHPWLRRR-LP-KPPTEKTTVKRITEGT 533          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 474.937 bits (1221), Expect = 4.308e-160
Identity = 260/438 (59.36%), Postives = 327/438 (74.66%), Query Frame = 1
Query:   73 GNSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGT 1386
            G+S   ++T  + P   PL P  AMK +M+K+++FE  EI  Y ++Y++G NA+K + +    NN             G+DD+QGSYIHV  DHIAYRYEV+K+IGKGSFGQVVKAYDHK   +VALK+VRNEKRF RQAAEEIRILEHL++ DK+S  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCL++L KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE DQL+C+IE+LG+P   LL + KR   F +S   PRYC V   P    +  L G  ++RGK RGPPGS+     LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+ +P K   EK+  K    GT
Sbjct:  124 GSSTSIKSTESK-PKPAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNN------------GGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTVTTLPDASVV--LNGGRSRRGKLRGPPGSRDWVTALKGC-DDPLFLDFLKQCLEWDPSQRMTPSQALRHPWLRRR-LP-KPPTEKTTVKRITEGT 543          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 474.167 bits (1219), Expect = 1.395e-159
Identity = 260/438 (59.36%), Postives = 327/438 (74.66%), Query Frame = 1
Query:   73 GNSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGT 1386
            G+S   ++T  + P   PL P  AMK +M+K+++FE  EI  Y ++Y++G NA+K + +    NN             G+DD+QGSYIHV  DHIAYRYEV+K+IGKGSFGQVVKAYDHK   +VALK+VRNEKRF RQAAEEIRILEHL++ DK+S  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCL++L KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE DQL+C+IE+LG+P   LL + KR   F +S   PRYC V   P    +  L G  ++RGK RGPPGS+     LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+ +P K   EK+  K    GT
Sbjct:  135 GSSTSIKSTESK-PKPAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNN------------GGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTVTTLPDASVV--LNGGRSRRGKLRGPPGSRDWVTALKGC-DDPLFLDFLKQCLEWDPSQRMTPSQALRHPWLRRR-LP-KPPTEKTTVKRITEGT 554          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:ZFIN;Acc:ZDB-GENE-080219-31])

HSP 1 Score: 462.996 bits (1190), Expect = 1.909e-155
Identity = 255/450 (56.67%), Postives = 320/450 (71.11%), Query Frame = 1
Query:  115 LSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSF--QKESENGTC-QDILATAIDVEFSNKNDSSGTM 1455
            L  P+ P  A+K    ++T  EQ EI  Y ++Y+LG NA+K + +    NN            +G+DD+QG YIHV  DH+AYRYE +K+IGKGSFGQV K YDHKL  +VALKIVRNEKRF RQAAEEIRILEHL++ DK    N+VH+ E+FTFRNH+C+TFELL+ NL+ELIK+NKF+GFSL LVRKFA SILQCL+AL +++IIHCDLKPENILL+   RS IKVIDFGSSC+++QRVYTYIQSRFYRAPEVILG +YG+PIDMWSFGCILAEL+TGYPLFPGEDE DQL+CM+ELLG+PP  LL   KR   F +S   PRYC V+    +     L GS ++RGK RG PGSK     LK    D  F+DF+++ LD++P TRM P +A++H W+ ++       GEK+   ++ SE+ T    I++    V  S  N    TM
Sbjct:  128 LGSPMTPEQALKQHRQQMTTLEQQEIHNYSEIYFLGPNAKKRQAVAGGTNN------------SGYDDDQGGYIHVPHDHLAYRYEFLKVIGKGSFGQVAKVYDHKLQQHVALKIVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALHRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPSKLLEQAKRAKNFISSKGHPRYCTVST--LSNGTIVLNGSRSRRGKMRGAPGSKEWGTALKGC-EDATFIDFLKKCLDWDPSTRMTPVQALRHPWLYKRLPKPAPGGEKTVLPKRISEHSTSFPTIISKVPPVMGSTNNKLRTTM 562          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:ZFIN;Acc:ZDB-GENE-080219-31])

HSP 1 Score: 462.611 bits (1189), Expect = 2.244e-155
Identity = 255/450 (56.67%), Postives = 320/450 (71.11%), Query Frame = 1
Query:  115 LSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSF--QKESENGTC-QDILATAIDVEFSNKNDSSGTM 1455
            L  P+ P  A+K    ++T  EQ EI  Y ++Y+LG NA+K + +    NN            +G+DD+QG YIHV  DH+AYRYE +K+IGKGSFGQV K YDHKL  +VALKIVRNEKRF RQAAEEIRILEHL++ DK    N+VH+ E+FTFRNH+C+TFELL+ NL+ELIK+NKF+GFSL LVRKFA SILQCL+AL +++IIHCDLKPENILL+   RS IKVIDFGSSC+++QRVYTYIQSRFYRAPEVILG +YG+PIDMWSFGCILAEL+TGYPLFPGEDE DQL+CM+ELLG+PP  LL   KR   F +S   PRYC V+    +     L GS ++RGK RG PGSK     LK    D  F+DF+++ LD++P TRM P +A++H W+ ++       GEK+   ++ SE+ T    I++    V  S  N    TM
Sbjct:  129 LGSPMTPEQALKQHRQQMTTLEQQEIHNYSEIYFLGPNAKKRQAVAGGTNN------------SGYDDDQGGYIHVPHDHLAYRYEFLKVIGKGSFGQVAKVYDHKLQQHVALKIVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALHRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPSKLLEQAKRAKNFISSKGHPRYCTVST--LSNGTIVLNGSRSRRGKMRGAPGSKEWGTALKGC-EDATFIDFLKKCLDWDPSTRMTPVQALRHPWLYKRLPKPAPGGEKTVLPKRISEHSTSFPTIISKVPPVMGSTNNKLRTTM 563          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:100485120])

HSP 1 Score: 497.664 bits (1280), Expect = 3.306e-168
Identity = 261/413 (63.20%), Postives = 316/413 (76.51%), Query Frame = 1
Query:  118 SEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEK 1356
            S  L P  AMK +M K+T FE HEIF YP++Y+LG NA+K + +    NN             G+DD+QGSY+ V  DH+AYRYEV+K+IGKGSFGQVVKAYDHKL  +VALK+VRNEKRF RQAAEEIRILEHL++ DK++  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILGG+YG+PIDMWS GCILAEL+TGYPL PGEDE DQL+CMIELLG+P   LL   KR   FF+S   PRYC V   P    +  L G  ++RGK RGPPGS+     LK   +DPLF+DF+ + L+++P  RM P +A++H W+RR+ +P    GEK
Sbjct:  175 SSSLTPEQAMKQYMQKLTAFEHHEIFNYPEIYFLGPNAKKRQGVIGGPNN------------GGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKLHQHVALKMVRNEKRFHRQAAEEIRILEHLKKQDKDNNMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGGRYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRGKNFFSSKGYPRYCTVTSLPDGSVV--LNGGRSRRGKLRGPPGSRDWVTALKGC-DDPLFLDFLTQCLEWDPSLRMTPSQALRHHWLRRR-LPKPPTGEK 571          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 439.499 bits (1129), Expect = 1.217e-146
Identity = 246/452 (54.42%), Postives = 317/452 (70.13%), Query Frame = 1
Query:  127 LNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGTCQ---------DILATAIDVEFSNKNDSSGTM 1455
            L P  A+K + ++++ +E  EI  + ++Y++G NA+K + +    NN             G+DD+QG Y  V  DH+AYRYEV+K+IGKGSFGQV K YDHKL  ++ALK+VRNEKRF RQAAEEIRILEHL++ DK    N++H+ E FTFRNH+C+TFELL+ NL+ELIK+NKF+GFSL LVRKFA SILQCL+AL +N+IIHCDLKPENILL+   RS IKVIDFGSSC+++QRVYTYIQSRFYRAPEVILG +YG+PIDMWSFGCIL EL+TGYPLFPGEDE DQL+CM+ELLG PP  LL   KR   F  S   PRYC V   P   ++  L GS ++RGK RG PGSK     LK    D LF+DF++  L ++P  RM P +A++HQWI ++ +P   + EK+  K   + T            ++  A  +  +  NDS+G++
Sbjct:  100 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNN------------GGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTV--LNGSRSRRGKMRGAPGSKDWVAALKGC-EDSLFIDFLKGCLTWDPVARMTPSQALRHQWISKR-LPKPSVTEKASGKRISSQTSSFPGIGSKLPPVVGVANKLRANLMNDSNGSI 535          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 439.113 bits (1128), Expect = 1.545e-146
Identity = 246/452 (54.42%), Postives = 317/452 (70.13%), Query Frame = 1
Query:  127 LNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGTCQ---------DILATAIDVEFSNKNDSSGTM 1455
            L P  A+K + ++++ +E  EI  + ++Y++G NA+K + +    NN             G+DD+QG Y  V  DH+AYRYEV+K+IGKGSFGQV K YDHKL  ++ALK+VRNEKRF RQAAEEIRILEHL++ DK    N++H+ E FTFRNH+C+TFELL+ NL+ELIK+NKF+GFSL LVRKFA SILQCL+AL +N+IIHCDLKPENILL+   RS IKVIDFGSSC+++QRVYTYIQSRFYRAPEVILG +YG+PIDMWSFGCIL EL+TGYPLFPGEDE DQL+CM+ELLG PP  LL   KR   F  S   PRYC V   P   ++  L GS ++RGK RG PGSK     LK    D LF+DF++  L ++P  RM P +A++HQWI ++ +P   + EK+  K   + T            ++  A  +  +  NDS+G++
Sbjct:   93 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNN------------GGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTV--LNGSRSRRGKMRGAPGSKDWVAALKGC-EDSLFIDFLKGCLTWDPVARMTPSQALRHQWISKR-LPKPSVTEKASGKRISSQTSSFPGIGSKLPPVVGVANKLRANLMNDSNGSI 528          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 438.343 bits (1126), Expect = 1.667e-146
Identity = 246/452 (54.42%), Postives = 317/452 (70.13%), Query Frame = 1
Query:  127 LNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGTCQ---------DILATAIDVEFSNKNDSSGTM 1455
            L P  A+K + ++++ +E  EI  + ++Y++G NA+K + +    NN             G+DD+QG Y  V  DH+AYRYEV+K+IGKGSFGQV K YDHKL  ++ALK+VRNEKRF RQAAEEIRILEHL++ DK    N++H+ E FTFRNH+C+TFELL+ NL+ELIK+NKF+GFSL LVRKFA SILQCL+AL +N+IIHCDLKPENILL+   RS IKVIDFGSSC+++QRVYTYIQSRFYRAPEVILG +YG+PIDMWSFGCIL EL+TGYPLFPGEDE DQL+CM+ELLG PP  LL   KR   F  S   PRYC V   P   ++  L GS ++RGK RG PGSK     LK    D LF+DF++  L ++P  RM P +A++HQWI ++ +P   + EK+  K   + T            ++  A  +  +  NDS+G++
Sbjct:   83 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNN------------GGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTV--LNGSRSRRGKMRGAPGSKDWVAALKGC-EDSLFIDFLKGCLTWDPVARMTPSQALRHQWISKR-LPKPSVTEKASGKRISSQTSSFPGIGSKLPPVVGVANKLRANLMNDSNGSI 518          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 439.884 bits (1130), Expect = 1.720e-146
Identity = 246/452 (54.42%), Postives = 317/452 (70.13%), Query Frame = 1
Query:  127 LNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGTCQ---------DILATAIDVEFSNKNDSSGTM 1455
            L P  A+K + ++++ +E  EI  + ++Y++G NA+K + +    NN             G+DD+QG Y  V  DH+AYRYEV+K+IGKGSFGQV K YDHKL  ++ALK+VRNEKRF RQAAEEIRILEHL++ DK    N++H+ E FTFRNH+C+TFELL+ NL+ELIK+NKF+GFSL LVRKFA SILQCL+AL +N+IIHCDLKPENILL+   RS IKVIDFGSSC+++QRVYTYIQSRFYRAPEVILG +YG+PIDMWSFGCIL EL+TGYPLFPGEDE DQL+CM+ELLG PP  LL   KR   F  S   PRYC V   P   ++  L GS ++RGK RG PGSK     LK    D LF+DF++  L ++P  RM P +A++HQWI ++ +P   + EK+  K   + T            ++  A  +  +  NDS+G++
Sbjct:  122 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNN------------GGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTV--LNGSRSRRGKMRGAPGSKDWVAALKGC-EDSLFIDFLKGCLTWDPVARMTPSQALRHQWISKR-LPKPSVTEKASGKRISSQTSSFPGIGSKLPPVVGVANKLRANLMNDSNGSI 557          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:MGI Symbol;Acc:MGI:1330301])

HSP 1 Score: 496.893 bits (1278), Expect = 1.795e-168
Identity = 260/423 (61.47%), Postives = 320/423 (75.65%), Query Frame = 1
Query:  118 SEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGT 1386
            + P+ P  AMK +M K+T FE HEIF YP++Y+LG NA+K + +T   NN             G+DD+QGSY+ V  DH+AYRYEV+K+IGKGSFGQVVKAYDHK+  +VALK+VRNEKRF RQAAEEIRILEHL++ DK++  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RSSIKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE DQL+CMIELLG+P   LL   KR   F +S   PRYC V     +     L G  ++RGK RGPP S+   N LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+ +P    GEK+  K     T
Sbjct:  149 ASPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGPNAKKRQGMTGGPNN------------GGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTT--LSDGSVVLNGGRSRRGKLRGPPESREWGNALKGC-DDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRR-LPKPPTGEKTAVKRVTEST 555          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk3 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:MGI Symbol;Acc:MGI:1330300])

HSP 1 Score: 445.277 bits (1144), Expect = 1.596e-148
Identity = 237/400 (59.25%), Postives = 295/400 (73.75%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRR 1323
            PL P  A+K + + +T +E+ EI  YP++Y++G NA+K + +    NN             G+DD  G+YIHV  DH+AYRYEV+K+IGKGSFGQV + YDHKL  YVALK+VRNEKRF RQAAEEIRILEHL++ DK    N++H+ E FTFRNHVC+ FELL+ +L+ELIKKNKF+GFS+ LVRKFA SILQ LDAL KN+IIHCDLKPENILL+H  RS+ KVIDFGSSC+E Q++YTYIQSRFYRAPE+ILG +Y  PID+WSFGCILAEL+TG PLFPGEDE DQL+CMIELLG+PP  LL   KR   F  S  +PRYC V+          L G  ++RGK RGPPGSK     LK  G D LF++F++R L ++P  R+ P +A++H WI +
Sbjct:  139 PLTPEQALKQYKHHLTAYEKLEIVSYPEIYFVGPNAKKRQGVIGGPNN------------GGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMIELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVSTQ--TDGRVVLLGGRSRRGKKRGPPGSKDWATALKGCG-DYLFIEFLKRCLQWDPSARLTPAQALRHPWISK 523          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk4 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 [Source:MGI Symbol;Acc:MGI:1330292])

HSP 1 Score: 355.525 bits (911), Expect = 3.276e-113
Identity = 204/398 (51.26%), Postives = 267/398 (67.09%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWI 1317
            PL    A+K+F N+++ +EQ EI  Y ++++LG  A+K        N  PE  S        FDDE GSY+ VL DHIAYRYEV+++IGKGSFGQV K  DHK    VALKI+RN+KRF  QA  E++ILE L++ DK++  N+VH+ + F FRNH+CITFELL  NL+EL+K N F GF+L +VR+F  SIL+CL  L   +IIHCDLKPENI+L    + ++KVIDFGSSCYE+Q+VYTYIQSRFYR+PEVILG  Y + IDMWS GCI+AEL TGYPLFPGE+E +QL+C++E+LGLPP +      R   FF S  +P+           ++N  +G      +Y   P SK +   +KT   D  F+DF+RR L + P  RM P +A+KH WI
Sbjct:  150 PLTVAEALKFFKNQLSPYEQSEILGYSELWFLGLEAKKL-------NVVPEKFSK-----TSFDDEHGSYMKVLHDHIAYRYEVLEMIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHHQALVELKILEALRRKDKDNNHNVVHMKDFFYFRNHLCITFELLGINLYELMKNNSFHGFNLSIVRRFTFSILKCLHMLYVEKIIHCDLKPENIVLYQRGQVTVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYNMAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPAHFTQTASRRQVFFDSKGLPK-----------NINNNRGG----KRY---PDSKDLTMVVKTY--DSSFLDFLRRCLVWEPSLRMTPEQALKHAWI 515          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 268.47 bits (685), Expect = 3.480e-80
Identity = 170/385 (44.16%), Postives = 230/385 (59.74%), Query Frame = 1
Query:  205 QVYYLGQNAQKSRRLTQQKNNYPESCSNLEE---FNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQ--IIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFF-----TSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKC 1329
            +VYY    A+K RR  Q     P+  S  +E    N+G+DD+   YI    +    RYE+  LIGKGSFGQVVKAYDH+    VA+KI++N+K F  QA  E+R+LE + Q+D E K  IVH+  HF FRNH+C+ FELL+ NL++L++   FRG SL L RK A  +   L  L   +  IIHCDLKPENILL +  RS+IK++DFGSSC   QR+Y YIQSRFYR+PEV+LG  Y L IDMWS GCIL E+ TG PLF G +E DQ+S ++E+LG+PP  +L    +  K+F         + R  E+ +D   P   +L+      G   G PG +       +  +   F D + R L++ P  R+ P  A++H + RR  
Sbjct:   61 EVYY----AKKKRRAQQAP---PQDSSTKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRTKELRKDYQGPGTRRLQEVL---GVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTA 435          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 267.7 bits (683), Expect = 2.569e-79
Identity = 170/385 (44.16%), Postives = 230/385 (59.74%), Query Frame = 1
Query:  205 QVYYLGQNAQKSRRLTQQKNNYPESCSNLEE---FNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQ--IIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFF-----TSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKC 1329
            +VYY    A+K RR  Q     P+  S  +E    N+G+DD+   YI    +    RYE+  LIGKGSFGQVVKAYDH+    VA+KI++N+K F  QA  E+R+LE + Q+D E K  IVH+  HF FRNH+C+ FELL+ NL++L++   FRG SL L RK A  +   L  L   +  IIHCDLKPENILL +  RS+IK++DFGSSC   QR+Y YIQSRFYR+PEV+LG  Y L IDMWS GCIL E+ TG PLF G +E DQ+S ++E+LG+PP  +L    +  K+F         + R  E+ +D   P   +L+      G   G PG +       +  +   F D + R L++ P  R+ P  A++H + RR  
Sbjct:  121 EVYY----AKKKRRAQQAP---PQDSSTKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRTKELRKDYQGPGTRRLQEVL---GVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTA 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Match: sp|Q5U4C9|DYRK2_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Mus musculus OX=10090 GN=Dyrk2 PE=2 SV=1)

HSP 1 Score: 496.893 bits (1278), Expect = 1.256e-167
Identity = 260/423 (61.47%), Postives = 320/423 (75.65%), Query Frame = 1
Query:  118 SEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGT 1386
            + P+ P  AMK +M K+T FE HEIF YP++Y+LG NA+K + +T   NN             G+DD+QGSY+ V  DH+AYRYEV+K+IGKGSFGQVVKAYDHK+  +VALK+VRNEKRF RQAAEEIRILEHL++ DK++  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RSSIKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE DQL+CMIELLG+P   LL   KR   F +S   PRYC V     +     L G  ++RGK RGPP S+   N LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+ +P    GEK+  K     T
Sbjct:  149 ASPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGPNAKKRQGMTGGPNN------------GGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTT--LSDGSVVLNGGRSRRGKLRGPPESREWGNALKGC-DDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRR-LPKPPTGEKTAVKRVTEST 555          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Match: sp|Q92630|DYRK2_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens OX=9606 GN=DYRK2 PE=1 SV=3)

HSP 1 Score: 493.426 bits (1269), Expect = 3.024e-166
Identity = 258/417 (61.87%), Postives = 318/417 (76.26%), Query Frame = 1
Query:  118 SEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQK 1368
            + P+ P  AMK +M K+T FE HEIF YP++Y+LG NA+K + +T   NN             G+DD+QGSY+ V  DH+AYRYEV+K+IGKGSFGQVVKAYDHK+  +VALK+VRNEKRF RQAAEEIRILEHL++ DK++  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE DQL+CMIELLG+P   LL   KR   F +S   PRYC V     +     L G  ++RGK RGPP S+   N LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+ +P    GEK+  K
Sbjct:  151 ATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNN------------GGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTT--LSDGSVVLNGGRSRRGKLRGPPESREWGNALKGC-DDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRR-LPKPPTGEKTSVK 551          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Match: sp|Q5ZIU3|DYRK2_CHICK (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Gallus gallus OX=9031 GN=DYRK2 PE=2 SV=1)

HSP 1 Score: 478.019 bits (1229), Expect = 3.075e-161
Identity = 256/420 (60.95%), Postives = 317/420 (75.48%), Query Frame = 1
Query:  127 LNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGT 1386
            + P  AMK +M K+T FE +EIF Y ++Y+LG NA+K + +    NN    C        G+DD+QGSYI V  DHIAYRYEV+K+IGKGSFGQVVKAYDHK+  +VALK+VRNEKRF RQAAEEIRILEHL++ DK++  N++H+ E+FTFR+H+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE DQL+CMIELLG+P   LL + KR   F +S   PRYC +     +     L G  ++RGK RGPP S+   N LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+ +P    GEK+  K     T
Sbjct:   79 MTPEQAMKQYMQKLTTFEHNEIFGYTEIYFLGPNAKKRQGVIGGPNN----C--------GYDDDQGSYIQVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKMHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNNMNVIHMLENFTFRSHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSPKLLDSSKRAKNFVSSKGYPRYCTITT--LSDGSIILNGGRSRRGKLRGPPESREWGNALKGC-DDPLFLDFLKQCLEWDPAIRMTPSQALRHPWLRRR-LPKPPTGEKASAKRITEST 482          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Match: sp|Q922Y0|DYRK3_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus OX=10090 GN=Dyrk3 PE=1 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 1.116e-147
Identity = 237/400 (59.25%), Postives = 295/400 (73.75%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRR 1323
            PL P  A+K + + +T +E+ EI  YP++Y++G NA+K + +    NN             G+DD  G+YIHV  DH+AYRYEV+K+IGKGSFGQV + YDHKL  YVALK+VRNEKRF RQAAEEIRILEHL++ DK    N++H+ E FTFRNHVC+ FELL+ +L+ELIKKNKF+GFS+ LVRKFA SILQ LDAL KN+IIHCDLKPENILL+H  RS+ KVIDFGSSC+E Q++YTYIQSRFYRAPE+ILG +Y  PID+WSFGCILAEL+TG PLFPGEDE DQL+CMIELLG+PP  LL   KR   F  S  +PRYC V+          L G  ++RGK RGPPGSK     LK  G D LF++F++R L ++P  R+ P +A++H WI +
Sbjct:  139 PLTPEQALKQYKHHLTAYEKLEIVSYPEIYFVGPNAKKRQGVIGGPNN------------GGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMIELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVSTQ--TDGRVVLLGGRSRRGKKRGPPGSKDWATALKGCG-DYLFIEFLKRCLQWDPSARLTPAQALRHPWISK 523          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Match: sp|Q9XTF3|MBK2_CAEEL (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans OX=6239 GN=mbk-2 PE=1 SV=1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.710e-147
Identity = 238/398 (59.80%), Postives = 300/398 (75.38%), Query Frame = 1
Query:  133 PRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK 1326
            P  A++ F  K+  FE++EI+ Y +V+++G +A+K   +    NN             G+DDE GSY  V+ DHIAYRYEV+K+IGKGSFGQV+KA+DHK   YVALK+VRNEKRF RQA EEIRIL+HL++ D +   NI+H+ ++F FRNH CITFELL+ NL+ELIK+NKF+GFSL+LVRKFA S+L CLD L+KN++IHCDLKPEN+LL+   RS IKVIDFGSSC+++QR+YTYIQSRFYRAPEVILG KYG+PIDMWS GCILAEL+TGYPL PGEDE+DQL+ +IELLG+PP   L   KR   F TS   PRYC     P    +  L G+ +KRGK RGPP S+S    LK  G D LFVDF++R LD++PETRM P +A+KH+W+RR+
Sbjct:  395 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANN------------GGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVV--LAGARSKRGKMRGPPASRSWSTALKNMG-DELFVDFLKRCLDWDPETRMTPAQALKHKWLRRR 777          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: V4A1L8 (Protein kinase domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_123164 PE=4 SV=1)

HSP 1 Score: 503.056 bits (1294), Expect = 4.332e-168
Identity = 260/403 (64.52%), Postives = 317/403 (78.66%), Query Frame = 1
Query:  118 SEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK 1326
            S  ++P +AMK +M+K++ FE HEIF YPQ+Y++GQNA+K + +    +N            NG+DDE GSY+HV  DHI+YRYEV+K+IGKGSFGQVVKAYDHK G ++ALK+VRNEKRF RQA EEIRILEHL++ DKE+  NIVH+ EHFTFRNH+CITFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL +N+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QR+YTYIQSRFYRAPEVILG KYG+ IDMWS GCILAEL+TGYPLFPGEDE DQL+C+IELLG+PP  +L   KR   F +S   PRYC V   P    +  L G  ++RGK RGPPGSK +   LK   +DP+F+DF+RRSLD++P  RM P +A++H W+RR+
Sbjct:  103 SNSMSPEVAMKQYMHKLSSFEHHEIFNYPQIYFVGQNAKKRQGVVGAASN------------NGYDDENGSYVHVPHDHISYRYEVLKVIGKGSFGQVVKAYDHKAGAHIALKMVRNEKRFHRQAQEEIRILEHLKKQDKENTMNIVHMLEHFTFRNHICITFELLSMNLYELIKKNKFQGFSLQLVRKFAHSILQCLDALYRNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGTKYGMAIDMWSLGCILAELLTGYPLFPGEDEGDQLACIIELLGMPPQKILDVSKRARNFISSKGYPRYCSVTTLPDGSVV--LNGGRSRRGKPRGPPGSKELVTALKGC-DDPMFIDFMRRSLDWDPNVRMNPSQALRHPWLRRR 490          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: K1QR76 (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Crassostrea gigas OX=29159 GN=CGI_10020062 PE=4 SV=1)

HSP 1 Score: 499.59 bits (1285), Expect = 8.254e-167
Identity = 263/417 (63.07%), Postives = 318/417 (76.26%), Query Frame = 1
Query:   76 NSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK 1326
             S    A + RN     ++P  AMK +M+K+T FE HEIF YP ++++GQNA+K + +    NN            NG+DDE GSYIHV  DHI YRYEV+K+IGKGSFGQVVKAYDHK+ +++ALK+VRNEKRF RQA EEIRILEHL++ DK++  NIVH+ EHFTFRNH+CITFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QR+YTYIQSRFYRAPEVILG KYG+PIDMWS GCILAEL+TGYPLFPGEDE DQL+C+IEL G+PP  LL   KR   F +S   PRYC V   P   ++  L G  ++RGK RGPP SK +   LK    DPLF+DF++R LD++P TRM P +A++H W+RR+
Sbjct:   91 GSKTGSAAARRN---NSMSPESAMKQYMHKLTSFEHHEIFNYPSIFFVGQNAKKRQGVVGGANN------------NGYDDENGSYIHVPHDHIGYRYEVLKVIGKGSFGQVVKAYDHKINSHIALKMVRNEKRFHRQAQEEIRILEHLKKQDKDNAMNIVHMLEHFTFRNHICITFELLSMNLYELIKKNKFQGFSLQLVRKFAHSILQCLDALYKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGAKYGMPIDMWSLGCILAELLTGYPLFPGEDEGDQLACIIELQGMPPQKLLDQSKRARNFISSKGFPRYCTVTTLPDGSTV--LNGCRSRRGKPRGPPSSKEMVTALKGC-EDPLFLDFMKRCLDWDPSTRMTPGQALRHPWLRRR 489          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: A0A076G429 (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Cerebratulus lacteus OX=6221 PE=2 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 3.704e-166
Identity = 260/403 (64.52%), Postives = 315/403 (78.16%), Query Frame = 1
Query:  118 SEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK 1326
            S  ++P  AMK +M+K++ FE HEIF YPQ+Y++G NA+K + +    NN            NG+DD+QGSY+H+  DHI+YRYEV+K+IGKGSFGQVVKAYDHK   +VALK+VRNEKRF RQA EEIRILEHL++ DK++  NI+HI EHF FRNH+CITFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QR+YTYIQSRFYRAPEVILG KYG+PIDMWS GCILAEL+TGYPLFPGEDE DQL+C+IELLG+PP  LL   KR   F +S   PRYC V   P   ++  L    ++RGK RGPPGSK +   LK   +DPLF+DF+RR LD++P TRM P +A++H W+RR+
Sbjct:  119 SSAVSPETAMKQYMHKLSSFEHHEIFNYPQIYFVGHNAKKRQGVIGGPNN------------NGYDDDQGSYVHIPHDHISYRYEVLKVIGKGSFGQVVKAYDHKSNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQDKDNTHNIIHITEHFVFRNHICITFELLSMNLYELIKKNKFQGFSLQLVRKFAHSILQCLDALNKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGAKYGMPIDMWSLGCILAELLTGYPLFPGEDEGDQLACVIELLGMPPQKLLDQSKRARNFISSKGYPRYCTVTTLPDGSTV--LGPGRSRRGKTRGPPGSKEMVTGLKGC-DDPLFLDFMRRCLDWDPATRMSPGQALRHAWLRRR 506          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: A0A4W6CXM1 (Protein kinase domain-containing protein OS=Lates calcarifer OX=8187 GN=dyrk2 PE=4 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 1.037e-165
Identity = 259/417 (62.11%), Postives = 319/417 (76.50%), Query Frame = 1
Query:   76 NSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK 1326
             S  S  ++   P   PL+P  AMK FM+K++ FE HE+F YP+VY++G NA+K   +    NN             G+DD+QGSYIHV  DHIAYRYEV+K+IGKGSFGQVVKA+DHK   +VALK+VRNEKRF RQAAEEIRILEHL++ DK+S  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLD+L KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE+DQL+C+IELLG+P   LL   KR   F +S   PRYC V   P   ++  L G  ++RGK RGPPGSK     LK   +DPLF+DF+++SL+++P  RM P +A++H W+RR+
Sbjct:  119 GSATSNKSTDSKPKPNPLSPEQAMKQFMSKMSSFEHHEVFSYPEVYFVGPNAKKRSGVMGGANN------------GGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAFDHKSQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSSMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDSLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEADQLACIIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLPDGTTV--LNGGRSRRGKVRGPPGSKDWSAALKGC-DDPLFLDFLKQSLEWDPALRMTPSQALRHPWLRRR 520          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: A0A0S7H005 (DYRK2 (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=DYRK2 PE=3 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 2.998e-165
Identity = 261/413 (63.20%), Postives = 316/413 (76.51%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKC--IPVKQIGEK 1356
            P++P LAMK +M+K++ FE HE+F YP+VY++GQNA+K   +    NN             G+DDEQGSYI V  D IAYRYEV+K+IGKGSFGQVVKA+DHK   +VALK+VRNEKRF RQAAEEIRILEHL++ DK+S  N++H+ EHFTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDESDQL+C+IELLG+P   LL   KR   F +S   PRYC V   P    +  L G  ++RGK RGPPGSK     LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+    P    GEK
Sbjct:    8 PMSPDLAMKQYMSKLSSFEHHEVFSYPEVYFIGQNAKKRNGILGAANN------------GGYDDEQGSYIQVPHDQIAYRYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLKKQDKDSSMNVIHMMEHFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDESDQLACIIELLGMPNPKLLEVSKRAKNFVSSKGFPRYCTVTTMPDGSVV--LNGGRSRRGKTRGPPGSKDWSAALKGC-DDPLFLDFLKQCLEWDPALRMTPSQALRHPWLRRRLPKPPSGTTGEK 405          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:103042530])

HSP 1 Score: 487.263 bits (1253), Expect = 6.380e-165
Identity = 265/445 (59.55%), Postives = 327/445 (73.48%), Query Frame = 1
Query:   52 ETT*MMIGNSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGT 1386
            ETT    G+S   ++T  + P   PL P  AMK +++K++ FE  EIF YP+++++G NA+K                     N G+DD+QGSYIHV  DHIAYRYEV+K+IGKGSFGQVVKAYDHK   +VALK+VRNEKRF RQAAEEIRILEHL++ DK+S  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLD+L KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE DQL+C+IELLG+P   LL + KR   F +S   PRYC V   P       L G  ++RGK RGPPGSK     LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+ +P    GEK+  K    GT
Sbjct:  115 ETTQCRQGSSTSIKSTDSK-PKPAPLTPEQAMKQYLSKLSTFEHQEIFNYPEIFFVGPNAKK------------RPGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKTHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDSLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIELLGMPSQKLLDSSKRAKNFISSKGYPRYCTVTSLP--DGTVALNGGRSRRGKLRGPPGSKDWVTALKGC-DDPLFLDFLKQCLEWDPTLRMTPSQALRHPWLRRR-LPKPPTGEKTTVKRITEGT 542          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:103034036])

HSP 1 Score: 459.914 bits (1182), Expect = 3.147e-154
Identity = 245/413 (59.32%), Postives = 305/413 (73.85%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSF 1362
            PL    A+K +  ++T  EQ E+  Y +++++G NA+K + +    NN    C        G+DD+QG YIHV  DHIAYRYE +K+IGKGSFGQV K YDHKL  ++ALK+VRNEKRF RQAAEEIRILEHL++ DK    N+VH+ E+FTFRNH+C+TFELL+ NL+ELIK+NKF+GFSL LVRKFA SILQCL+AL++++IIHCDLKPENILL+   RS IKVIDFGSSC+++QRVYTYIQSRFYRAPEVILG +YG+PIDMWSFGCILAEL+TGYPLFPGEDE DQL+CM+ELLG+PP  LL   KR   F  S   PRYC V     +     L GS ++RGK RGPPGSK     LK   +DP F+DF+R+ LD+ P TRM P  A++H W+ ++       GEK+ 
Sbjct:  135 PLGAEQALKQYRQQLTAMEQQEVHNYSEIFFVGPNAKKRQAVAGGSNN----C--------GYDDDQGGYIHVPHDHIAYRYEFLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALQRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLEQAKRAKNFINSKGHPRYCTVTT--LSNGTLVLNGSRSRRGKMRGPPGSKEWVTALKGC-DDPTFIDFLRKCLDWEPSTRMTPVSALRHPWLYKRLPKPVPSGEKTM 532          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:103034036])

HSP 1 Score: 459.144 bits (1180), Expect = 4.136e-154
Identity = 245/413 (59.32%), Postives = 305/413 (73.85%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSF 1362
            PL    A+K +  ++T  EQ E+  Y +++++G NA+K + +    NN    C        G+DD+QG YIHV  DHIAYRYE +K+IGKGSFGQV K YDHKL  ++ALK+VRNEKRF RQAAEEIRILEHL++ DK    N+VH+ E+FTFRNH+C+TFELL+ NL+ELIK+NKF+GFSL LVRKFA SILQCL+AL++++IIHCDLKPENILL+   RS IKVIDFGSSC+++QRVYTYIQSRFYRAPEVILG +YG+PIDMWSFGCILAEL+TGYPLFPGEDE DQL+CM+ELLG+PP  LL   KR   F  S   PRYC V     +     L GS ++RGK RGPPGSK     LK   +DP F+DF+R+ LD+ P TRM P  A++H W+ ++       GEK+ 
Sbjct:  127 PLGAEQALKQYRQQLTAMEQQEVHNYSEIFFVGPNAKKRQAVAGGSNN----C--------GYDDDQGGYIHVPHDHIAYRYEFLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALQRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLEQAKRAKNFINSKGHPRYCTVTT--LSNGTLVLNGSRSRRGKMRGPPGSKEWVTALKGC-DDPTFIDFLRKCLDWEPSTRMTPVSALRHPWLYKRLPKPVPSGEKTM 524          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 384.415 bits (986), Expect = 2.420e-124
Identity = 218/436 (50.00%), Postives = 294/436 (67.43%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWI--------RRKCIPVKQIG-----EKSFQKESENGTCQ 1392
            P++P  A+K+F +++T +EQ EI  Y +++YLG + +K            E C    + N+G+DDE GSY+ VL DHIAYRYEV+++IGKGSFGQV+K  DHK    VA+KI+RN+KRF +QA  E++IL+ +++ D++S  N++H+ E+F FRNH+CI+FELL  NL+ELIKKN F+GFSL L+R+FA S+L+CL  L + +IIHCDLKPENILL    + +IKV+DFGSSCYE QRVYTYIQSRFYR+PEVILG  Y + IDMWS GCILAEL TGYPLFPGE E +Q++C++E++G+PP + +    R   FF S   PR                      +GK R  P SK + + LKT  NDPLF+DFIRR L ++P  RM P E M+H+WI        R K  PV++ G     E +F++ S N T +
Sbjct:  138 PMSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKI-----------EGCQGSPQ-NSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRDSCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPRNVT-----------------NSKGKKRR-PNSKELASVLKT--NDPLFLDFIRRCLVWDPTKRMTPDEGMQHEWITEGRLTRLRPKTRPVRKPGDSDNYEYTFRRSSTNRTVE 541          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 384.03 bits (985), Expect = 2.795e-124
Identity = 218/436 (50.00%), Postives = 294/436 (67.43%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWI--------RRKCIPVKQIG-----EKSFQKESENGTCQ 1392
            P++P  A+K+F +++T +EQ EI  Y +++YLG + +K            E C    + N+G+DDE GSY+ VL DHIAYRYEV+++IGKGSFGQV+K  DHK    VA+KI+RN+KRF +QA  E++IL+ +++ D++S  N++H+ E+F FRNH+CI+FELL  NL+ELIKKN F+GFSL L+R+FA S+L+CL  L + +IIHCDLKPENILL    + +IKV+DFGSSCYE QRVYTYIQSRFYR+PEVILG  Y + IDMWS GCILAEL TGYPLFPGE E +Q++C++E++G+PP + +    R   FF S   PR                      +GK R  P SK + + LKT  NDPLF+DFIRR L ++P  RM P E M+H+WI        R K  PV++ G     E +F++ S N T +
Sbjct:  130 PMSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKI-----------EGCQGSPQ-NSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRDSCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPRNVT-----------------NSKGKKRR-PNSKELASVLKT--NDPLFLDFIRRCLVWDPTKRMTPDEGMQHEWITEGRLTRLRPKTRPVRKPGDSDNYEYTFRRSSTNRTVE 533          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 461.84 bits (1187), Expect = 4.314e-156
Identity = 250/408 (61.27%), Postives = 309/408 (75.74%), Query Frame = 1
Query:  112 PLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIK-VIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCI 1332
            P S  ++P  AM+ +M+++++FE HEIF Y +VY++G +A+K R+ T    N           NNGFDDEQGSYIHV  DH+AYRYEV+++IGKGSFGQVVKAYDH+   YVALK+VRNEKRF RQAAEEIRILEHL++ DKE+  N++H+ E F FRNH+C+TFELL+ NL+ELIKKNKF+GFSL +VRKFA SIL CL+AL KN+IIHCDLKPENILLR   RS IK +IDFGSSCYE+QRVYTYIQSRFYRAP    GG+YGLPIDMWS GCILAEL+TG PL PGEDE DQL+C +EL G PP  LL   KR  +FF+S   PRYC V   P  P +  L G  T+RGK RGPP S+     LK   +D LF+DF+++ LD++P TR+ P +A+KH W+RR+ +
Sbjct:   99 PHSTAMSPEQAMRKYMHRLSMFEHHEIFNYHEVYFVGPSAKK-RQATLSGVN-----------NNGFDDEQGSYIHVPHDHVAYRYEVLRVIGKGSFGQVVKAYDHRTHQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKENTMNVIHMLESFNFRNHICMTFELLSMNLYELIKKNKFQGFSLQVVRKFAHSILLCLNALHKNRIIHCDLKPENILLRQQGRSGIKIIIDFGSSCYEHQRVYTYIQSRFYRAP----GGRYGLPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELTGSPPARLLEQSKRARQFFSSLGHPRYCTVTTLPGGPVV--LNGGRTRRGKLRGPPSSRDWTTALKGC-DDHLFIDFLKKCLDWDPATRLTPSQALKHPWLRRRPL 487          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 445.662 bits (1145), Expect = 9.056e-150
Identity = 237/399 (59.40%), Postives = 298/399 (74.69%), Query Frame = 1
Query:  118 SEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQW 1314
            S+  +P  A++ +  K+T +E  EI+ Y ++Y++G NA+K   +    +N    C        G+DDEQGSY+HV  DH+AYRYEV+K+IGKGSFGQVVKA+DHK   +VALK+VRNEKRF RQAAEEIRILEHL++ D+E+  NI+H+ E FTFR HVC+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLD L +N+IIHCDLKPENILL+   RS IKVIDFGSSC+E+QRVYTYIQSRFYRAPEV+LG +YG PIDMWS GCILAEL+TG PL PGEDE DQL+C +ELLG+PP  LL   KR+  F +S   PRYC V E P    +  L    ++RGK RGPPGS+ +   L+   +DPL +DF+R  L++ P  R+ P +A++H W
Sbjct:   91 SQLASPDQAVRLYGQKLTAYEHQEIYNYAEIYFVGHNAKKRPGVVGGASN----C--------GYDDEQGSYVHVAHDHVAYRYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDRENSMNIIHLLESFTFRGHVCMTFELLSMNLYELIKKNKFQGFSLALVRKFAHSILQCLDTLHRNRIIHCDLKPENILLKQPGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVVLGARYGPPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELLGMPPQRLLAQGKRSRNFVSSRGHPRYCGVTEAPDGAVV--LNAGRSRRGKPRGPPGSRELPAALRGC-DDPLLLDFLRGCLEWEPSERLTPAQALRHPW 474          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 251.136 bits (640), Expect = 3.780e-73
Identity = 153/329 (46.50%), Postives = 213/329 (64.74%), Query Frame = 1
Query:  364 RYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQ--IIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFF--TSDCIPRYCEVAEDPFNPSMNKLKGSFTKR-----GKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRR 1323
            RYE+  LIGKGSFGQVVKAYDH+   +VA+KI++N+K F  QA  E+R+LE + ++D + K  IVH+  HF FRNH+C+ FELL+ NL++L++   FRG SL L RKFA  +   L  L   +  IIHCDLKPENILL +  RS+IK++DFGSSC   QR+Y YIQSRFYR+PEV+LG  Y L IDMWS GCIL E+ TG PLF G +E DQ++ ++E+LGLPP ++L    +  K+F   SD      +  +     S  + K + +++     G   G PG + +     T  +   F D I R LD++P+TR+ P  A++H + ++
Sbjct:  161 RYEIDSLIGKGSFGQVVKAYDHQEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTDMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGLPPTHMLEQAPKARKYFERLSDGSWTVKKTKD-----SKREYKTAGSRKLHDIIGVESGGPGGRRMGEAGHTVADYLKFKDLILRMLDYDPKTRITPFYALQHNFFKK 484          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007958.1 (pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.386 bits (542), Expect = 6.599e-64
Identity = 137/328 (41.77%), Postives = 191/328 (58.23%), Query Frame = 1
Query:  340 VLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAE-EIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIR 1320
            V  +H+ YRYEV++++G+GSFG+V+K  DHK   +VA+K++ N  RF       EI IL+ LQ   + SK  I+ + EHF+FR   C+ FELLN NL   +K    +GF L +VR FAIS+L+ L+ L    +IH DLKP NI +       +K+ DFG SC++++  +T IQ+R YRAPEVIL   Y  P DMWS GC LAEL +G  LFPG    DQL  ++E+ GLPP +++   +    FF              P +  +N        RG  R  PGS+++   L+T   D  F DFIR  L ++PE R+ P  AM H+W+R
Sbjct:    2 VWHEHLLYRYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVL-NRARFNESVHRREIEILKRLQTARESSK--IIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFA----------ITKPTHWDIN------NHRGLVR-VPGSRALPLALRT--TDEHFTDFIRSCLQWDPEWRLTPHGAMDHEWVR 307          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007952.1 (pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.616 bits (540), Expect = 1.368e-63
Identity = 139/333 (41.74%), Postives = 195/333 (58.56%), Query Frame = 1
Query:  340 VLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAE-EIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIP 1335
            V  +H+ YRYEV++++G+GSFG+V+K  DHK   +VA+K++ N  RF       EI IL+ LQ   + SK  I+ + EHF+FR   C+ FELLN NL   +K    +GF L +VR FAIS+L+ L+ L    +IH DLKP NI +       +K+ DFG SC++++  +T IQ+R YRAPEVIL   Y  P DMWS GC LAEL +G  LFPG    DQL  ++E+ GLPP +++   +    FF        C+  +   N  +N        RG  R  PGS+++   L+T   D  F DFIR  L ++PE R+ P  AM H+W+R   +P
Sbjct:    2 VWHEHLLYRYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVL-NRARFNESVHRREIEILKRLQTARESSK--IIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFA-------CK--DFSSNVRLN--------RGLVR-VPGSRALPLALRT--TDEHFTDFIRSCLQWDPEWRLTPHGAMDHEWVRAPRMP 311          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: YAK1 (Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose [Source:SGD;Acc:S000003677])

HSP 1 Score: 211.075 bits (536), Expect = 7.057e-59
Identity = 158/440 (35.91%), Postives = 243/440 (55.23%), Query Frame = 1
Query:  301 NNGFDDEQGSYIHVLSDHIAY----RYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHL-QQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFF-------TSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPG-------SKSICNDL----KTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRK-----------CIP-VKQIGEKSFQKESENGTCQDILATAIDVEFSNKNDSSGTMSATD-GILETTKQFTFNEIS 1512
            NNGFD+    YI  ++D +      +Y V+ ++G+G+FGQVVK  +      +A+K+V++   +  Q+  E +ILE L Q+ D  +K + + +Y+ F  +NH+C+ FELL+NNL+EL+K+NKF G S+ L+R F   IL  L  L+++++IHCDLKPENILL   ++  +K+IDFGSSC E + VYTYIQSRFYRAPE+ILG  Y   IDMWS GCI+AEL  G P+FPG  E +QL+ +I+ LG PP  ++   K + KF        +S    ++     + F    N ++    +  K+R  P         KSI N      +   N    + F+   L+ NP  R  P++AM H +I ++            +P   +  + +  ++SE G+  D    A      N + ++G   + D G +   K+ T  +IS
Sbjct:  343 NNGFDNINSDYILYVNDVLGVEQNRKYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTNKHHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESKLIHCDLKPENILLCAPDKPELKIIDFGSSCEEARTVYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNSGKFMKKLAPEESSSSTQKHRMKTIEEFCREYNIVEKPSKQYFKWRKLPDIIRNYRYPKSIQNSQELIDQEMQNRECLIHFLGGVLNLNPLERWTPQQAMLHPFITKQEFTGEWFPPGSSLPGPSEKHDDAKGQQSEYGSANDSSNNAGHNYVYNPSSATGGADSVDIGAISKRKENTSGDIS 782          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 121.324 bits (303), Expect = 7.790e-31
Identity = 93/327 (28.44%), Postives = 160/327 (48.93%), Query Frame = 1
Query:  364 RYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVR--NEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCIT----XXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTY---IQSRFYRAPEVILGGK-YGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQW 1314
            +++ ++ +G G++  V K  +   G YVALK V+  +E+     A  EI +++ L+        NIV +Y+     N + +        L   +      N  RG  L LV+ F   +LQ L    +N+I+H DLKP+N+L+    R  +K+ DFG +      V T+   + + +YRAP+V++G + Y   ID+WS GCILAE++TG PLFPG ++ +QL  + +++G P  +L  +  +         +P+Y        NP++ +           R P   + +         D   +DF+   L  NP+ R+  ++A+ H W
Sbjct:    6 QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHE------NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLIN--KRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTK---------LPKY--------NPNIQQ-----------RPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPW 296          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: KNS1 (Protein kinase involved in negative regulation of PolIII transcription; effector kinase of the TOR signaling pathway and phosphorylates Rpc53p to regulate ribosome and tRNA biosynthesis; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues; capable of autophosphorylation [Source:SGD;Acc:S000003942])

HSP 1 Score: 126.331 bits (316), Expect = 1.292e-30
Identity = 78/263 (29.66%), Postives = 134/263 (50.95%), Query Frame = 1
Query:  316 DEQGSYIHVLSDHIAY--RYEVVKLIGKGSFGQVVKAYDHKL-GNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILL------------------------------RHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCM 1005
            D+ G Y++  +D      R+ V  L+G+G+FG+V+K  D+K   NYVA+K++R   R+   A  E+RIL+ +   D + +   + + E F ++NH+C+  +L   ++++ +  N    F    ++  A  +++ +  L    IIH DLKPENIL+                              + +    IK+IDFGS+ +  +     I +R YRAPE++LG  +  P D+WS  C+L ELV G  L+P  +  + ++ M
Sbjct:  294 DKDGHYVYQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELRILQTILNNDPQGQFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAIARQLIRSVCFLHDLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKILKNPEIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIGESLYPIHENLEHMAMM 556          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 115.546 bits (288), Expect = 2.026e-28
Identity = 101/341 (29.62%), Postives = 167/341 (48.97%), Query Frame = 1
Query:  355 IAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVR--NEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHF----TFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVL---VRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFG-SSCYENQR---------VYTYIQSRFYRAPEVILG-GKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWI 1317
            I  +Y++V LIG+G++G V  A     G  VA+K ++  ++K F  +   EI++L +  +++     NI+ I +        + +     E L     + +  N+  GFS +    V+ F   IL+ L ++   Q+IH D+KP N+LL   +   +KV DFG + C  +           +  Y+ +R+YRAPE++L   +Y   +D+WS GCILAE+V+G PLFPG D   QL  ++E+LG            T  F             ED FN   +K    +      R P   +++ +  KT  N P  +D + + L FNP+ R+   EA++H ++
Sbjct:    9 IPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHE-----NIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLN--SNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLG------------TPSF-------------ED-FNQIKSKRAKEYIANLPMRPPLPWETVWS--KTDLN-PDMIDLLDKMLQFNPDKRISAAEALRHPYL 313          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 105.145 bits (261), Expect = 1.374e-24
Identity = 94/327 (28.75%), Postives = 152/327 (46.48%), Query Frame = 1
Query:  355 IAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVR---NEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFT--FRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGG-KYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGP-PGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQW 1314
            I  RY  +  +G G+FG V  A D      VA+K +    +     ++   E+++L+HL+        N++ + + F     +   +T     +    L  +   + F    V+ F   IL+ L  +    +IH DLKP NIL+       +K+ DFG +  ++ ++  Y+ +R+YRAPE++L   KY + +D+WS GCI AE++ G PLFPG+D   Q S + +LLG P                 D I   C         S N LK  F     +R P P S+      KT   +P  VD + + L F+P+ R+   +A+ H +
Sbjct:   19 ITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHE------NLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKYVHSAGVIHRDLKPSNILIN--ENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSP---------------PKDVINTIC---------SENTLK--FVTSLPHRDPIPFSER----FKTV--EPDAVDLLEKMLVFDPKKRITAADALAHPY 301          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO46144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP1])

HSP 1 Score: 474.552 bits (1220), Expect = 6.096e-161
Identity = 249/406 (61.33%), Postives = 305/406 (75.12%), Query Frame = 1
Query:  118 SEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIP 1335
            S      +AMK +M+K++ +E HEIF Y Q+Y++G+ A+K + +    NN    C        G+DDEQGSYIHV  DHIAYRYEV+K+IGKGSFGQVVKA DHK   +VALK+VRNEKRF RQA EEIRILEHL++ DK++  NI+H+ EHFTFRNHVC+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RS IKVIDFGSSCYE+QR+YTYIQSRFYRAPEVILG +YG+PIDMWSFGCILAEL+TGYPLFPGEDE DQL+C +ELLG  P  L    KR   F  S   PRYC +   P       + G  ++RGK RG P SK+    LK   +D +F+DF++R L+++P  RM P +A++H W+RR+ +P
Sbjct:   96 SRSFTAEVAMKQYMHKLSGYETHEIFNYSQIYFVGEAAKKRQGVVGGANN----C--------GYDDEQGSYIHVPKDHIAYRYEVLKIIGKGSFGQVVKALDHKTNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQDKDNTHNIIHMLEHFTFRNHVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGARYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACNMELLGYIPEKLRETSKRAKNFINSKGYPRYCTITTLPDGSVA--VSGGRSRRGKTRGAPNSKTFVQALKGC-DDAMFIDFLKRCLEWDPSARMTPSQALRHPWLRRRALP 486          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO36294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ45])

HSP 1 Score: 357.066 bits (915), Expect = 3.278e-118
Identity = 201/368 (54.62%), Postives = 264/368 (71.74%), Query Frame = 1
Query:  160 NKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLD 1263
            ++IT FEQ EI  YP+V++LG +A+K        +  P +  N     N +DD+ GSY+  L DH+AYRYEV++++GKGSFGQVVKA DHK G +VA+KI+RN+KRF +QA  E++IL++L++ DK++  N++H+ EHF FRNH+CITFEL+  NL+ELIKKN F+GFSL L+R+FA ++L CL  + K +IIHCDLKPENILLR   ++SIKVIDFGSSCYE+QRVYTYIQSRFYR+PEVILG  Y + IDMWSFGCILAEL TGYPLFPGE+E +QL+C++E+LGLP   L+ +  R   FF S  IPR                      +GK R  P S+ I   LKT  ND LF+DF+++ L+
Sbjct:    3 DRITTFEQSEILDYPEVWFLGLDAKKI-------DGVPGAPQN-----NNYDDDNGSYLKALHDHLAYRYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALVEVKILDNLRKKDKDNTHNLIHMIEHFYFRNHLCITFELMGMNLYELIKKNNFQGFSLALIRRFAFALLHCLKVIHKEKIIHCDLKPENILLRQRGQTSIKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGLPYSMAIDMWSFGCILAELYTGYPLFPGENEVEQLACIMEVLGLPSPKLIESASRRRLFFDSKGIPRCIT-----------------NSKGKKR-RPSSRDISAALKT--NDALFLDFLKQCLE 338          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO45187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC8])

HSP 1 Score: 245.743 bits (626), Expect = 4.430e-74
Identity = 155/351 (44.16%), Postives = 220/351 (62.68%), Query Frame = 1
Query:  295 EFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDAL--EKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFF------TSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRR 1323
            ++N+G+DDE   YI    +    RYE+  LIGKGSFGQV KAYDH+   ++A+KI++N+K F  QA  E+++LE + + D + K  IV +  HF +RNH+C+ FELL+ NL++L++   FRG SL L RKFA  +   L  L   +  IIHCDLKPENILL +  RS+IK++DFGSSC   QR+Y YIQSRFYR+PEV+LG  Y L IDMWS GCIL E+ TG PLF G +E DQ+  ++E+LG+PP ++L N  +  KFF      +  C+ +  +  ++  +P   KL       G   G PG + +     T  +   F D I R LD++ +TR+ P  A+ H + ++
Sbjct:   55 QYNDGYDDENYDYIVKAGEKWFDRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKIIKNKKPFLNQAQIEVKLLELMNKNDPDGKYYIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLCSPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQIGQRIYQYIQSRFYRSPEVLLGIPYNLAIDMWSLGCILVEMHTGEPLFSGANEFDQMMKIVEVLGMPPKDILDNAPKARKFFDRLPDGSYQCL-KVKDGVKEYLSPGSRKLHDIL---GCETGGPGGRRLGEAGHTLQDYLKFKDLILRMLDYDRKTRIVPYAALHHCFFKK 401          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO49238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV4])

HSP 1 Score: 166.392 bits (420), Expect = 9.518e-46
Identity = 125/338 (36.98%), Postives = 184/338 (54.44%), Query Frame = 1
Query:  373 VVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSS--IKVIDFGSSCYENQRV-YTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPP--GSKSICNDL----------KTAGNDPL--------FVDFIRRSLDFNPETRMKPREAMKHQWI 1317
            V++ +G+G+FGQVVK +       VA+KI+++   + RQ   EI IL  L   + E+  N V   E F  +NH C+ FE+L  NL++ +K++KF    L  +R     +L  L  L    +IH DLKPENI+L   ++    +KVIDFGS+ + ++ V  TY+QSR+YRAPEVILG  +   IDMWS GC++AEL  G+PL+PG  E DQ+  +I+  GLP  +LL N  +T++FF    I  +  V E        KLK +     + + P     K I N L             GN+ +        FV  ++R L  + E R+ P EA+ HQ++
Sbjct:    1 VLEFLGRGTFGQVVKCWKKGTNELVAIKILKDHPSYARQGQIEISILAKLSAENSEAY-NFVRAIECFQHKNHTCLVFEMLQQNLYDYLKQSKFNPLPLKHIRPIVQQVLVALSKLRTLGLIHADLKPENIMLVDPDKQPFRVKVIDFGSATHVSKVVCSTYLQSRYYRAPEVILGLPFCESIDMWSLGCVIAELFLGWPLYPGSSEFDQIRYIIQTQGLPYDHLLNNATKTSRFF-KKAINTHTGVLE-------WKLKNANEHERETKIPSKEARKYIFNSLDDIAQVNLSSSLTGNERIAEKIDRYEFVSLLKRMLTIDQEKRITPEEALSHQFV 329          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO33758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR83])

HSP 1 Score: 157.532 bits (397), Expect = 8.562e-42
Identity = 109/361 (30.19%), Postives = 189/361 (52.35%), Query Frame = 1
Query:  283 SNLEE--FNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILL-----------------RHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKH 1308
            S+ EE  ++   DDE G  I+   D +  RYEV  L+G+G+FG+V++ YD K G+ VA+K+++N +++   A  EI++LE + Q ++  K   + + + F    H+C+ FE +  ++F+ +K N +  + L  VR  +  ++  +  L + ++ H DLKPEN+L                  R++  S +++IDFGS+ +E++   T + +R YRAPEVIL   +  P D+WS GCI+ EL TG+ LF   +  + L+ M  ++G  P +     ++T  F+         E  E          K S  K  +    P  K + +D   +    LF + +   L+++PE R+  +EAM+H
Sbjct:   95 SHAEERCYSTSRDDEDGHLIYHKGDQLHSRYEVHCLLGEGTFGKVLECYDKKTGDVVAVKVIKNIEKYREAAKLEIKVLEKINQKNRYGKSLCIKMLDWFNHHGHMCLVFEKMGLSVFDFMKDNNYEPYPLDQVRHISYQLIVAVKFLHEMKLTHTDLKPENMLFVNSDCDVFYNKDTKQDQRYVKSSHMRLIDFGSATFEHEHHSTTVSTRHYRAPEVILELGWSYPCDIWSIGCIMFELYTGFTLFQTHENREHLAMMERIIGPIPSDFAKKSRKTKYFYKGK-----LEWDE----------KSSSGKYVRENCKPLKKYMLSD---SEGHQLFFNLLDYLLEYDPEKRITAKEAMQH 437          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:101170635])

HSP 1 Score: 481.871 bits (1239), Expect = 5.231e-163
Identity = 255/435 (58.62%), Postives = 319/435 (73.33%), Query Frame = 1
Query:   76 NSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESEN 1380
            +S  S   +   P + PL    AMK FM+K++ FE HE+F + +VY++G +A+K   +    NN             G+DD+QGSYI V  DHIAYRYEV+K+IGKGSFGQVVKA+DHK   +VALK+VRNEKRF RQAAEEIRILEHL++ DK+S  N++H+ E+FTFRNH+C+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SILQCLDAL KN+IIHCDLKPENILL+   RS IKVIDFGSSC+E+QRVYTYIQSRFYRAPEVILG +YG+PIDMWS GCILAEL+TGYPL PGEDE+DQL+C+IELLG+P   +L   KR   F +S   PRYC V     +     L G  ++RGK RGPPGSK     LK   +DPLF+DF+++ L+++P  RM P +A++H W+RR+ +P    G     K S +
Sbjct:  108 SSATSNKPADSKPKTNPLTAEQAMKQFMSKMSSFEHHEVFSFSEVYFIGPSAKKRSGVLGGPNN------------GGYDDDQGSYIQVPHDHIAYRYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLKKQDKDSSMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEADQLACIIELLGMPSQKILDASKRAKNFVSSKGYPRYCTVTT--LSDGTTVLNGGRSRRGKVRGPPGSKVWSTALKGC-DDPLFLDFLKQCLEWDPAHRMTPSQALRHSWLRRR-LPKPPTGTTPGDKTSSS 526          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 452.21 bits (1162), Expect = 7.535e-152
Identity = 243/412 (58.98%), Postives = 303/412 (73.54%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKS 1359
            PL P  A++ + ++++  E  EI  YP VY++G NA+K   +    NN    C        G+DDEQG YIHV  DH+AYRYE +K+IGKGSFGQV K YDHKL  ++ALK+VRNEKRF RQA EEIRILEHL + D+    N+VH+ E+FTFRNH+C+TFELL+ NL+ELIK+NKF+GFSL LVRKFA SILQCL+AL +++IIHCDLKPENILL+   RS IKVIDFGSSC+E+QRVYTYIQSRFYRAPEVILG +YGLPIDMWSFGCILAEL+TGYPLFPGEDESDQL+C +ELLG+PP  +L   KR   F  S   PRYC     P   ++  L GS ++RGK RGPP SK     LK    DP F+DFI++ LD++P +R+ P +A++H W+ R+      + EK+
Sbjct:   91 PLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNN----C--------GYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATV--LTGSRSRRGKMRGPPASKDWNVALKGC-EDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRRLPKPLAVTEKN 487          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 453.366 bits (1165), Expect = 2.003e-151
Identity = 243/412 (58.98%), Postives = 303/412 (73.54%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKS 1359
            PL P  A++ + ++++  E  EI  YP VY++G NA+K   +    NN    C        G+DDEQG YIHV  DH+AYRYE +K+IGKGSFGQV K YDHKL  ++ALK+VRNEKRF RQA EEIRILEHL + D+    N+VH+ E+FTFRNH+C+TFELL+ NL+ELIK+NKF+GFSL LVRKFA SILQCL+AL +++IIHCDLKPENILL+   RS IKVIDFGSSC+E+QRVYTYIQSRFYRAPEVILG +YGLPIDMWSFGCILAEL+TGYPLFPGEDESDQL+C +ELLG+PP  +L   KR   F  S   PRYC     P   ++  L GS ++RGK RGPP SK     LK    DP F+DFI++ LD++P +R+ P +A++H W+ R+      + EK+
Sbjct:  149 PLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNN----C--------GYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATV--LTGSRSRRGKMRGPPASKDWNVALKGC-EDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRRLPKPLAVTEKN 545          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 453.366 bits (1165), Expect = 2.003e-151
Identity = 243/412 (58.98%), Postives = 303/412 (73.54%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKS 1359
            PL P  A++ + ++++  E  EI  YP VY++G NA+K   +    NN    C        G+DDEQG YIHV  DH+AYRYE +K+IGKGSFGQV K YDHKL  ++ALK+VRNEKRF RQA EEIRILEHL + D+    N+VH+ E+FTFRNH+C+TFELL+ NL+ELIK+NKF+GFSL LVRKFA SILQCL+AL +++IIHCDLKPENILL+   RS IKVIDFGSSC+E+QRVYTYIQSRFYRAPEVILG +YGLPIDMWSFGCILAEL+TGYPLFPGEDESDQL+C +ELLG+PP  +L   KR   F  S   PRYC     P   ++  L GS ++RGK RGPP SK     LK    DP F+DFI++ LD++P +R+ P +A++H W+ R+      + EK+
Sbjct:  149 PLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNN----C--------GYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATV--LTGSRSRRGKMRGPPASKDWNVALKGC-EDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRRLPKPLAVTEKN 545          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk4 (dual specificity tyrosine-phosphorylation-regulated kinase 4 [Source:NCBI gene;Acc:101159741])

HSP 1 Score: 369.392 bits (947), Expect = 8.580e-119
Identity = 218/472 (46.19%), Postives = 299/472 (63.35%), Query Frame = 1
Query:  124 PLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIP-VKQIGEKSFQKESENGTCQDILATAIDVEFSNKNDSSGTMSATDGILETTKQFTFNEISGISAAVTD 1536
            P++P  A+  F  ++T FEQ EI  Y +V++LG  +QK     +     P         N+G+DDE GSYI VL DHIAYR+EV+++IGKGSFGQV+K  DHK    VA+K++RN+KRF  QA  E++ILE +++ DK++  N++H+ E+F FRNH+CI+FELL  NL+ELIKKN F+GFSL L+R+FA ++L+CL  L K +IIHCDLKPENILL      +IKV+DFGSSCYE QRVYTYIQSRFYR+PEVILG  Y + IDMWS GCILAEL TGYPLFPGE E +Q++C++E+LG+PP + + +  R   FF S   PR                      +GK R  P SK +   LKT   DPLF++FI+  L ++P  RM P E ++HQWI       V+   + + +K S+  T  D  A +   + S +++S  ++   D     +K  +   +  I A+  D
Sbjct:  131 PMSPSEALNNFQERLTEFEQEEINAYAEVWFLGLGSQK----IEGSQGAPH--------NSGYDDEHGSYIRVLHDHIAYRFEVLEVIGKGSFGQVLKCLDHKTNELVAIKMIRNKKRFHHQALVELKILEVIKKKDKDNLHNVIHMKEYFYFRNHLCISFELLGVNLYELIKKNNFQGFSLALIRRFAHALLRCLQMLHKEKIIHCDLKPENILLSQRGPGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELHTGYPLFPGESEVEQIACIMEVLGMPPNDFVQSASRRKLFFDSKGNPRNIT-----------------NSKGKKRR-PNSKELSAALKTT--DPLFLEFIKGCLTWDPTKRMTPDEGLQHQWILEGNFNRVRSRAKTTVKKTSDTSTSADRQANSKSEKVSPESNSKESLR-RDSSTGESKMASVERLRPIGASAED 569          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000076586.1 (SMESG000076586.1)

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 298/298 (100.00%), Postives = 298/298 (100.00%), Query Frame = 1
Query:   64 MMIGNSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTG 957
            MMIGNSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITFELLNNNLFELIKKNKFRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTG
Sbjct:    1 MMIGNSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITFELLNNNLFELIKKNKFRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTG 298          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000076586.1 (SMESG000076586.1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 297/297 (100.00%), Postives = 297/297 (100.00%), Query Frame = 1
Query:   67 MIGNSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTG 957
            MIGNSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITFELLNNNLFELIKKNKFRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTG
Sbjct:    1 MIGNSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITFELLNNNLFELIKKNKFRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTG 297          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000076583.1 (SMESG000076583.1)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 303/437 (69.34%), Postives = 350/437 (80.09%), Query Frame = 1
Query:  118 SEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQK----------ESENGTCQDI 1398
            S+   P  A++   + +T+ EQ EI  +PQ+Y+LGQNAQK +RL          C    EFN+GFDD+QGSYIH+++DHIAYRYEV K+IGKGSFG+V+KAYD+K   YVALKI++++ RFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITFELLNNNLFELIKKNKFRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTG+PLFPGE+ESDQLSC+ ELLG+P   +L +CKR N FF SDC+P+YC V ++  N S+ KL GS+T+RG +RGPP SK I + LK  G D  F+DF+ R ++ NP TR+KP EAMKH WIR K   +    E S Q           +S+NG C +I
Sbjct:   14 SDSFTPEYAIRNLFDNLTMHEQSEIRKFPQIYFLGQNAQKLKRLIY--------CKTEGEFNDGFDDDQGSYIHIVNDHIAYRYEVCKIIGKGSFGEVIKAYDYKFHRYVALKIIKSDNRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITFELLNNNLFELIKKNKFRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGHPLFPGENESDQLSCIFELLGIPSLEMLKDCKRKNTFFNSDCLPKYCTVIKNSVNSSLPKLTGSYTRRGTFRGPPQSKGIKSYLKLNGTDHEFLDFLLRCIELNPTTRIKPEEAMKHPWIRHKIQEINDKKENSTQLSSDKINSNGIQSKNGKCVNI 442          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000058389.1 (SMESG000058389.1)

HSP 1 Score: 483.797 bits (1244), Expect = 4.368e-164
Identity = 262/428 (61.21%), Postives = 319/428 (74.53%), Query Frame = 1
Query:  115 LSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQ-----KESENG 1383
            +S  L+P  AM+ FM+K+T +E HEIF YP ++++G NA+K   +    NN    C        G+DD+Q SYIHV  DHIAYRYEV+KL+GKGSFGQVVKA DHK G  VA+K+VRNEKRFTRQAAEEIR+LE L++ D +S CN++HI + F FRNHVC+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SIL CL+ L +N+IIHCDLKPENILL+   RS IKVIDFGSSC E+QR+YTYIQSRFYRAPEVILGGKYG+PIDMWSFGCILAEL TGYP+FPGEDE DQL+C++E+LG PP  L   CKRT  FFTS   PRYC  + D     +  LKG  +KRG++RGPP SK++   LK   +D LF+DF  R L + PETRM P+EA+KH W+RRK IP   I +  +      K+  NG
Sbjct:  143 MSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNN----C--------GYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVI--LKGGRSKRGRFRGPPASKTLSTALKNC-DDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDGKDDPNG 555          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000058389.1 (SMESG000058389.1)

HSP 1 Score: 483.411 bits (1243), Expect = 5.371e-164
Identity = 262/428 (61.21%), Postives = 319/428 (74.53%), Query Frame = 1
Query:  115 LSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVYYLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAYRYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITXXXXXXXXXXXXXXXXXRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFGSSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYPLFPGEDESDQLSCMIEXXXXXXXXXXXXCKRTNKFFTSDCIPRYCEVAEDPFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLDFNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQ-----KESENG 1383
            +S  L+P  AM+ FM+K+T +E HEIF YP ++++G NA+K   +    NN    C        G+DD+Q SYIHV  DHIAYRYEV+KL+GKGSFGQVVKA DHK G  VA+K+VRNEKRFTRQAAEEIR+LE L++ D +S CN++HI + F FRNHVC+TFELL+ NL+ELIKKNKF+GFSL LVRKFA SIL CL+ L +N+IIHCDLKPENILL+   RS IKVIDFGSSC E+QR+YTYIQSRFYRAPEVILGGKYG+PIDMWSFGCILAEL TGYP+FPGEDE DQL+C++E+LG PP  L   CKRT  FFTS   PRYC  + D     +  LKG  +KRG++RGPP SK++   LK   +D LF+DF  R L + PETRM P+EA+KH W+RRK IP   I +  +      K+  NG
Sbjct:  146 MSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNN----C--------GYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVI--LKGGRSKRGRFRGPPASKTLSTALKNC-DDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDGKDDPNG 558          
The following BLAST results are available for this feature:
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK23.136e-16761.23dual specificity tyrosine phosphorylation regulate... [more]
DYRK26.297e-16761.87dual specificity tyrosine phosphorylation regulate... [more]
DYRK38.312e-14858.44dual specificity tyrosine phosphorylation regulate... [more]
DYRK38.312e-14858.44dual specificity tyrosine phosphorylation regulate... [more]
DYRK31.108e-14758.35dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbk-21.329e-15159.80Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.329e-15159.80Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.329e-15159.80Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.557e-15157.52Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.557e-15157.52Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk38.818e-14359.50gene:FBgn0027101 transcript:FBtr0100406[more]
Dyrk38.818e-14359.50gene:FBgn0027101 transcript:FBtr0100404[more]
Dyrk38.818e-14359.50gene:FBgn0027101 transcript:FBtr0100402[more]
Dyrk22.670e-10648.12gene:FBgn0016930 transcript:FBtr0100447[more]
Dyrk22.670e-10648.12gene:FBgn0016930 transcript:FBtr0089289[more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk22.511e-16059.36dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk24.308e-16059.36dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk21.395e-15959.36dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk31.909e-15556.67dual specificity tyrosine phosphorylation regulate... [more]
dyrk32.244e-15556.67dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK23.306e-16863.20dual specificity tyrosine phosphorylation regulate... [more]
dyrk31.217e-14654.42dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk31.545e-14654.42dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk31.667e-14654.42dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk31.720e-14654.42dual specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk21.795e-16861.47dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk31.596e-14859.25dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk43.276e-11351.26dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b3.480e-8044.16dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b2.569e-7944.16dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5U4C9|DYRK2_MOUSE1.256e-16761.47Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q92630|DYRK2_HUMAN3.024e-16661.87Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q5ZIU3|DYRK2_CHICK3.075e-16160.95Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q922Y0|DYRK3_MOUSE1.116e-14759.25Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q9XTF3|MBK2_CAEEL1.710e-14759.80Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A1L84.332e-16864.52Protein kinase domain-containing protein OS=Lottia... [more]
K1QR768.254e-16763.07Dual specificity tyrosine-phosphorylation-regulate... [more]
A0A076G4293.704e-16664.52Dual specificity tyrosine-phosphorylation-regulate... [more]
A0A4W6CXM11.037e-16562.11Protein kinase domain-containing protein OS=Lates ... [more]
A0A0S7H0052.998e-16563.20DYRK2 (Fragment) OS=Poeciliopsis prolifica OX=1881... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk26.380e-16559.55dual specificity tyrosine phosphorylation regulate... [more]
dyrk33.147e-15459.32dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk34.136e-15459.32dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk42.420e-12450.00dual specificity tyrosine phosphorylation regulate... [more]
dyrk42.795e-12450.00dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk24.314e-15661.27dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk29.056e-15059.40dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1aa3.780e-7346.50dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
ENSPMAT00000007958.16.599e-6441.77pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-... [more]
ENSPMAT00000007952.11.368e-6341.74pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YAK17.057e-5935.91Serine-threonine protein kinase; component of a gl... [more]
PHO857.790e-3128.44Cyclin-dependent kinase; has ten cyclin partners; ... [more]
KNS11.292e-3029.66Protein kinase involved in negative regulation of ... [more]
KSS12.026e-2829.62Mitogen-activated protein kinase (MAPK); involved ... [more]
HOG11.374e-2428.75Mitogen-activated protein kinase involved in osmor... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461446.096e-16161.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362943.278e-11854.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451874.430e-7444.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492389.518e-4636.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337588.562e-4230.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk25.231e-16358.62dual specificity tyrosine phosphorylation regulate... [more]
dyrk37.535e-15258.98dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk32.003e-15158.98dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk32.003e-15158.98dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk48.580e-11946.19dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076586.10.000e+0100.00SMESG000076586.1[more]
SMESG000076586.10.000e+0100.00SMESG000076586.1[more]
SMESG000076583.10.000e+069.34SMESG000076583.1[more]
SMESG000058389.14.368e-16461.21SMESG000058389.1[more]
SMESG000058389.15.371e-16461.21SMESG000058389.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001404 ID=SMED30001404|Name=Dual specificity tyrosine-phosphorylation-regulated kinase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2081bp
CTCTTCCGATCTCAAAATTTAAAGAAAATGTCGGATCAAAGCATTTGAAA
CGAAACCACATGAATGATGATTGGGAATTCCAATGACTCCGAGGCAACCT
CTTTCAGGAATCCGTTGTCGGAACCTCTGAATCCAAGACTTGCCATGAAA
TATTTCATGAATAAAATAACTTTGTTTGAACAGCATGAAATATTTTACTA
TCCGCAAGTTTATTATTTGGGTCAAAATGCGCAAAAGTCTCGACGTTTGA
CACAACAGAAAAACAATTATCCCGAAAGCTGTTCCAACTTGGAAGAATTT
AATAATGGGTTTGATGATGAACAAGGTTCTTATATTCACGTGCTAAGTGA
TCATATTGCCTACAGGTATGAAGTGGTTAAATTAATCGGAAAAGGCAGTT
TCGGTCAAGTTGTAAAGGCTTATGATCATAAATTAGGAAATTATGTAGCA
TTAAAAATAGTGAGAAATGAAAAACGTTTCACAAGACAGGCAGCCGAAGA
GATCCGAATCCTTGAACACCTTCAACAGTACGACAAAGAAAGCAAATGTA
ATATCGTTCACATTTATGAGCATTTCACGTTCCGAAATCACGTTTGTATC
ACATTCGAATTGCTAAACAATAACCTCTTTGAGTTGATCAAGAAAAATAA
ATTCCGAGGGTTTTCGTTGGTATTAGTGAGGAAATTTGCAATCTCAATTT
TGCAGTGTTTGGATGCGTTGGAGAAAAACCAAATCATTCATTGTGATTTG
AAACCGGAAAACATTTTGTTGCGGCACATGAATCGCAGTTCTATAAAGGT
GATAGATTTTGGGTCAAGTTGCTATGAGAATCAGAGGGTGTACACGTACA
TTCAATCTAGGTTTTATCGGGCTCCTGAGGTTATTTTAGGGGGCAAATAC
GGGCTTCCTATCGACATGTGGAGTTTCGGATGTATTTTGGCTGAACTGGT
AACAGGCTATCCTTTATTTCCGGGAGAGGATGAATCAGATCAGTTAAGTT
GTATGATTGAATTGCTTGGTTTACCTCCTTATAATTTACTCTTAAACTGT
AAACGAACAAACAAATTTTTCACAAGTGACTGTATTCCAAGGTATTGTGA
AGTTGCTGAAGATCCTTTTAATCCAAGCATGAATAAATTGAAAGGCAGTT
TTACAAAACGTGGTAAATACAGAGGTCCACCTGGATCGAAAAGTATTTGT
AATGACCTGAAAACCGCAGGAAATGATCCATTATTTGTGGACTTCATTCG
CAGATCCTTGGATTTTAATCCTGAAACCCGAATGAAACCTCGTGAAGCAA
TGAAGCACCAATGGATCCGCAGGAAATGCATTCCTGTTAAACAAATAGGA
GAAAAATCTTTTCAAAAAGAATCTGAAAATGGCACTTGCCAAGATATTTT
AGCCACAGCTATTGATGTTGAATTCAGCAACAAAAACGACAGCAGTGGAA
CAATGTCTGCAACTGATGGGATTTTAGAAACCACTAAACAATTTACATTT
AATGAAATCTCAGGAATAAGTGCCGCAGTGACGGACAACTCAGTCTTTTC
TAGTGGTGATGTAATTATTTAAGACATATTTTTTAAACTTTATTCACAGT
ATTCTTTTTTGAATCCGTATGAAGATAGTTTCGATTTTAATACCCTTTCT
GATGAAATACAGTTACGTATTTAGCACAAGTCTTTGCCCTAGAATAACAT
TTTTATTTTCAATATGTAGTTCTATGTGAGAGTTAGATAAATTCAATTCT
AAACTCGTCTTTGTGATCCTTATTTTTATATATGGTGATTGATTGTTTAT
TTAAAAATACTCTATTTTTTTGTTTTACTGAACTGATTAATAAAAACAAA
CTCATTTTAACATGTGAAATGTAAACAGAATATTTACGATAGAATTATTT
GCTGTAGATGTATATCATGTGGAATTGTAATTCTTCGGTTTAAAATACAT
GATATAGGTGGAGGAGTCGTAAATGTCGTTGTTAGAATCTTCTTCATCCT
CATTGTCATTCTAGAACTTTATTGTATGTTTTCTGTAATTGACAGAAGAA
ATAAAAAGTTGATTTATTTTTGAAAAAAAAA
back to top

protein sequence of SMED30001404-orf-1

>SMED30001404-orf-1 ID=SMED30001404-orf-1|Name=SMED30001404-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=503bp
MMIGNSNDSEATSFRNPLSEPLNPRLAMKYFMNKITLFEQHEIFYYPQVY
YLGQNAQKSRRLTQQKNNYPESCSNLEEFNNGFDDEQGSYIHVLSDHIAY
RYEVVKLIGKGSFGQVVKAYDHKLGNYVALKIVRNEKRFTRQAAEEIRIL
EHLQQYDKESKCNIVHIYEHFTFRNHVCITFELLNNNLFELIKKNKFRGF
SLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRHMNRSSIKVIDFG
SSCYENQRVYTYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGYP
LFPGEDESDQLSCMIELLGLPPYNLLLNCKRTNKFFTSDCIPRYCEVAED
PFNPSMNKLKGSFTKRGKYRGPPGSKSICNDLKTAGNDPLFVDFIRRSLD
FNPETRMKPREAMKHQWIRRKCIPVKQIGEKSFQKESENGTCQDILATAI
DVEFSNKNDSSGTMSATDGILETTKQFTFNEISGISAAVTDNSVFSSGDV
II*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR042521DYRK
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0000287magnesium ion binding
GO:0004674protein serine/threonine kinase activity
GO:0004712protein serine/threonine/tyrosine kinase activity
GO:0004713protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0030145manganese ion binding
GO:0043130ubiquitin binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006915apoptotic process
GO:0006974cellular response to DNA damage stimulus
GO:0007224smoothened signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0045725positive regulation of glycogen biosynthetic process
GO:0051534negative regulation of NFAT protein import into nucleus
Vocabulary: cellular component
TermDefinition
GO:0000151ubiquitin ligase complex
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 102..418
e-value: 2.7E-87
score: 306.0
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 102..418
e-value: 4.1E-53
score: 180.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 102..418
score: 38.647
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 158..418
e-value: 2.8E-121
score: 406.8
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 84..183
e-value: 2.8E-121
score: 406.8
NoneNo IPR availablePANTHERPTHR24058:SF112DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-REGULATED KINASE 3 HOMOLOG-RELATEDcoord: 14..438
NoneNo IPR availablePANTHERPTHR24058DUAL SPECIFICITY PROTEIN KINASEcoord: 14..438
IPR042521Dual specificity tyrosine-phosphorylation-regulated kinaseGENE3DG3DSA:1.10.8.980coord: 2..62
e-value: 2.2E-12
score: 49.2
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 224..236
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 108..131
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 94..424