Plastin 3

Overview
NamePlastin 3
Smed IDSMED30001402
Length (bp)1256
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Plastin 3 (SMED30001402) t-SNE clustered cells

Violin plots show distribution of expression levels for Plastin 3 (SMED30001402) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001402

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30001402h1SMcG0011845 dd_Smed_v4_15254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001402h1SMcG0011845 dd_Smed_v4_15254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001402h1SMcG0011845 dd_Smed_v4_11520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001402h1SMcG0011845 dd_Smed_v4_11520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001402h1SMcG0011845 Contig48975uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001402h1SMcG0011845 Contig48975newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Plastin 3 vs. Ensembl Human
Match: LCP1 (lymphocyte cytosolic protein 1 [Source:HGNC Symbol;Acc:HGNC:6528])

HSP 1 Score: 238.424 bits (607), Expect = 9.813e-72
Identity = 151/388 (38.92%), Postives = 221/388 (56.96%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLE------LKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP---EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NGYI    L   F+   L L    ++EI  +L +   L+         F +I   LK   +       +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P      D+++   DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  +++LGL+WQVI+ GL   I L  N  L ALL  GES++DL KLSPE+LL+RW N+ L+ A C  +I NF  D+ + +AY +LL Q+AP   E+    ++     ++  D IQRAE +L+ A  L  + FVT  D+V  N       KLNLAFIANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   26 NGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGC-NKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGN------PKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNW 403          
BLAST of Plastin 3 vs. Ensembl Human
Match: LCP1 (lymphocyte cytosolic protein 1 [Source:HGNC Symbol;Acc:HGNC:6528])

HSP 1 Score: 238.424 bits (607), Expect = 9.813e-72
Identity = 151/388 (38.92%), Postives = 221/388 (56.96%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLE------LKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP---EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NGYI    L   F+   L L    ++EI  +L +   L+         F +I   LK   +       +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P      D+++   DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  +++LGL+WQVI+ GL   I L  N  L ALL  GES++DL KLSPE+LL+RW N+ L+ A C  +I NF  D+ + +AY +LL Q+AP   E+    ++     ++  D IQRAE +L+ A  L  + FVT  D+V  N       KLNLAFIANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   26 NGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGC-NKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGN------PKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNW 403          
BLAST of Plastin 3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 220.32 bits (560), Expect = 6.346e-65
Identity = 149/392 (38.01%), Postives = 228/392 (58.16%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSL--SSVKYLELK-NFEEILLVLK--KDSIINHVFTQ-MNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NG+I    L   F+   + L   +++EI   L     +  + K +F+E + + +  K S I   F + +N  +    L   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P     +D++    DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+  G  H++LGL+WQ+I+ GL   I L  N  L ALL  GE++++L KLSPE+LL+RW NF L+ +    +I NF  D+ + +AY +LL+QIAP+ +K      E  + +N       D ++RAE +L+ A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   29 NGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTP--FIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGW-QKINNFSADIKDSKAYFHLLNQIAPKGQK----EGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNW 406          

HSP 2 Score: 55.8398 bits (133), Expect = 8.624e-8
Identity = 61/243 (25.10%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAIN-SAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCE-AYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y   +D L++ +L  +  VP  +D   +NK     L    KK EN   A+          +V +G  D++DG + + L L+WQ++R          Y  N+   L  G+  +D       D+++ WVN  L +A   T I++FK+  ++   A + L+  I P      L+    + + +D    A+  +  A  + ++V+   ED+V
Sbjct:  397 TREERTFRNWMNSLGVN---------PHVN---HLYADLQDALVILQLYERIKVP--VDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRR---------YTLNVLEDLGDGQKAND-------DIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTE-DDKHNNAKYAVSMARRIGARVYALPEDLV 608          
BLAST of Plastin 3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 220.32 bits (560), Expect = 6.346e-65
Identity = 149/392 (38.01%), Postives = 228/392 (58.16%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSL--SSVKYLELK-NFEEILLVLK--KDSIINHVFTQ-MNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NG+I    L   F+   + L   +++EI   L     +  + K +F+E + + +  K S I   F + +N  +    L   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P     +D++    DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+  G  H++LGL+WQ+I+ GL   I L  N  L ALL  GE++++L KLSPE+LL+RW NF L+ +    +I NF  D+ + +AY +LL+QIAP+ +K      E  + +N       D ++RAE +L+ A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   29 NGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTP--FIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGW-QKINNFSADIKDSKAYFHLLNQIAPKGQK----EGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNW 406          

HSP 2 Score: 55.8398 bits (133), Expect = 8.624e-8
Identity = 61/243 (25.10%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAIN-SAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCE-AYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y   +D L++ +L  +  VP  +D   +NK     L    KK EN   A+          +V +G  D++DG + + L L+WQ++R          Y  N+   L  G+  +D       D+++ WVN  L +A   T I++FK+  ++   A + L+  I P      L+    + + +D    A+  +  A  + ++V+   ED+V
Sbjct:  397 TREERTFRNWMNSLGVN---------PHVN---HLYADLQDALVILQLYERIKVP--VDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRR---------YTLNVLEDLGDGQKAND-------DIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTE-DDKHNNAKYAVSMARRIGARVYALPEDLV 608          
BLAST of Plastin 3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 213.001 bits (541), Expect = 2.741e-62
Identity = 147/401 (36.66%), Postives = 220/401 (54.86%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSL------SSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKED---------VMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NG+I    L   F+   + L   +++EI   L      +    +    F  I   +K   I       +N  +    L   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P     +D++    DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+  G  H++LGL+WQ+I+ GL   I L  N  L ALL  GE++++L KLSPE+LL+RW NF L+ +    +I NF  D         V + +AY +LL+QIAP+ +K      E  + +N       D ++RAE +L+ A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:    7 NGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTP--FIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGW-QKINNFSADIKLIDFSNSVKDSKAYFHLLNQIAPKGQK----EGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNW 393          

HSP 2 Score: 55.8398 bits (133), Expect = 8.999e-8
Identity = 61/243 (25.10%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAIN-SAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCE-AYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y   +D L++ +L  +  VP  +D   +NK     L    KK EN   A+          +V +G  D++DG + + L L+WQ++R          Y  N+   L  G+  +D       D+++ WVN  L +A   T I++FK+  ++   A + L+  I P      L+    + + +D    A+  +  A  + ++V+   ED+V
Sbjct:  384 TREERTFRNWMNSLGVN---------PHVN---HLYADLQDALVILQLYERIKVP--VDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRR---------YTLNVLEDLGDGQKAND-------DIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTE-DDKHNNAKYAVSMARRIGARVYALPEDLV 595          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: plst-1 (PLaSTin (Actin bundling protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PMA7])

HSP 1 Score: 88.1965 bits (217), Expect = 5.030e-19
Identity = 59/136 (43.38%), Postives = 86/136 (63.24%), Query Frame = 3
Query:  852 IRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSL-XXXXXXXXXXXXXXXXXXKTYRNW 1256
            +RWVN+ L++A    R+ NF  D+++ E Y +LLHQIAP +   + +SP   + V+  + RA  +L  A  L+ + FVT  D+   N       KLNLAF+ANLFN +P+L +   +E+V ++IEET EEKTYRNW
Sbjct:    1 MRWVNYHLERAGTQRRLHNFTSDIVDSEIYTHLLHQIAP-NGSGVTLSP---LGVHGNVPRAGAMLDEAEKLDCREFVTATDVAAGNY------KLNLAFVANLFNKHPNLPDPGADEVVEDVIEETREEKTYRNW 126          

HSP 2 Score: 56.225 bits (134), Expect = 1.668e-8
Identity = 55/239 (23.01%), Postives = 107/239 (44.77%), Query Frame = 3
Query:  396 EERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTID-ERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDL-LIRWVNFQLKKADCPTRIRNFKEDVM-NCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            EE+ Y  W+N++  +         P+ N    +Y   ++G+++ +L +   P  +  +RV+     L+G   + +N   A+     +   +V +   DI DG + + L L+WQ++RA             L+ L    +S D L    P D  ++ WVN +LK +   T IR+F++  + + +  + L+  I P      L+   +     D +  A+  +     + +K++   EDIV
Sbjct:  119 EEKTYRNWMNSMGVD---------PYVNW---LYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQNCNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMRAY-----------TLSVLAQCTQSGDSL----PADKDIVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGK--SNEDKMSNAKYAITCGRKIGAKIYALPEDIV 328          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: plst-1 (PLaSTin (Actin bundling protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PMA7])

HSP 1 Score: 87.4261 bits (215), Expect = 9.711e-19
Identity = 58/139 (41.73%), Postives = 83/139 (59.71%), Query Frame = 3
Query:  852 IRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSL----XXXXXXXXXXXXXXXXXXKTYRNW 1256
            +RWVN+ L++A    R+ NF  D+++ E Y +LLHQIAP +   + +SP   + V+  + RA  +L  A  L+ + FVT  D+   N       KLNLAF+ANLFN +P+L     +     V ++IEET EEKTYRNW
Sbjct:    1 MRWVNYHLERAGTQRRLHNFTSDIVDSEIYTHLLHQIAP-NGSGVTLSP---LGVHGNVPRAGAMLDEAEKLDCREFVTATDVAAGNY------KLNLAFVANLFNKHPNLPDPGADEVGFSVEDVIEETREEKTYRNW 129          

HSP 2 Score: 56.225 bits (134), Expect = 1.715e-8
Identity = 55/239 (23.01%), Postives = 107/239 (44.77%), Query Frame = 3
Query:  396 EERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTID-ERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDL-LIRWVNFQLKKADCPTRIRNFKEDVM-NCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            EE+ Y  W+N++  +         P+ N    +Y   ++G+++ +L +   P  +  +RV+     L+G   + +N   A+     +   +V +   DI DG + + L L+WQ++RA             L+ L    +S D L    P D  ++ WVN +LK +   T IR+F++  + + +  + L+  I P      L+   +     D +  A+  +     + +K++   EDIV
Sbjct:  122 EEKTYRNWMNSMGVD---------PYVNW---LYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQNCNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMRA-----------YTLSVLAQCTQSGDSL----PADKDIVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGK--SNEDKMSNAKYAITCGRKIGAKIYALPEDIV 331          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: anc-1 (Nuclear anchorage protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4M4])

HSP 1 Score: 54.6842 bits (130), Expect = 1.045e-7
Identity = 41/127 (32.28%), Postives = 59/127 (46.46%), Query Frame = 3
Query:  378 HTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESL---KGFFKKQ----ENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVI 737
            H    A++  ++ WIN  LE            +   ED+++  +DG+LLC LI           VL  GE+L   KG   K+     NL  A+      G  ++N    DI+DG   I+LGLIWQ+I
Sbjct:   19 HEDEKAQKNTFTRWINFHLEEHS--------SSGRIEDLFEDIRDGVLLCHLI----------EVLT-GEALAVHKGRVSKRVHHIANLTTALTVLRRRGLELINNNAADIADGNPRIVLGLIWQII 126          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: anc-1 (Nuclear anchorage protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4M4])

HSP 1 Score: 53.5286 bits (127), Expect = 2.973e-7
Identity = 40/122 (32.79%), Postives = 58/122 (47.54%), Query Frame = 3
Query:  393 AEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESL---KGFFKKQ----ENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVI 737
            A++  ++ WIN  LE            +   ED+++  +DG+LLC LI           VL  GE+L   KG   K+     NL  A+      G  ++N    DI+DG   I+LGLIWQ+I
Sbjct:   17 AQKNTFTRWINFHLEEHS--------SSGRIEDLFEDIRDGVLLCHLI----------EVLT-GEALAVHKGRVSKRVHHIANLTTALTVLRRRGLELINNNAADIADGNPRIVLGLIWQII 119          
BLAST of Plastin 3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074442)

HSP 1 Score: 234.958 bits (598), Expect = 7.497e-71
Identity = 145/384 (37.76%), Postives = 227/384 (59.11%), Query Frame = 3
Query:  123 ENGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKY------LELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            ++G+I    L+ A   VG +L+  +++E+ +     +       L L+ FE + L LK   + +   T ++  +  + L   S   +  + H+V   E+  +S+WIN+ L +D+DL+   LP  +  + +Y   KDG+LLCK+IN + P+TIDER +NK       +++ ENL LA+ S+ +IGC +VN+   D++ G  H++LGL+WQ+IR GL   I L   P L  LLF  E ++DL K+SPE +L+RWVN  L++A    R  NF+ D+++ E Y +LL QIA  D    L    + ++ +D   RAE++L+ A  LN + F+T +D+VN         KLNLAF+ANLFN++P L++ +    +E IEET EEKTYRNW
Sbjct:    6 KDGFIDLHELKDALNQVGFKLAGYQVREMIDEYKGKQLTAFQGKLNLEEFEALCLDLKSKDVASTFKTVVSKKENLETLGGMSSISSEGTTHSVRLEEQLAFSDWINSNLGHDKDLQH-LLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAINKKNLT--VYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGNDADVNL----DALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVVNGVY------KLNLAFVANLFNNHPGLDKPEQIEGLESIEETREEKTYRNW 376          

HSP 2 Score: 59.6918 bits (143), Expect = 2.488e-9
Identity = 57/253 (22.53%), Postives = 110/253 (43.48%), Query Frame = 3
Query:  354 KDENFESKHTVS-SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTID-ERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKED-VMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            K E  E   ++  + EE+ Y  W+N++            P  N    +Y    DGL++ +L +   P  ++  RV  +   L+ F +K EN   A++    +   +V +   D++DG   + L LIWQ++RA  L  ++ + N     +               E  +++WVN +L +A   +++RNF +  + + +  I L+  I        L+      +  D +  A+  +  A  + ++V+   EDI 
Sbjct:  354 KPEQIEGLESIEETREEKTYRNWMNSM---------GVAPHVNW---LYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPII---------------EKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQE--DNLANAKYAISMARKIGARVYALPEDIT 577          
BLAST of Plastin 3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074441)

HSP 1 Score: 235.343 bits (599), Expect = 9.592e-71
Identity = 145/384 (37.76%), Postives = 227/384 (59.11%), Query Frame = 3
Query:  123 ENGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKY------LELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            ++G+I    L+ A   VG +L+  +++E+ +     +       L L+ FE + L LK   + +   T ++  +  + L   S   +  + H+V   E+  +S+WIN+ L +D+DL+   LP  +  + +Y   KDG+LLCK+IN + P+TIDER +NK       +++ ENL LA+ S+ +IGC +VN+   D++ G  H++LGL+WQ+IR GL   I L   P L  LLF  E ++DL K+SPE +L+RWVN  L++A    R  NF+ D+++ E Y +LL QIA  D    L    + ++ +D   RAE++L+ A  LN + F+T +D+VN         KLNLAF+ANLFN++P L++ +    +E IEET EEKTYRNW
Sbjct:   30 KDGFIDLHELKDALNQVGFKLAGYQVREMIDEYKGKQLTAFQGKLNLEEFEALCLDLKSKDVASTFKTVVSKKENLETLGGMSSISSEGTTHSVRLEEQLAFSDWINSNLGHDKDLQH-LLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAINKKNLT--VYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGNDADVNL----DALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVVNGVY------KLNLAFVANLFNNHPGLDKPEQIEGLESIEETREEKTYRNW 400          

HSP 2 Score: 60.077 bits (144), Expect = 2.366e-9
Identity = 57/253 (22.53%), Postives = 110/253 (43.48%), Query Frame = 3
Query:  354 KDENFESKHTVS-SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTID-ERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            K E  E   ++  + EE+ Y  W+N++            P  N    +Y    DGL++ +L +   P  ++  RV  +   L+ F +K EN   A++    +   +V +   D++DG   + L LIWQ++RA  L  ++ + N     +               E  +++WVN +L +A   +++RNF +  + + +  I L+  I        L+      +  D +  A+  +  A  + ++V+   EDI 
Sbjct:  378 KPEQIEGLESIEETREEKTYRNWMNSM---------GVAPHVNW---LYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPII---------------EKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQE--DNLANAKYAISMARKIGARVYALPEDIT 601          
BLAST of Plastin 3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074443)

HSP 1 Score: 234.958 bits (598), Expect = 1.426e-70
Identity = 145/384 (37.76%), Postives = 227/384 (59.11%), Query Frame = 3
Query:  123 ENGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKY------LELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            ++G+I    L+ A   VG +L+  +++E+ +     +       L L+ FE + L LK   + +   T ++  +  + L   S   +  + H+V   E+  +S+WIN+ L +D+DL+   LP  +  + +Y   KDG+LLCK+IN + P+TIDER +NK       +++ ENL LA+ S+ +IGC +VN+   D++ G  H++LGL+WQ+IR GL   I L   P L  LLF  E ++DL K+SPE +L+RWVN  L++A    R  NF+ D+++ E Y +LL QIA  D    L    + ++ +D   RAE++L+ A  LN + F+T +D+VN         KLNLAF+ANLFN++P L++ +    +E IEET EEKTYRNW
Sbjct:   31 KDGFIDLHELKDALNQVGFKLAGYQVREMIDEYKGKQLTAFQGKLNLEEFEALCLDLKSKDVASTFKTVVSKKENLETLGGMSSISSEGTTHSVRLEEQLAFSDWINSNLGHDKDLQH-LLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAINKKNLT--VYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGNDADVNL----DALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVVNGVY------KLNLAFVANLFNNHPGLDKPEQIEGLESIEETREEKTYRNW 401          

HSP 2 Score: 59.6918 bits (143), Expect = 2.474e-9
Identity = 57/253 (22.53%), Postives = 110/253 (43.48%), Query Frame = 3
Query:  354 KDENFESKHTVS-SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTID-ERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKED-VMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            K E  E   ++  + EE+ Y  W+N++            P  N    +Y    DGL++ +L +   P  ++  RV  +   L+ F +K EN   A++    +   +V +   D++DG   + L LIWQ++RA  L  ++ + N     +               E  +++WVN +L +A   +++RNF +  + + +  I L+  I        L+      +  D +  A+  +  A  + ++V+   EDI 
Sbjct:  379 KPEQIEGLESIEETREEKTYRNWMNSM---------GVAPHVNW---LYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPII---------------EKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQE--DNLANAKYAISMARKIGARVYALPEDIT 602          
BLAST of Plastin 3 vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0337101)

HSP 1 Score: 49.2914 bits (116), Expect = 6.430e-6
Identity = 67/270 (24.81%), Postives = 115/270 (42.59%), Query Frame = 3
Query:  357 DENFESKHTVSS------AEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLI----NKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKL-----SPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPE-EIMKVNDPIQRAELVLKNATT-LNSKVFVTIEDIVNANV 1115
            DE+ E++  ++        ++  ++ W N      E LK       N+  D+     DGL L  LI     K +P        NK  + +   +K EN+ +A+      G  +VN+   DI D    ++LGLIW            L+ + +++  ++ GE   D K+L     +P+  L+ W++ ++   D P  I NF  D    +A   L+   AP       + P+ E+    D +Q A   +  A   LN +  +  E++VN NV
Sbjct:   28 DEDMEAERDLAEDAQWKKIQQNTFTRWAN------EHLKTIDRSINNLETDL----SDGLRLIALIEVLSQKRMPK------YNKRPTFRS--QKLENVSVALKFLQDEGIKIVNIDSSDIVDCKLKLILGLIW-----------TLILHYSISMPMWDGE---DDKQLNGSGHTPKQRLLNWIHAKI--PDLP--INNFTNDWTTGKAVGALVDACAPG------LCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNV 255          
BLAST of Plastin 3 vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0303364)

HSP 1 Score: 48.9062 bits (115), Expect = 8.276e-6
Identity = 67/270 (24.81%), Postives = 115/270 (42.59%), Query Frame = 3
Query:  357 DENFESKHTVSS------AEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLI----NKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKL-----SPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPE-EIMKVNDPIQRAELVLKNATT-LNSKVFVTIEDIVNANV 1115
            DE+ E++  ++        ++  ++ W N      E LK       N+  D+     DGL L  LI     K +P        NK  + +   +K EN+ +A+      G  +VN+   DI D    ++LGLIW            L+ + +++  ++ GE   D K+L     +P+  L+ W++ ++   D P  I NF  D    +A   L+   AP       + P+ E+    D +Q A   +  A   LN +  +  E++VN NV
Sbjct:   28 DEDMEAERDLAEDAQWKKIQQNTFTRWAN------EHLKTIDRSINNLETDL----SDGLRLIALIEVLSQKRMPK------YNKRPTFRS--QKLENVSVALKFLQDEGIKIVNIDSSDIVDCKLKLILGLIW-----------TLILHYSISMPMWDGE---DDKQLNGSGHTPKQRLLNWIHAKI--PDLP--INNFTNDWTTGKAVGALVDACAPG------LCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNV 255          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 239.965 bits (611), Expect = 1.665e-72
Identity = 150/387 (38.76%), Postives = 230/387 (59.43%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELKN---FEEILLVLK--KDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPE-DKKSLLISPEEI--MKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NG+I T  L   F+   L L    ++EI   +S    L       F+E   V+   K S +   F +  + +++    +    E   ++H+ S  E+  +  W+N  LE D D +   LP     +D++    DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G +H++LGL+WQVI+ GL   I +  N  L ALL  GES++DL KLSPE+LL+RW N+ L++A CP +I NF  D+ + +AY  +L+Q+AP+ D++ +   P +I  ++  D ++RAE +L+ A  L  + FVT  D+V  N       KLNLA++ANLFN YP+L++ +N+ +    I  ET EE+T+RNW
Sbjct:   26 NGHISTDELNALFKAANLPLPGYRVREIIQEISRTMDLNQDGKITFDEFAKVVHDLKSSEVAKTFRKA-INKKEGICSVAGTSEQSGTQHSYSEEEKVAFVNWVNKALEKDPDCQH-VLPMDPSTDDLFTAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIEISRNEALIALLRDGESLEDLVKLSPEELLLRWANYHLEEAGCP-KINNFSSDIKDSKAYYNILNQVAPKGDEEGIPAIPIDISGIREKDDLKRAECMLEQADRLGCRQFVTATDVVRGN------PKLNLAYVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNW 401          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 228.024 bits (580), Expect = 5.676e-68
Identity = 149/388 (38.40%), Postives = 218/388 (56.19%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEI------ENSLSSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP---EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NG+I    L   F+   L L   +++EI      E   +    +    F  I   LK   I       +N  +    +   S+  +  ++H+ S  E   +  WINT LE+D D K K LP     + ++    DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  H++LGL+WQ+I+ GL   I L  N  L ALL  GE+++DL KLSPE+LL+RW NF L+ A   ++I NF  D+ +  AY +LL+QIAP   +D +S +          D ++RAE +L  A  L  + FVT  D+++ N       KLNLAF+ANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   25 NGFICDHELHDLFKEANLPLPGYKVREIIQKLMEEGDKNKDNMISFDEFVSIFQELKSGDIAKSFRKAINRKEGILAIGGTSELSSAGTQHSFSEEERFAFVNWINTALEHDPDCKHK-LPMNPNTDALFKAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGW-SKINNFSHDIKDSRAYFHLLNQIAPKGQKDGESRIDIDMSGFTEKDDLKRAECMLLQADKLGCRQFVTSTDVMSGN------PKLNLAFVANLFNKYPALTKPENQDINWGLLEGETREERTFRNW 402          

HSP 2 Score: 60.8474 bits (146), Expect = 1.651e-9
Identity = 64/243 (26.34%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAIN-SAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y   +D L++ +L  K  VP   + +V NK     L    KK EN   A+          +V +G  D++DG   + L L+WQ++R          Y  N+   L  G+ V+D       D+++ WVN  L +A   T+I NFK+ ++ +  A + L+  I P      L+    +    D +  A+  +  A  + ++V+   ED+V
Sbjct:  393 TREERTFRNWMNSLGVN---------PHVN---HLYGDLQDALVILQLYEKIKVPVDWNNKV-NKPPYPKLGANMKKLENCNYAVELGKTKANFSLVGIGGQDLNDGNPTLTLALVWQLMRR---------YTLNVLENLGDGQKVND-------DVIVSWVNKTLSQAGKSTKISNFKDKEISSSLAVLDLIDAIQPSSINYDLVKRGSLSD-GDKLDNAKYAVSMARKIGARVYALPEDLV 605          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 228.024 bits (580), Expect = 5.676e-68
Identity = 149/388 (38.40%), Postives = 218/388 (56.19%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEI------ENSLSSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP---EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NG+I    L   F+   L L   +++EI      E   +    +    F  I   LK   I       +N  +    +   S+  +  ++H+ S  E   +  WINT LE+D D K K LP     + ++    DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  H++LGL+WQ+I+ GL   I L  N  L ALL  GE+++DL KLSPE+LL+RW NF L+ A   ++I NF  D+ +  AY +LL+QIAP   +D +S +          D ++RAE +L  A  L  + FVT  D+++ N       KLNLAF+ANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   25 NGFICDHELHDLFKEANLPLPGYKVREIIQKLMEEGDKNKDNMISFDEFVSIFQELKSGDIAKSFRKAINRKEGILAIGGTSELSSAGTQHSFSEEERFAFVNWINTALEHDPDCKHK-LPMNPNTDALFKAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGW-SKINNFSHDIKDSRAYFHLLNQIAPKGQKDGESRIDIDMSGFTEKDDLKRAECMLLQADKLGCRQFVTSTDVMSGN------PKLNLAFVANLFNKYPALTKPENQDINWGLLEGETREERTFRNW 402          

HSP 2 Score: 60.8474 bits (146), Expect = 1.651e-9
Identity = 64/243 (26.34%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAIN-SAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y   +D L++ +L  K  VP   + +V NK     L    KK EN   A+          +V +G  D++DG   + L L+WQ++R          Y  N+   L  G+ V+D       D+++ WVN  L +A   T+I NFK+ ++ +  A + L+  I P      L+    +    D +  A+  +  A  + ++V+   ED+V
Sbjct:  393 TREERTFRNWMNSLGVN---------PHVN---HLYGDLQDALVILQLYEKIKVPVDWNNKV-NKPPYPKLGANMKKLENCNYAVELGKTKANFSLVGIGGQDLNDGNPTLTLALVWQLMRR---------YTLNVLENLGDGQKVND-------DVIVSWVNKTLSQAGKSTKISNFKDKEISSSLAVLDLIDAIQPSSINYDLVKRGSLSD-GDKLDNAKYAVSMARKIGARVYALPEDLV 605          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 223.402 bits (568), Expect = 2.589e-66
Identity = 143/389 (36.76%), Postives = 217/389 (55.78%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSL--SSVKYLELKNFEEILLVLK--KDSIINHVFTQMNLTQEKDDLKIYSKDENFES---KHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP----EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXX-XXXXXXXXXKTYRNW 1256
            +GY+    L+  F      L   +I+EI            E  +FEE + + +  +   +   F +      +D ++ +       S   +H+ S  E+  +  W+N  L ND D K   +P     + ++   KDG+LLCK+IN + P+TIDERV+NK  +    F   ENL+LA+NSA++IGC VVN+   D+  GT H++LGL+WQ+I+ GL   I +  N  L ALL   E +D L  +SPEDLL+RWVN+ LK A    +IRNF ED+ +  AY +LL+QI+P    +D+  + I    + + +D + RAEL+L+ A  L+ + FVT +D+V  N       KLN+AF+ANLFN YP+L    +  +   I  ET E++T+RNW
Sbjct:   28 SGYVSDFELQELFREASFHLPGYQIREIVEKFIAGDTNKDEKISFEEFVAISQELRSKEVRETFRK--CISRRDGIRSFGGTSGISSEGTQHSYSDEEKVAFVNWVNKALANDPDCKH-LIPMDPGTDSLFKSVKDGILLCKMINLSQPDTIDERVINKKCTP---FTMTENLMLALNSASAIGCTVVNIDAQDMKAGTPHLVLGLLWQIIKIGLFADIEISRNEALIALLDESEELDHLMSMSPEDLLLRWVNYHLKAAGW-KQIRNFSEDIKDSRAYFHLLNQISPKGDLDDQMRIDIDMLGLTERDDEM-RAELMLRQAARLDCRQFVTPKDVVAGN------HKLNMAFVANLFNMYPALNRPTDNGIDYAIEGETREDRTFRNW 402          

HSP 2 Score: 53.9138 bits (128), Expect = 2.321e-7
Identity = 62/247 (25.10%), Postives = 109/247 (44.13%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-----CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCE-AYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + E+R +  W+N+L            P+ N    +Y    DGL++ +L  +  +P  +D   +NK     L    KK EN     N A ++G       +V +G  +I++G+    L L+WQ++R          Y   + + L  GE V D        ++I WVN  LK+ D  + I +FK+  ++     I L+  I P+  K  ++   + M   D +  A+  +  A  +  KV+   +D+V
Sbjct:  393 TREDRTFRNWMNSL---------GVSPYVN---HLYSDLHDGLIILQLYERIQIP--VDWPRVNKPPYPVLGSNMKKLEN----CNYAVALGKKEAKFSLVGIGGENINEGSPMHTLALVWQLMRR---------YTLKVLSDLGDGEKVSD-------QIIINWVNSTLKQGDKNSSISSFKDKSISTSLPVIDLIDTIVPKAIKYEMVKSGD-MTAEDKLNNAKYAISVARKIGVKVYALPDDLV 604          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 223.016 bits (567), Expect = 6.818e-66
Identity = 145/389 (37.28%), Postives = 217/389 (55.78%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSL--SSVKYLELKNFEEILLVLK--KDSIINHVFTQMNLTQEKDDLKIYSKDENFES---KHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP----EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSL-XXXXXXXXXXXXXXXXXXKTYRNW 1256
            +GY+    L+  F      L   +I+EI            E  +FEE + + +  +   +   F +      +D ++ +       S   +H+ S  E+  +  W+N  L ND D K   +P     + ++   KDG+LLCK+IN + P+TIDERV+NK  +    F   ENL+LA+NSA++IGC VVN+   D+  GT H++LGL+WQ+I+ GL   I +  N  L ALL   E +D L  +SPEDLL+RWVN+ LK A    +IRNF ED+ +  AY +LL+QI+P    +D+  + I    + + +D + RAEL+L+ A  L+ + FVT +D+V  N       KLN+AF+ANLFN YP+L     N I   I  ET E++T+RNW
Sbjct:   65 SGYVSDFELQELFREASFHLPGYQIREIVEKFIAGDTNKDEKISFEEFVAISQELRSKEVRETFRK--CISRRDGIRSFGGTSGISSEGTQHSYSDEEKVAFVNWVNKALANDPDCKH-LIPMDPGTDSLFKSVKDGILLCKMINLSQPDTIDERVINKKCTP---FTMTENLMLALNSASAIGCTVVNIDAQDMKAGTPHLVLGLLWQIIKIGLFADIEISRNEALIALLDESEELDHLMSMSPEDLLLRWVNYHLKAAGW-KQIRNFSEDIKDSRAYFHLLNQISPKGDLDDQMRIDIDMLGLTERDDEM-RAELMLRQAARLDCRQFVTPKDVVAGN------HKLNMAFVANLFNMYPALNRPTDNGIDYAIEGETREDRTFRNW 439          

HSP 2 Score: 53.9138 bits (128), Expect = 2.688e-7
Identity = 62/247 (25.10%), Postives = 109/247 (44.13%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-----CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCE-AYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + E+R +  W+N+L            P+ N    +Y    DGL++ +L  +  +P  +D   +NK     L    KK EN     N A ++G       +V +G  +I++G+    L L+WQ++R          Y   + + L  GE V D        ++I WVN  LK+ D  + I +FK+  ++     I L+  I P+  K  ++   + M   D +  A+  +  A  +  KV+   +D+V
Sbjct:  430 TREDRTFRNWMNSL---------GVSPYVN---HLYSDLHDGLIILQLYERIQIP--VDWPRVNKPPYPVLGSNMKKLEN----CNYAVALGKKEAKFSLVGIGGENINEGSPMHTLALVWQLMRR---------YTLKVLSDLGDGEKVSD-------QIIINWVNSTLKQGDKNSSISSFKDKSISTSLPVIDLIDTIVPKAIKYEMVKSGD-MTAEDKLNNAKYAISVARKIGVKVYALPDDLV 641          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 231.876 bits (590), Expect = 2.361e-69
Identity = 159/389 (40.87%), Postives = 223/389 (57.33%), Query Frame = 3
Query:  129 GYIYTTSLRTAFEIVGLELSEQEIKEIENSL--SSVKYLELK-NFEEILLVLKKDSIINHVFTQ-MNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            GYI    L   F+   L L   +++EI   L     K  + K  FEE + V  K S I   F + +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D K   LP      D++    DG++LCK+IN +VP+TIDERV+NK +     F  QENL LA+NSA++IGC VVN+G  D+  G  H+ LGL+WQVI+ GL   I L  N  L ALL  GE+++DL KLSPE+LL+RW NF L+ A    +I NF  D+ +  AY +LL+QIAP+ +K      EE + +N       D ++RAE +L+ A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L +  N+ +    +  ET EE+T+RNW
Sbjct:   26 GYISDYELHDLFKEANLPLPGYKVREIIQKLMNDGDKNKDGKICFEEFVFVKLKSSDIAKTFRKAINRKEGICAIGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCKH-VLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGW-QKISNFSSDIKDSRAYFHLLNQIAPKGQK----EGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALTKPVNQDIDWTLLEGETREERTFRNW 400          

HSP 2 Score: 63.929 bits (154), Expect = 2.465e-10
Identity = 65/248 (26.21%), Postives = 113/248 (45.56%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-----CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAY--IYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y+  +D L++ +L +K  VP  +D   +NK     L    KK EN     N A  +G       +V +G  D++DG   + L L+WQV+R          Y  N+   L  G+ V+D       ++++ WVN  L  A   T I+NFK+  + C ++  + L+  I P      L+  ++ +   D  + A+  +  A  + ++++   ED+V
Sbjct:  391 TREERTFRNWMNSLGVN---------PHVN---HLYNDLQDALVILQLYDKIKVP--VDWNKVNKPPYPKLGANMKKLEN----CNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRR---------YTLNVLECLGEGQKVND-------EIIVNWVNRTLADAGKKTSIQNFKDKTI-CTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLV 603          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 230.335 bits (586), Expect = 1.079e-68
Identity = 162/407 (39.80%), Postives = 234/407 (57.49%), Query Frame = 3
Query:   81 ELINELNSRIPEYGENGYIYTTSLRTAFEIVGLELSEQEIKEIENSL--SSVKYLELK-NFEEILLVLK--KDSIINHVFTQ-MNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            E + E  +RI +  ++GYI    L   F+   L L   +++EI   L     K  + K  FEE + +++  K S I   F + +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D K   LP      D++    DG++LCK+IN +VP+TIDERV+NK +     F  QENL LA+NSA++IGC VVN+G  D+  G  H+ LGL+WQVI+ GL   I L  N  L ALL  GE+++DL KLSPE+LL+RW NF L+ A    +I NF  D+ +  AY +LL+QIAP+ +K      EE + +N       D ++RAE +L+ A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L +  N+ +    +  ET EE+T+RNW
Sbjct:   15 EELREAFARI-DTDDSGYISDYELHDLFKEANLPLPGYKVREIIQKLMNDGDKNKDGKICFEEFVFLVQELKSSDIAKTFRKAINRKEGICAIGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCKH-VLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGW-QKISNFSSDIKDSRAYFHLLNQIAPKGQK----EGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALTKPVNQDIDWTLLEGETREERTFRNW 406          

HSP 2 Score: 64.3142 bits (155), Expect = 2.023e-10
Identity = 65/248 (26.21%), Postives = 113/248 (45.56%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-----CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAY--IYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y+  +D L++ +L +K  VP  +D   +NK     L    KK EN     N A  +G       +V +G  D++DG   + L L+WQV+R          Y  N+   L  G+ V+D       ++++ WVN  L  A   T I+NFK+  + C ++  + L+  I P      L+  ++ +   D  + A+  +  A  + ++++   ED+V
Sbjct:  397 TREERTFRNWMNSLGVN---------PHVNH---LYNDLQDALVILQLYDKIKVP--VDWNKVNKPPYPKLGANMKKLEN----CNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRR---------YTLNVLECLGEGQKVND-------EIIVNWVNRTLADAGKKTSIQNFKDKTI-CTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLV 609          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 230.335 bits (586), Expect = 1.293e-68
Identity = 159/403 (39.45%), Postives = 231/403 (57.32%), Query Frame = 3
Query:   93 ELNSRIPEYGENGYIYTTSLRTAFEIVGLELSEQEIKEIENSL--SSVKYLELK-NFEEILLVLK--KDSIINHVFTQ-MNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            ++ S   +  ++GYI    L   F+   L L   +++EI   L     K  + K  FEE + +++  K S I   F + +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D K   LP      D++    DG++LCK+IN +VP+TIDERV+NK +     F  QENL LA+NSA++IGC VVN+G  D+  G  H+ LGL+WQVI+ GL   I L  N  L ALL  GE+++DL KLSPE+LL+RW NF L+ A    +I NF  D+ +  AY +LL+QIAP+ +K      EE + +N       D ++RAE +L+ A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L +  N+ +    +  ET EE+T+RNW
Sbjct:   28 KIRSLFSDTDDSGYISDYELHDLFKEANLPLPGYKVREIIQKLMNDGDKNKDGKICFEEFVFLVQELKSSDIAKTFRKAINRKEGICAIGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCKH-VLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGW-QKISNFSSDIKDSRAYFHLLNQIAPKGQK----EGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALTKPVNQDIDWTLLEGETREERTFRNW 416          

HSP 2 Score: 63.929 bits (154), Expect = 2.249e-10
Identity = 65/248 (26.21%), Postives = 113/248 (45.56%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-----CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAY--IYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y+  +D L++ +L +K  VP  +D   +NK     L    KK EN     N A  +G       +V +G  D++DG   + L L+WQV+R          Y  N+   L  G+ V+D       ++++ WVN  L  A   T I+NFK+  + C ++  + L+  I P      L+  ++ +   D  + A+  +  A  + ++++   ED+V
Sbjct:  407 TREERTFRNWMNSLGVN---------PHVNH---LYNDLQDALVILQLYDKIKVP--VDWNKVNKPPYPKLGANMKKLEN----CNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRR---------YTLNVLECLGEGQKVND-------EIIVNWVNRTLADAGKKTSIQNFKDKTI-CTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLV 619          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 229.95 bits (585), Expect = 1.375e-68
Identity = 158/393 (40.20%), Postives = 227/393 (57.76%), Query Frame = 3
Query:  123 ENGYIYTTSLRTAFEIVGLELSEQEIKEIENSL--SSVKYLELK-NFEEILLVLK--KDSIINHVFTQ-MNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            ++GYI    L   F+   L L   +++EI   L     K  + K  FEE + +++  K S I   F + +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D K   LP      D++    DG++LCK+IN +VP+TIDERV+NK +     F  QENL LA+NSA++IGC VVN+G  D+  G  H+ LGL+WQVI+ GL   I L  N  L ALL  GE+++DL KLSPE+LL+RW NF L+ A    +I NF  D+ +  AY +LL+QIAP+ +K      EE + +N       D ++RAE +L+ A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L +  N+ +    +  ET EE+T+RNW
Sbjct:   27 DSGYISDYELHDLFKEANLPLPGYKVREIIQKLMNDGDKNKDGKICFEEFVFLVQELKSSDIAKTFRKAINRKEGICAIGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCKH-VLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGW-QKISNFSSDIKDSRAYFHLLNQIAPKGQK----EGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALTKPVNQDIDWTLLEGETREERTFRNW 405          

HSP 2 Score: 63.929 bits (154), Expect = 2.131e-10
Identity = 65/248 (26.21%), Postives = 113/248 (45.56%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-----CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAY--IYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y+  +D L++ +L +K  VP  +D   +NK     L    KK EN     N A  +G       +V +G  D++DG   + L L+WQV+R          Y  N+   L  G+ V+D       ++++ WVN  L  A   T I+NFK+  + C ++  + L+  I P      L+  ++ +   D  + A+  +  A  + ++++   ED+V
Sbjct:  396 TREERTFRNWMNSLGVN---------PHVNH---LYNDLQDALVILQLYDKIKVP--VDWNKVNKPPYPKLGANMKKLEN----CNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRR---------YTLNVLECLGEGQKVND-------EIIVNWVNRTLADAGKKTSIQNFKDKTI-CTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLV 608          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 229.95 bits (585), Expect = 1.529e-68
Identity = 158/393 (40.20%), Postives = 227/393 (57.76%), Query Frame = 3
Query:  123 ENGYIYTTSLRTAFEIVGLELSEQEIKEIENSL--SSVKYLELK-NFEEILLVLK--KDSIINHVFTQ-MNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            ++GYI    L   F+   L L   +++EI   L     K  + K  FEE + +++  K S I   F + +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D K   LP      D++    DG++LCK+IN +VP+TIDERV+NK +     F  QENL LA+NSA++IGC VVN+G  D+  G  H+ LGL+WQVI+ GL   I L  N  L ALL  GE+++DL KLSPE+LL+RW NF L+ A    +I NF  D+ +  AY +LL+QIAP+ +K      EE + +N       D ++RAE +L+ A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L +  N+ +    +  ET EE+T+RNW
Sbjct:   26 DSGYISDYELHDLFKEANLPLPGYKVREIIQKLMNDGDKNKDGKICFEEFVFLVQELKSSDIAKTFRKAINRKEGICAIGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCKH-VLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGW-QKISNFSSDIKDSRAYFHLLNQIAPKGQK----EGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALTKPVNQDIDWTLLEGETREERTFRNW 404          

HSP 2 Score: 63.929 bits (154), Expect = 2.346e-10
Identity = 65/248 (26.21%), Postives = 113/248 (45.56%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-----CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAY--IYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y+  +D L++ +L +K  VP  +D   +NK     L    KK EN     N A  +G       +V +G  D++DG   + L L+WQV+R          Y  N+   L  G+ V+D       ++++ WVN  L  A   T I+NFK+  + C ++  + L+  I P      L+  ++ +   D  + A+  +  A  + ++++   ED+V
Sbjct:  395 TREERTFRNWMNSLGVN---------PHVNH---LYNDLQDALVILQLYDKIKVP--VDWNKVNKPPYPKLGANMKKLEN----CNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRR---------YTLNVLECLGEGQKVND-------EIIVNWVNRTLADAGKKTSIQNFKDKTI-CTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLV 607          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 242.662 bits (618), Expect = 1.685e-73
Identity = 153/388 (39.43%), Postives = 226/388 (58.25%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELK---NFEEILLV---LKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP---EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NGYI    L   F+   L L    ++EI  +L +   L+     +F+E + V   LK   +       +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P     +D+++   DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  +++LGL+WQVI+ GL   I L  N  L ALL  GES++DL KLSPE+LL+RW N+ L+ A C T+I NF  D+ + +AY +LL Q+AP   E+    ++     ++  D IQRAE +L+ A  L  + FVT  D+V  N       KLNLAFIANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   26 NGYISCNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGKISFDEFIKVFHGLKSTEVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGC-TKITNFSTDIKDSKAYYHLLEQVAPKGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGN------PKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNW 403          

HSP 2 Score: 54.6842 bits (130), Expect = 1.689e-7
Identity = 61/248 (24.60%), Postives = 111/248 (44.76%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIY-LLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVR 1118
            + EER +  W+N+L  N         P  N    +Y    D L++ +L  K  VP  +D   +NK     L G  KK EN   A++   +     +V +   D+++G + + L L+WQ++R          Y  N+   +  G+ V+D       D+++ WVN  LK+A   + I +FK+  ++    +  L+  I P      L+  E  +   + +  A+  +  A  + ++V+   ED+V  N +
Sbjct:  394 TREERTFRNWMNSLGVN---------PRVN---HLYSDLSDALVIFQLYEKIKVP--VDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRR---------YTLNILEDIGGGQKVND-------DIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTEN-LDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPK 610          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 242.662 bits (618), Expect = 1.685e-73
Identity = 153/388 (39.43%), Postives = 226/388 (58.25%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELK---NFEEILLV---LKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP---EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NGYI    L   F+   L L    ++EI  +L +   L+     +F+E + V   LK   +       +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P     +D+++   DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  +++LGL+WQVI+ GL   I L  N  L ALL  GES++DL KLSPE+LL+RW N+ L+ A C T+I NF  D+ + +AY +LL Q+AP   E+    ++     ++  D IQRAE +L+ A  L  + FVT  D+V  N       KLNLAFIANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   26 NGYISCNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGKISFDEFIKVFHGLKSTEVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGC-TKITNFSTDIKDSKAYYHLLEQVAPKGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGN------PKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNW 403          

HSP 2 Score: 54.6842 bits (130), Expect = 1.689e-7
Identity = 61/248 (24.60%), Postives = 111/248 (44.76%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIY-LLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVR 1118
            + EER +  W+N+L  N         P  N    +Y    D L++ +L  K  VP  +D   +NK     L G  KK EN   A++   +     +V +   D+++G + + L L+WQ++R          Y  N+   +  G+ V+D       D+++ WVN  LK+A   + I +FK+  ++    +  L+  I P      L+  E  +   + +  A+  +  A  + ++V+   ED+V  N +
Sbjct:  394 TREERTFRNWMNSLGVN---------PRVN---HLYSDLSDALVIFQLYEKIKVP--VDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRR---------YTLNILEDIGGGQKVND-------DIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTEN-LDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPK 610          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 242.662 bits (618), Expect = 1.685e-73
Identity = 153/388 (39.43%), Postives = 226/388 (58.25%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELK---NFEEILLV---LKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP---EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NGYI    L   F+   L L    ++EI  +L +   L+     +F+E + V   LK   +       +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P     +D+++   DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  +++LGL+WQVI+ GL   I L  N  L ALL  GES++DL KLSPE+LL+RW N+ L+ A C T+I NF  D+ + +AY +LL Q+AP   E+    ++     ++  D IQRAE +L+ A  L  + FVT  D+V  N       KLNLAFIANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   26 NGYISCNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGKISFDEFIKVFHGLKSTEVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGC-TKITNFSTDIKDSKAYYHLLEQVAPKGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGN------PKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNW 403          

HSP 2 Score: 54.6842 bits (130), Expect = 1.689e-7
Identity = 61/248 (24.60%), Postives = 111/248 (44.76%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIY-LLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVR 1118
            + EER +  W+N+L  N         P  N    +Y    D L++ +L  K  VP  +D   +NK     L G  KK EN   A++   +     +V +   D+++G + + L L+WQ++R          Y  N+   +  G+ V+D       D+++ WVN  LK+A   + I +FK+  ++    +  L+  I P      L+  E  +   + +  A+  +  A  + ++V+   ED+V  N +
Sbjct:  394 TREERTFRNWMNSLGVN---------PRVN---HLYSDLSDALVIFQLYEKIKVP--VDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRR---------YTLNILEDIGGGQKVND-------DIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTEN-LDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPK 610          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Pls3 (plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:104807])

HSP 1 Score: 220.705 bits (561), Expect = 3.002e-65
Identity = 146/392 (37.24%), Postives = 220/392 (56.12%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSL------SSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NG+I    L   F+   + L   +++EI   L      +    +    F  I   +K   I       +N  +    L   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P     +D++    DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+  G  H++LGL+WQ+I+ GL   I L  N  L ALL  GE++++L KLSPE+LL+RW NF L+ +    +I NF  D+ + +AY +LL+QIAP+ +K      E  + +N       D ++RAE +L+ A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   29 NGFICDYELHELFKEANMPLPGYKVREIIQKLMVDGDRNKDGKISFNEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTP--FIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGW-QKINNFSADIKDSKAYFHLLNQIAPKGQK----EGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNW 406          

HSP 2 Score: 54.299 bits (129), Expect = 2.086e-7
Identity = 60/243 (24.69%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCE-AYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y   +D L++ +L  +  VP  +D   +NK     L    KK EN   A+    +     +V +G  D++DG   + L ++WQ++R          Y  N+   L  G+  +D       D+++ WVN  L +A   T I++FK+  ++   A + L+  I P      L+    + + +D    A+  +  A  + ++V+   ED+V
Sbjct:  397 TREERTFRNWMNSLGVN---------PHVN---HLYADLQDALVILQLYERIKVP--VDWSKVNKPPYPKLGANMKKLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRR---------YTLNVLEDLGEGQKAND-------DIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTE-DDKHNNAKYAVSMARRIGARVYALPEDLV 608          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Pls3 (plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:104807])

HSP 1 Score: 220.705 bits (561), Expect = 3.726e-65
Identity = 146/392 (37.24%), Postives = 220/392 (56.12%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSL------SSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NG+I    L   F+   + L   +++EI   L      +    +    F  I   +K   I       +N  +    L   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P     +D++    DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+  G  H++LGL+WQ+I+ GL   I L  N  L ALL  GE++++L KLSPE+LL+RW NF L+ +    +I NF  D+ + +AY +LL+QIAP+ +K      E  + +N       D ++RAE +L+ A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   29 NGFICDYELHELFKEANMPLPGYKVREIIQKLMVDGDRNKDGKISFNEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTP--FIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGW-QKINNFSADIKDSKAYFHLLNQIAPKGQK----EGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNW 406          

HSP 2 Score: 54.299 bits (129), Expect = 2.200e-7
Identity = 60/243 (24.69%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCE-AYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y   +D L++ +L  +  VP  +D   +NK     L    KK EN   A+    +     +V +G  D++DG   + L ++WQ++R          Y  N+   L  G+  +D       D+++ WVN  L +A   T I++FK+  ++   A + L+  I P      L+    + + +D    A+  +  A  + ++V+   ED+V
Sbjct:  397 TREERTFRNWMNSLGVN---------PHVN---HLYADLQDALVILQLYERIKVP--VDWSKVNKPPYPKLGANMKKLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRR---------YTLNVLEDLGEGQKAND-------DIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTE-DDKHNNAKYAVSMARRIGARVYALPEDLV 608          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|Q61233|PLSL_MOUSE (Plastin-2 OS=Mus musculus OX=10090 GN=Lcp1 PE=1 SV=4)

HSP 1 Score: 242.662 bits (618), Expect = 1.179e-72
Identity = 153/388 (39.43%), Postives = 226/388 (58.25%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELK---NFEEILLV---LKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP---EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NGYI    L   F+   L L    ++EI  +L +   L+     +F+E + V   LK   +       +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P     +D+++   DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  +++LGL+WQVI+ GL   I L  N  L ALL  GES++DL KLSPE+LL+RW N+ L+ A C T+I NF  D+ + +AY +LL Q+AP   E+    ++     ++  D IQRAE +L+ A  L  + FVT  D+V  N       KLNLAFIANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   26 NGYISCNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGKISFDEFIKVFHGLKSTEVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGC-TKITNFSTDIKDSKAYYHLLEQVAPKGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGN------PKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNW 403          

HSP 2 Score: 54.6842 bits (130), Expect = 1.181e-6
Identity = 61/248 (24.60%), Postives = 111/248 (44.76%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIY-LLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVR 1118
            + EER +  W+N+L  N         P  N    +Y    D L++ +L  K  VP  +D   +NK     L G  KK EN   A++   +     +V +   D+++G + + L L+WQ++R          Y  N+   +  G+ V+D       D+++ WVN  LK+A   + I +FK+  ++    +  L+  I P      L+  E  +   + +  A+  +  A  + ++V+   ED+V  N +
Sbjct:  394 TREERTFRNWMNSLGVN---------PRVN---HLYSDLSDALVIFQLYEKIKVP--VDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRR---------YTLNILEDIGGGQKVND-------DIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTEN-LDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPK 610          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|Q6P698|PLSL_DANRE (Plastin-2 OS=Danio rerio OX=7955 GN=lcp1 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.231e-71
Identity = 150/387 (38.76%), Postives = 230/387 (59.43%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELKN---FEEILLVLK--KDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPE-DKKSLLISPEEI--MKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NG+I T  L   F+   L L    ++EI   +S    L       F+E   V+   K S +   F +  + +++    +    E   ++H+ S  E+  +  W+N  LE D D +   LP     +D++    DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G +H++LGL+WQVI+ GL   I +  N  L ALL  GES++DL KLSPE+LL+RW N+ L++A CP +I NF  D+ + +AY  +L+Q+AP+ D++ +   P +I  ++  D ++RAE +L+ A  L  + FVT  D+V  N       KLNLA++ANLFN YP+L++ +N+ +    I  ET EE+T+RNW
Sbjct:   26 NGHISTDELNALFKAANLPLPGYRVREIIQEISRTMDLNQDGKITFDEFAKVVHDLKSSEVAKTFRKA-INKKEGICSVAGTSEQSGTQHSYSEEEKVAFVNWVNKALEKDPDCQH-VLPMDPSTDDLFTAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIEISRNEALIALLRDGESLEDLVKLSPEELLLRWANYHLEEAGCP-KINNFSSDIKDSKAYYNILNQVAPKRDEEGIPAIPIDISGIREKDDLKRAECMLEQADRLGCRQFVTATDVVRGN------PKLNLAYVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNW 401          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|P13796|PLSL_HUMAN (Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6)

HSP 1 Score: 238.424 bits (607), Expect = 4.713e-71
Identity = 151/388 (38.92%), Postives = 221/388 (56.96%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLE------LKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP---EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NGYI    L   F+   L L    ++EI  +L +   L+         F +I   LK   +       +N  +    +   S+  +  ++H+ S  E+  +  WIN  LEND D +   +P      D+++   DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  +++LGL+WQVI+ GL   I L  N  L ALL  GES++DL KLSPE+LL+RW N+ L+ A C  +I NF  D+ + +AY +LL Q+AP   E+    ++     ++  D IQRAE +L+ A  L  + FVT  D+V  N       KLNLAFIANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   26 NGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRH-VIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGC-NKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGN------PKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNW 403          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|P54680|FIMB_DICDI (Fimbrin OS=Dictyostelium discoideum OX=44689 GN=fimA PE=2 SV=2)

HSP 1 Score: 228.024 bits (580), Expect = 2.828e-67
Identity = 152/399 (38.10%), Postives = 228/399 (57.14%), Query Frame = 3
Query:   87 INELNSRIPEYGENGYIYTTSL-------RTAFEIVGLELSEQEIKEIENSLSSVKYLELKNFEEILLVLKKDSI-INHVF-TQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            I+E  +   ++ ENG    ++L       +   ++ G+E+ +  IKE++   +    ++ K F +++   ++ S   +  F + +      + +  YS       +H+ S  E+  Y +WIN  L  D DLK + LP     +  +    DGLLLCKLIN AVP+TIDERVLNK ++L  F +  EN VL INSA +IGC VVN+G GD+ +G  H+++GL WQ+I+ GL  +INL  +P L  LL  GE+++DL KL  E++L+RW N+ L  A    R++NF  D+ + E Y  LL QIAP+D           + +++  QRA  VL+NA  L  K F+  +DIV         +KLNLAF+ANLFN++P+L   +    + IIEET EEKT+RNW
Sbjct:    9 ISEFKASFNQFDENGDGQISALELQKILTKCGEKVTGVEVRDM-IKEVDTDGNG--SIDFKEFLQVMQKARQHSANASPAFASAVKKVGAVNTIGGYSGSTASGVQHSYSDEEKVAYIDWINNCLAKDVDLKSR-LPIPEDGDKFFAACNDGLLLCKLINDAVPDTIDERVLNK-KNLNAF-RINENQVLCINSAKAIGCNVVNIGAGDLVEGRAHLIMGLTWQIIKIGLFARINLTNHPELYRLLHDGETIEDLLKLPVEEILLRWFNYHLAAAGSQRRVKNFSGDIKDSECYTILLKQIAPKDAG----VETSALNISNLDQRAVKVLENADKLGCKKFLKPKDIVTG------FQKLNLAFVANLFNTHPAL---EPVEDVVIIEETREEKTFRNW 388          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|A6H742|PLSI_BOVIN (Plastin-1 OS=Bos taurus OX=9913 GN=PLS1 PE=2 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.987e-65
Identity = 143/389 (36.76%), Postives = 220/389 (56.56%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSV------KYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP----EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXX--XXXXXXXXXXXXXXKTYRNW 1256
            +GY+    L+  F+   L L   +++EI   + +V        +  + F  ++  LK   I       +N  +    +   S   +  ++H+ S  E+  +  WIN  LEND D K   +P    ++ ++    DG+LLCK+IN + P+TIDER +NK +     F   ENL LA+NSA++IGC VVN+G  D+++G  H++LGL+WQ+I+ GL   I +  N  L ALL  GE +++L +LSPE+LL++WVN+ L  A  PT I NF  D+ +  AY +LL+QIAP    +D  ++ I      + ND ++RAE +L+ A  L  + FVT  D+V+ N       KLNLAF+ANLFN+YP L +    +  V  +  E+ EE+T+RNW
Sbjct:   28 SGYVSDYELQDLFKEASLPLPGYKVREIVEKILAVADNNKDSRISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSSISSEGTQHSYSEEEKVAFVNWINKALENDPDCKH-LIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDERAINKKKLTP--FTISENLNLALNSASAIGCTVVNIGAQDLTEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLKEGEDLEELMRLSPEELLLQWVNYHLTNAGWPT-ISNFSHDIKDSRAYFHLLNQIAPKGDRDDGPAIAIDLTGFSEKND-LKRAEFMLQEADKLGCRQFVTPADVVSGN------PKLNLAFVANLFNTYPGLHKPDNNDIDVNLLEGESKEERTFRNW 405          

HSP 2 Score: 59.6918 bits (143), Expect = 2.804e-8
Identity = 63/246 (25.61%), Postives = 112/246 (45.53%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-----CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIY-LLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            S EER +  W+N+L  N         P+ N    +Y    D L++ +L  + +   +D   +NK    +L G  KK EN     N A  +G       +V +   D+++G   + L L+WQ++R          Y  N+ + L  GE V+D        ++I WVN  LK A+  T I +FK+  ++    +  L+  IAP   +  +I  E++    D +  A+  +  A  + ++++   +D+V
Sbjct:  396 SKEERTFRNWMNSLGVN---------PYIN---HLYSDLADALVIFQLY-EMIRVPVDWSHVNKPPYPALGGNMKKIEN----CNYAVELGKNKAKFSLVGIAGQDLNEGNSTLTLALVWQLMRR---------YTLNVLSDLGEGEKVNDA-------IIIEWVNQTLKSANKNTFISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIKREDLSD-EDKLNNAKYAISVARKIGARIYALPDDLV 607          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A1I8JAL8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000734g5 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 7.862e-103
Identity = 185/404 (45.79%), Postives = 266/404 (65.84%), Query Frame = 3
Query:   81 ELINELNSRIPEYGENG-YIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELKNFEEILLVL--------KKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGF---FKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            E I +L  + P+ G++G  +    LR A + +G ++S  +++++ N L   K     +F++  LV         + D  +     +++  ++K  +K  S   N  + HT+  +E RGY+ WIN +LE D DL    LP     +++Y+K  DGL+LCKLIN AVP+TI E+ +NK   LKG    F+  ENLVLA+NSA SIGCC+VN+G  DI +   HI+LGLIWQ+IR GL+  I L  +  L ALL PGE+++DLK+LSPE+LL+RWVN+QL KA    R+ NFK+D+M+ EAY +LL QIAP DK+S + SP+E++   D ++RA+ VL NA  L++ VFV  EDI  AN  G+NREKLN+AF+ANLFN+YP++ E   ++ +E+IEETLEEKT+RNW
Sbjct:   16 ENIADLLRKFPDLGKDGGTVSKDELRDALDAMGAKVSGFQLRDLLNDLMPTK----TSFDKDALVTLYCQVKMKQPDRDVKDSMKKLHNPEDKQSMKKISGTGNEWTLHTIGDSERRGYAGWINKMLEKDPDLSH-LLPVDGNTDELYEKLGDGLVLCKLINSAVPDTIHEKAMNKLAQLKGGSAGFRMHENLVLAVNSAESIGCCIVNIGANDIKECRPHIILGLIWQIIRIGLMKDITLSQHKELAALLLPGETLEDLKQLSPEELLLRWVNYQLAKAGTDKRVHNFKDDIMDSEAYAHLLSQIAPADKRSEMRSPQEVLASADRLKRADGVLSNADKLDAAVFVVSEDIAFANEPGRNREKLNMAFVANLFNNYPAM-EAVQDVEVEVIEETLEEKTFRNW 413          

HSP 2 Score: 71.633 bits (174), Expect = 1.242e-9
Identity = 63/242 (26.03%), Postives = 108/242 (44.63%), Query Frame = 3
Query:  396 EERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTID-ERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPG-ESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNAN 1112
            EE+ +  W+N+L            PF    +D+Y   ++GL+L  L++   P  +   +V       K  F+ Q N    I     IG  + N+G  DI DG + + LGL++Q++RA         Y  +L   L  G   +DD       D +I+W N +L+ A    R+++FK+  + +    + L   I P   K++  S    MK  D + RA  +L  +  +  +++   E +V  N
Sbjct:  406 EEKTFRNWMNSL---------GVSPFV---KDLYSDLRNGLILLTLMDHIKPGVVPWSKVCKTFVPNKKLFQWQANCNYVIECGRKIGLPMTNIGAEDIRDGDRKLTLGLVFQMMRA---------YTLSLLMQLTGGTRKIDD-------DEIIQWANQKLEAAGKAARVKSFKDPSLADGMVILELADAIKP---KTVDTSIAAGMK--DQLDRARFILSKSRMIGGRIYALPEHVVQVN 614          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A1I8GSA3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000734g1 PE=4 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 2.178e-102
Identity = 185/404 (45.79%), Postives = 265/404 (65.59%), Query Frame = 3
Query:   81 ELINELNSRIPEYGENG-YIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELKNFEEILLVL--------KKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGF---FKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            E I +L  + P+ G++G  +    LR A + +G ++S  +++++ N L   K     +F++  LV         + D  +     +++  ++K  +K  S   N  + HT+  +E RGY+ WIN +LE D DL    LP     +++Y+K  DGL+LCKLIN AVP TI E+ +NK   LKG    F+  ENLVLA+NSA SIGCC+VN+G  DI +   HI+LGLIWQ+IR GL+  I L  +  L ALL PGE+++DLK+LSPE+LL+RWVN+QL KA    R+ NFK+D+M+ EAY +LL QIAP DK+S + SP+E++   D ++RA+ VL NA  L++ VFV  EDI  AN  G+NREKLN+AF+ANLFN+YP++ E   ++ +E+IEETLEEKT+RNW
Sbjct:   16 ENIADLLRKFPDLGKDGGTVSKDELRDALDAMGAKVSGFQLRDLLNDLMPTK----TSFDKDALVTLYCQVKMKQPDRDVKDSMKKLHNPEDKQSMKKISGTGNEWTLHTIGDSERRGYAGWINKMLEKDPDLSH-LLPVDGNTDELYEKLGDGLVLCKLINSAVPGTIHEKAMNKLAQLKGGSAGFRMHENLVLAVNSAESIGCCIVNIGANDIKECRPHIILGLIWQIIRIGLMKDITLSQHKELAALLLPGETLEDLKQLSPEELLLRWVNYQLAKAGTDKRVHNFKDDIMDSEAYAHLLSQIAPVDKRSEMRSPQEVLASADRLKRADGVLSNADKLDAAVFVVSEDIAFANEPGRNREKLNMAFVANLFNNYPAM-EAVQDVEVEVIEETLEEKTFRNW 413          

HSP 2 Score: 71.633 bits (174), Expect = 1.358e-9
Identity = 63/242 (26.03%), Postives = 108/242 (44.63%), Query Frame = 3
Query:  396 EERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTID-ERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPG-ESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNAN 1112
            EE+ +  W+N+L            PF    +D+Y   ++GL+L  L++   P  +   +V       K  F+ Q N    I     IG  + N+G  DI DG + + LGL++Q++RA         Y  +L   L  G   +DD       D +I+W N +L+ A    R+++FK+  + +    + L   I P   K++  S    MK  D + RA  +L  +  +  +++   E +V  N
Sbjct:  406 EEKTFRNWMNSL---------GVSPFV---KDLYSDLRNGLILLTLMDHIKPGVVPWSKVCKTFVPNKKLFQWQANCNYVIECGRKIGLPMTNIGAEDIRDGDRKLTLGLVFQMMRA---------YTLSLLMQLTGGTRKIDD-------DEIIQWANQKLEAAGKAARVKSFKDPSLADGMVILELADAIKP---KTVDTSIAAGMK--DQLDRARFILSKSRMIGGRIYALPEHVVQVN 614          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A0R3WQZ8 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS3173 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 2.264e-102
Identity = 187/400 (46.75%), Postives = 254/400 (63.50%), Query Frame = 3
Query:   81 ELINELNSRIPEYGENGYIYTTSLRTAFEIVGLELSEQEIK---EIENSLSSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIY----SKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFT-NMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            E+I +L+   P     G++  + +R A E VG  LS  + +   E E       ++ +    EI+ VLK     + +  +    +++ DL++Y     ++    +KH+VS AEER + +WIN LL  D+DLK  +LP   N++  +Y++ +DGLLLCKLIN AVP+TIDER +NK  +    FK  ENL LA+NSA SIGCCVVNVGP DI    +H++LGLIWQ+IR GLLG I++ ++  L  LL PGE+VD+L+ LSPEDLL+RWVNF L+ A    R+ NF  DV++ E Y  LL QIAPEDK+S LI    IM  ++   RAE+VL+NA  LN+  F++ EDIVNA  RG  R+KL+LAF+ANLFN YP L           + ETLEEKTYRNW
Sbjct:   12 EMIADLSESFPTL-YRGWLPRSQVRAALEKVGFTLSSGDFRCLVEEEFMRPGCDHICVDTLIEIIKVLKASQDKHQLVEKKKELRDRADLRVYETEMQENSTTTAKHSVSPAEERAFIDWINRLLGRDQDLKH-HLPIDYNVDGQLYERCRDGLLLCKLINAAVPDTIDERCINKTPTKPNIFKINENLTLAVNSAESIGCCVVNVGPEDIEQCARHLVLGLIWQIIRIGLLGMISIQHHSELIDLLEPGETVDNLRLLSPEDLLLRWVNFHLEMAGNTHRMTNFTYDVIDSEIYATLLQQIAPEDKQSFLIPVTGIMAESNMYCRAEMVLENAEFLNAAAFISPEDIVNAAERGMARDKLHLAFVANLFNLYPGL----KSKPPVDVPETLEEKTYRNW 405          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A564YG16 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5448 PE=4 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 7.450e-102
Identity = 185/400 (46.25%), Postives = 253/400 (63.25%), Query Frame = 3
Query:   81 ELINELNSRIPEYGENGYIYTTSLRTAFEIVGLELSEQEIKEI---ENSLSSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIY----SKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFT-NMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            E+I +L+   P     G+I    ++ A E VG  LS  + + +   E       ++ +    +IL +L+ +     +  +    +E+ DL++Y     ++    +KH+VS AEER + +WIN LL +D DLK  +LP    ++  +YD+ +DGLLLCKLIN AVP+TIDER +NK  +    FK  ENL LA+NSA SIGCCVVNVGP DI    +H++LGLIWQ+IR GLLG I++ ++  L  LL PGE+VD+L+ LSPEDLL+RWVNF L+ A    R+ NF  DV++ E Y  LL QIAPEDK+S LI    IM  ++   RAE+VL+NA  LN+  F+T +DIVNA  RG +R+KL+LAF+ANLFN YP L           + ETLEEKTYRNW
Sbjct:   12 EMIADLSETFPTL-YRGWIPRNQVKEALERVGFTLSGGDFRRLVEEEFFRPGYDHICVDTLMDILKMLQSNQEKQQLIDKKRELRERADLRVYETEVQENSTATAKHSVSPAEERAFIDWINRLLGSDPDLKH-HLPIDYTVDGQLYDRCRDGLLLCKLINTAVPDTIDERCINKAPTKSNIFKINENLTLAVNSAESIGCCVVNVGPEDIEQCARHLVLGLIWQIIRIGLLGMISIQHHSELIDLLEPGETVDNLRFLSPEDLLLRWVNFHLQTAGNTHRMTNFTSDVIDSEVYATLLQQIAPEDKQSFLIPVTGIMAESNMYCRAEMVLENAEFLNAAAFITPDDIVNAAERGMDRDKLHLAFVANLFNLYPGL----KSKPSVDVPETLEEKTYRNW 405          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A1I8JCX6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 3.917e-100
Identity = 182/396 (45.96%), Postives = 260/396 (65.66%), Query Frame = 3
Query:   81 ELINELNSRIPEYGENG-YIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGF---FKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            E I +L  + P+ G++G  +    LR A + +G ++S  +++++ N L   K     +F+       KD+++     +++ T             N  + HT+  +E RGY+ WIN +LE D DL    LP     +++Y+K  DGL+LCKLIN AVP+TI E+ +NK   LKG    F+  ENLVLA+NSA SIGCC+VN+G  DI +   HI+LGLIWQ+IR GL+  I L  +  L ALL PGE+++DLK+LSPE+LL+RWVN+QL KA    R+ NFK+D+M+ EAY +LL QIAP DK+S + SP+E++   D ++RA+ VL NA  L++ VFV  EDI  AN  G+NREKLN+AF+ANLFN+YP++ E   ++ +E+IEETLEEKT+RNW
Sbjct:    8 ENIADLLRKFPDLGKDGGTVSKDELRDALDAMGAKVSGFQLRDLLNDLMPTK----TSFD-------KDALVTLYCQKISGTG------------NEWTLHTIGDSERRGYAGWINKMLEKDPDLSH-LLPVDGNTDELYEKLGDGLVLCKLINSAVPDTIHEKAMNKLAQLKGGSAGFRMHENLVLAVNSAESIGCCIVNIGANDIKECRPHIILGLIWQIIRIGLMKDITLSQHKELAALLLPGETLEDLKQLSPEELLLRWVNYQLAKAGTDKRVHNFKDDIMDSEAYAHLLSQIAPADKRSEMRSPQEVLASADRLKRADGVLSNADKLDAAVFVVSEDIAFANEPGRNREKLNMAFVANLFNNYPAM-EAVQDVEVEVIEETLEEKTFRNW 378          

HSP 2 Score: 71.633 bits (174), Expect = 1.342e-9
Identity = 63/242 (26.03%), Postives = 108/242 (44.63%), Query Frame = 3
Query:  396 EERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTID-ERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPG-ESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNAN 1112
            EE+ +  W+N+L            PF    +D+Y   ++GL+L  L++   P  +   +V       K  F+ Q N    I     IG  + N+G  DI DG + + LGL++Q++RA         Y  +L   L  G   +DD       D +I+W N +L+ A    R+++FK+  + +    + L   I P   K++  S    MK  D + RA  +L  +  +  +++   E +V  N
Sbjct:  371 EEKTFRNWMNSL---------GVSPFV---KDLYSDLRNGLILLTLMDHIKPGVVPWSKVCKTFVPNKKLFQWQANCNYVIECGRKIGLPMTNIGAEDIRDGDRKLTLGLVFQMMRA---------YTLSLLMQLTGGTRKIDD-------DEIIQWANQKLEAAGKAARVKSFKDPSLADGMVILELADAIKP---KTVDTSIAAGMK--DQLDRARFILSKSRMIGGRIYALPEHVVQVN 579          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 234.187 bits (596), Expect = 1.806e-70
Identity = 148/388 (38.14%), Postives = 225/388 (57.99%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSV------KYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPE-DKKSL--LISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NGYI T  L   F +  L L    I+EI   LS+         +    F ++   LK   +       +N  +++    +    E   ++H+ S  E+  +  WIN  LE D D K   LP    + D++    DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NS+++IGC VVN+G  D+ +G +H++LGL+WQ+I+ GLL  I +  N  L ALL  GES++DL KLSPE+LL+RW N+ L++A C ++I NF  D+ + +AY  +L+Q+AP+ D + +  +I     ++  + ++RAE +L  A  L  + FV   D+V  N       KLNLAF+ANLFN YP+L++ +N+ +    I  ET EE+T+RNW
Sbjct:   24 NGYISTDELNELFRVANLPLPGYRIREIIQELSATMDQNQDGKITFDEFAKVFHGLKSSEVAKTFRKAIN--KKEGICAVAGTSEQSGTQHSYSEEEKVAFVNWINKALEKDPDCKH-VLPMDPSSNDLFTAVGDGIVLCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSSSAIGCHVVNIGAEDLKEGRQHLVLGLLWQIIKIGLLADIEISRNEALIALLRDGESLEDLMKLSPEELLLRWANYHLEQAGC-SKINNFSSDIKDSKAYYNILNQVAPKGDDEGIPPIIIDMTGLREKEDLKRAECMLDQADRLGCRQFVMPPDVVRGN------PKLNLAFVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNW 399          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 180.259 bits (456), Expect = 1.224e-50
Identity = 124/306 (40.52%), Postives = 176/306 (57.52%), Query Frame = 3
Query:  372 SKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSK--DGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            ++H+ S  E+  +  WINT LE D D K   LP  N N D   K    DG++   ++           +LN   +   F    ENL LA+NSA++IGC VVN+G  D+ +G  H++LGL+WQ+I+ GL   I L  N  L ALL  GE+++DL KLSPE+LL+RW NF L  A    +I NF  D+ + +AY +LL+QIAP+  K      E+ + +N       D ++RAE +L  A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   57 TQHSYSEEEKFAFVNWINTALEKDPDCKH-VLPM-NPNTDSLFKFAIFDGIVFLDIV-----------LLNICNTNVNFELNYENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLREGETLEDLMKLSPEELLLRWANFHLDNAGW-HKINNFSSDIKDSKAYFHLLNQIAPKGLK----ENEDRIDINMAGFNEKDDLKRAEAMLVQADRLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALTKPENQDIDWGLLEGETREERTFRNW 338          

HSP 2 Score: 57.3806 bits (137), Expect = 1.426e-8
Identity = 61/243 (25.10%), Postives = 109/243 (44.86%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIG-CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y   +D L++ +L  +  VP   + +V NK     L    KK EN   A++   +     +V +G  D++DG   + L L+WQ++R          Y  N+   L  GE V+D       D+++ WVN  L  A   T+I +FK+ ++ +    + L+  I P      L+    +    D ++ A+  +  A  + ++V+   +D+V
Sbjct:  329 TREERTFRNWMNSLGVN---------PHVN---HLYGDLQDALVILQLYERIKVPVDWNNKV-NKPPYPKLGANMKKLENCNYAVDLGKTTAKFSLVGIGGQDLNDGNPTLTLALVWQLMRR---------YTLNVLEDLGDGEKVND-------DIIVNWVNKTLAGAGKSTKISSFKDKEISSSLPVLDLIDAIQPGSVHYDLVKTGSLSD-QDKLENAKYAVSMARKIGARVYALPDDLV 541          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 139.043 bits (349), Expect = 1.277e-35
Identity = 102/308 (33.12%), Postives = 160/308 (51.95%), Query Frame = 3
Query:  372 SKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPN--LTALLF-----PGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP----EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXX--XXXXXXXXXXXXXXKTYRNW 1256
            ++H+ +  E+  +  WIN  L ND D K   +P     + +  +    L+  K+IN + P+TIDERV+N  +  +  F   ENL+LA+NSA++IGC VVN+   D+  GT H++LGL+WQ+I+ GL   I +  N    LT +       P  S+ DL+ L                         F +D     AY +LL QI+P    +D+  + I    + + +D  +RAEL+L+ A  L+ + FVT +D+V  N       KLN+AF+ANLFN +P+L         +  +  E+ E++T+RNW
Sbjct:  115 TQHSYADEEKVAFVNWINKALANDPDCKH-LIPMDPTTDSLCAQFYT-LVELKMINLSQPDTIDERVINTKK--RTTFTMTENLILALNSASAIGCTVVNIDSQDMIAGTPHLVLGLLWQIIKIGLFADIEISRNEGQKLTTIQHISQSCPWGSIHDLQCLF------------------------FSQD---SRAYFHLLDQISPKGDGDDEMRISIDMSGLNERDDE-RRAELMLRQAARLDCRQFVTPQDVVAGN------HKLNMAFVANLFNMFPALSRPANNGIDLAMLEGESREDRTFRNW 384          

HSP 2 Score: 63.1586 bits (152), Expect = 2.306e-10
Identity = 66/250 (26.40%), Postives = 114/250 (45.60%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKG--ESLKGFFKKQENLVLAINSAASIG-----CCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCE-AYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNAN 1112
            S E+R +  W+N+L  N         P+ N    +Y    DGL++ +L  +  VP  +D R +N+     L    KK EN     N A  +G       +V +G  +I++G+    L L+WQ++R          Y   + A +  GE V+D        +++ WVN  L+K    + I+NFK+  ++     I L+  IAP   KS ++   + M   D +  A+  +  +  + +KV+   +D+V  N
Sbjct:  375 SREDRTFRNWMNSLGVN---------PYVN---HLYSDLMDGLIILQLYERIQVP--VDWRKVNRPPYSILGSNMKKLENC----NYAVELGKREAKFSLVGIGGENINEGSAMHTLALVWQLMRR---------YTVKVLADIGHGEKVND-------QIIVDWVNSTLQKGQKDSSIKNFKDKSISTSLPVIDLIDTIAPGAIKSEMVKRGD-MSPEDKLNNAKYAISVSRKIGAKVYALPDDLVEVN 589          
BLAST of Plastin 3 vs. Ensembl Sea Lamprey
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 62.003 bits (149), Expect = 5.378e-11
Identity = 61/241 (25.31%), Postives = 105/241 (43.57%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIY-LLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            S EER +  W+N+L  N         PF N    +Y    D L++ +L  K +   +D   +NK     L    KK EN   A+    +    +V +G  D++DG   + L L+WQ++R          Y   +   L  GE V+D       ++++ WVN  L+ A   + I +FK          + L+  I P   +  L+  EE +  +D +  A+  +  A  + ++V+   +D+V
Sbjct:  103 SREERTFRNWMNSLGVN---------PFVNH---LYSDLVDALVIIQLFEK-IKTRVDWNKVNKPPYPKLGANMKKLENCNYAVELGKTTKFSLVGIGGQDLNDGNPTLTLALVWQLMRK---------YTIQVLEDLGEGEKVND-------EIIVNWVNHTLRDAGKSSSIASFKVPPTALSTPCWDLIDAIQPGSIRYDLVK-EEPLTDDDRLDNAKYAISMARKIGARVYALPDDLV 313          

HSP 2 Score: 58.5362 bits (140), Expect = 7.588e-10
Identity = 46/119 (38.66%), Postives = 69/119 (57.98%), Query Frame = 3
Query:  918 DVMNCEAYIYLLHQIAPE-DKKSLLISPEEIMKVNDP--IQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXX---XXXXXXXXXXXKTYRNW 1256
            D  +  AY +LL+QIAP+ DK+       +    ND   ++RAE++++ A  L  + FVT  D+V+ N       KLNLAF+ANLFN YP+L +  N+     +    E+ EE+T+RNW
Sbjct:    1 DPQDSRAYFHLLNQIAPKGDKEGQPRVDIDFSGFNDKDELRRAEMLVQ-ADKLGCRQFVTPADVVSGN------PKLNLAFVANLFNKYPALHKPANQDIDWGLLEAGESREERTFRNW 112          
BLAST of Plastin 3 vs. Ensembl Yeast
Match: SAC6 (Fimbrin, actin-bundling protein; cooperates with Scp1p in organization and maintenance of the actin cytoskeleton; phosphorylated by Cdc28p/Clb2p in metaphase on T103, to regulate conformation, and modulate actin filament binding affinity and actin cable dynamics; relocalizes from the plasma membrane to the cytoplasm upon DNA replication stress; human homologs PLS3 and LCP1 implicated in spinocerebellar ataxia type 2 (SCA2) can each complement yeast null mutant [Source:SGD;Acc:S000002536])

HSP 1 Score: 207.608 bits (527), Expect = 3.347e-61
Identity = 117/302 (38.74%), Postives = 182/302 (60.26%), Query Frame = 3
Query:  288 IINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLN---KGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSL 1184
            I++   T +    +    KI        + HT++  E R +++ IN++L  D+D+ +  LPF      ++D+ +DGL+L KLIN +VP+TID RVLN   KG+ L  F +  EN  + INSA +IGC VVNV   DI +G +H++LGLIWQ+IR GLL +I++  +P L  LL   E+++   +L PE +L+RW N+ LK+A+   R+ NF +DV + E Y  LL+Q+ P       +  +  ++  D ++RAE VL+NA  L+ + ++T   +V  N       KLNLAF+A+LFN++P L
Sbjct:  105 IVSTAATGLQHKGKGTQAKIIVAGSQTGTTHTINEEERREFTKHINSVLAGDQDIGD-LLPFPTDTFQLFDECRDGLVLSKLINDSVPDTIDTRVLNWPKKGKELNNF-QASENANIVINSAKAIGCVVVNVHSEDIIEGREHLILGLIWQIIRRGLLSKIDIKLHPELYRLLEDDETLEQFLRLPPEQILLRWFNYHLKQANWNRRVTNFSKDVSDGENYTILLNQLDPA------LCSKAPLQTTDLMERAEQVLQNAEKLDCRKYLTPSSLVAGN------PKLNLAFVAHLFNTHPGL 392          

HSP 2 Score: 69.707 bits (169), Expect = 2.401e-13
Identity = 68/264 (25.76%), Postives = 119/264 (45.08%), Query Frame = 3
Query:  396 EERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKG---FFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVM-NCEAYIYLLHQIAPEDKKSLLISP---EEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLF 1166
            E R ++ W+N+L     D+    +        ++D  KDGL+L +   K +P  +D + +NK  +       FK  EN   A++   + G  +V +   DI DG K + LGL+WQ++R  +        +  +  L   G  + D +       +++W   Q+ K    + IR+FK+  + N    + +L+ IAP      L++P   EE    N     A L +  A  L + +++  EDI       + R +L + FIA+L 
Sbjct:  413 EARVFTLWLNSL-----DVDPPVI-------SLFDDLKDGLILLQAYEKVMPGAVDFKHVNKRPASGAEISRFKALENTNYAVDLGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQLMRRNI--------SITMKTLSSSGRDMSDSQ-------ILKWAQDQVTKGGKNSTIRSFKDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYAN-----ARLAISIARKLGALIWLVPEDI------NEVRARLIITFIASLM 638          
BLAST of Plastin 3 vs. Ensembl Nematostella
Match: EDO40382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7E1])

HSP 1 Score: 233.032 bits (593), Expect = 3.859e-70
Identity = 141/369 (38.21%), Postives = 216/369 (58.54%), Query Frame = 3
Query:  123 ENGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELKNFEEILLVLKK--DSIINHVFTQMNLTQEKDDLKIYSKDENFE-SKHTVSSAEERGYSEWINTLLENDEDLKEKYLPF--TNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKK--------ADCPTR--IRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSL 1184
             NG+I    L   F   G E+   +++E+ +     +   ++ F+E + + KK  D     +F  +  T         + + + E +KH+ S  E+  +++WIN+ L+ DE +  KYLP   +  + D+Y+K KDG+LLCK+IN + P TIDERV+NK   LK  F   EN  L INSA +IGC +VN+G GD+++G KH++LG++WQVIR GL  +I L   P L  LL  GE+++ L  LSPE+LL+RWVNF L K         D   R  + NF +D+ + EAY  LL+QIAP+   S +  P+      D  ++AE +L+NA  +  + FV  +D+V+ N      +KLN+AF+ANLF+++P+L
Sbjct:   30 HNGHITVKELGAVFSAAGAEVPGYKVREVISEYDKDQNGTIE-FDEFVAMFKKVTDKYRGAIFKSLLSTNMGVKHSGGTSESSAEGTKHSHSKEEQVAFADWINSSLKEDESV-HKYLPIDASEDSSDLYEKVKDGILLCKMINLSAPGTIDERVINK-PPLK-VFTIHENQTLVINSALAIGCNLVNIGAGDLAEGKKHLVLGVLWQVIRIGLFSKITLTNVPGLARLLQEGETIEGLHHLSPEELLLRWVNFHLGKYYDGQNYPPDDSRRKVVHNFSDDIKDSEAYSILLYQIAPQ--SSGVDHPQSYYSTTDNSKKAEKMLRNAEKIGCRKFVRAKDVVSGN------QKLNMAFVANLFSTFPNL 386          

HSP 2 Score: 58.151 bits (139), Expect = 3.189e-9
Identity = 56/214 (26.17%), Postives = 97/214 (45.33%), Query Frame = 3
Query:  492 VYDKSKDGLLLCKLINKAVPNTID-ERVLN-----KGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQL---KKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            +Y    DG++L K+     P  +D E+ +N     K   + G  K  EN   A++        ++ +   DI +G +++ LGLIWQ++RA         Y   L A L P +  D +     E+ ++ WVN  L   KK     +   FK+ D+    A + L+  I+P+     LI+P+ +    D +  A+  +  A  + + V+   ED+V
Sbjct:  429 LYSDFFDGIILFKMFEHIRPGCVDWEKKVNPEGKCKNARMGGKVKCIENCNYAVDLGKQFNFSLIGIQGQDIHEGVQNLTLGLIWQMMRA---------YTYTLLARLSPDD--DHMT----EEKIVEWVNKTLQSKKKTHLINKGHGFKDPDISTSLAVLDLIDCISPKMINPALINPDPLSD-EDKLPNAQYAISMARKIGAVVYALPEDLV 626          
BLAST of Plastin 3 vs. Ensembl Nematostella
Match: EDO32484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX1])

HSP 1 Score: 219.935 bits (559), Expect = 1.155e-65
Identity = 126/295 (42.71%), Postives = 185/295 (62.71%), Query Frame = 3
Query:  372 SKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            ++H+++  E  G+++WIN+ L +DEDLKE         + +++  KDG+++CKLIN +VP+TIDER +N  +     +   EN  L +NSA +IGC +VN+G  D+ +G  H++LGL+WQVIR GL  +I +   P L  LL   E +DDL++L+PED+L+RW NFQL+ A    R+ NF  D+ + E Y  LL++IAP +   L I    + + +DP + AELVL NA  +  + FV  +D+V  N       KLNLAF+ NLFN++P L     E  +  IEET EEKT+RNW
Sbjct:   98 TRHSLTDDERIGFTDWINSCLGDDEDLKEA-------QDGLFNAVKDGVVMCKLINWSVPHTIDERAINMKKL--NVYTIHENQTLVLNSAMAIGCNIVNIGAEDLIEGKPHLVLGLMWQVIRIGLFAKITIQNCPGLVQLLHDHEELDDLRRLAPEDILLRWFNFQLEDAGHHRRVNNFSSDISDAENYSVLLNKIAPPE---LGIDTPHVSE-SDPTKLAELVLTNADKMACRKFVRAKDVVKGNA------KLNLAFVCNLFNTFPCL--EPVEHEMTDIEETREEKTFRNW 371          

HSP 2 Score: 62.7734 bits (151), Expect = 1.289e-10
Identity = 61/241 (25.31%), Postives = 109/241 (45.23%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKG--ESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EE+ +  WIN+L            PF    +++Y    DG++L +L ++  P  ++   +NK   + +    KK EN   AI+ A  +   +V VG  DI+DG K ++L L+WQ +RA             LT L    +     +K   E  ++ WVN +L  A   T I   K+ ++   +  + L+  I P+     +++  E  +  D    A+  +  A  + ++V+   ED+V
Sbjct:  362 TREEKTFRNWINSL---------GIKPFV---QNLYLDLDDGMILFQLFDQVQPGIVNYDKVNKPPFKKMGAKMKKLENCNYAISVADLLKFSLVGVGGKDINDGNKMLILALLWQTMRA-----------YTLTVL----QKCAGSEKPVTEAEIVVWVNEKLSSAGKATTITGMKDPEIKTSKCVLDLIDAIKPKAINYSMVNAGECQE--DAFLNAKYAISMARKVGARVYALPEDLV 573          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: lcp1 (plastin-2 [Source:NCBI gene;Acc:101162720])

HSP 1 Score: 234.187 bits (596), Expect = 1.708e-70
Identity = 150/384 (39.06%), Postives = 224/384 (58.33%), Query Frame = 3
Query:  123 ENGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVK-YLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP---EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            +NG+I    L   F+   L L    I+EI   L+     L  + F  ++  LK   +       +N  +    ++  SK     ++H+ S  E+  +  WIN  LE D D K   LP    ++D++    DG++LCK+IN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G +H++LGL+WQVI+ GL   I L  N  L ALL  GES++DL KLSPE+LL+RW N+ L++A C  +I NF  D+ + +AY  LL+Q+AP   E+  + +I     ++  + ++RAE +L  A  L+ + FV   D+V  N       KLNLAF+ANLFN YP+L++ +N+ +    I  ET EE+T+RNW
Sbjct:   25 KNGFITKDELNELFKAANLALPGYRIREIIQELTKTSNQLTFEEFTHVVHGLKSTEVAKTFRKAINKKEGICSVEGTSKQSG--TQHSYSEEEKVAFVNWINKALEKDPDCKH-VLPMDPDSDDLFTAMGDGIILCKMINLSVPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIELSRNEALIALLRDGESLEDLMKLSPEELLLRWANYHLEEAGC-GKINNFSSDIKDSKAYYNLLNQVAPKGDEEGIAAIIVDMSGIREKEDLKRAECMLDQADRLSCRQFVMPADVVRGN------PKLNLAFVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNW 396          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: ENSORLT00000047068.1 (plastin-3-like [Source:NCBI gene;Acc:101157305])

HSP 1 Score: 227.639 bits (579), Expect = 2.251e-68
Identity = 147/382 (38.48%), Postives = 209/382 (54.71%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVK--YLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKV---NDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            NGYI    L   F  VG  L   +I+E+   L   K   +    F  I   +K D +       +N  +    +   S+  +  ++H++S  E   ++ +INT L  D D    ++P       ++    DG+LLCKLIN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  H++LGL+WQ+I+ GL  +I L  N  + ALL  GES+D L KLSPE+LL+RWVNF LK       I NF  D+ + + Y +LL QIAP+  K  +   E  M      D  +RAEL+L+ A  L  + FVT  D+V  N       KLNLAF+A LFN +P+L          + +E+ EE+T+RNW
Sbjct:   25 NGYICAKELGDLFREVGCPLPGYQIRELLQKLDRDKDSRISFDEFTTIFKEMKDDRMAQGFRKALNKKEGIVAIGGTSEISSEGTQHSISEQERFAFTNYINTALGEDPDCSH-FVPINPNTGALFKAVADGILLCKLINLSVPDTIDERTINKKKLTP--FTTQENLNLALNSASAIGCQVVNIGAQDLKEGKPHLVLGLLWQIIKIGLFAKIQLSRNKAIAALLQDGESLDVLMKLSPEELLLRWVNFHLKTVG--MSITNFSADIKDSKVYFHLLEQIAPDGSKEDVPRVEIDMTGLYEKDLKKRAELMLQQAERLGCREFVTATDVVTGNA------KLNLAFVATLFNKHPAL-TKPENQEWIVEDESREERTFRNW 394          

HSP 2 Score: 55.8398 bits (133), Expect = 4.869e-8
Identity = 61/213 (28.64%), Postives = 93/213 (43.66%), Query Frame = 3
Query:  351 SKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLN---KGESLKGFFKKQENLVLAIN-SAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIY-LLHQIAPE 971
            +K EN E      S EER +  W+N+L            P  +    +Y   +D +++ +L  K  V    + RV +   KG    G  KK EN   A+       G  +V +G  D+ DG + + L L+WQ++R          Y  NL   L  GE   D       DL+I WVN  L +AD  + I++FK+  ++    +  L+  I PE
Sbjct:  372 TKPENQEWIVEDESREERTFRNWMNSL---------GVTPHVHY---IYGDLQDAMVILQLYEKIKVKVDWNNRVNHPPFKGVG-GGHLKKIENCNYAVELGKQKAGFSLVGIGGQDLYDGNEMLTLALMWQLMRR---------YTLNLLEDLGHGEVAGD-------DLIISWVNKTLAEADKSSSIKSFKDKSISTSLPVLDLIDAIQPE 555          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: ENSORLT00000011106.2 (plastin-3-like [Source:NCBI gene;Acc:101157305])

HSP 1 Score: 228.024 bits (580), Expect = 3.721e-68
Identity = 147/382 (38.48%), Postives = 209/382 (54.71%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVK--YLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKV---NDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            NGYI    L   F  VG  L   +I+E+   L   K   +    F  I   +K D +       +N  +    +   S+  +  ++H++S  E   ++ +INT L  D D    ++P       ++    DG+LLCKLIN +VP+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  H++LGL+WQ+I+ GL  +I L  N  + ALL  GES+D L KLSPE+LL+RWVNF LK       I NF  D+ + + Y +LL QIAP+  K  +   E  M      D  +RAEL+L+ A  L  + FVT  D+V  N       KLNLAF+A LFN +P+L          + +E+ EE+T+RNW
Sbjct:   25 NGYICAKELGDLFREVGCPLPGYQIRELLQKLDRDKDSRISFDEFTTIFKEMKDDRMAQGFRKALNKKEGIVAIGGTSEISSEGTQHSISEQERFAFTNYINTALGEDPDCSH-FVPINPNTGALFKAVADGILLCKLINLSVPDTIDERTINKKKLTP--FTTQENLNLALNSASAIGCQVVNIGAQDLKEGKPHLVLGLLWQIIKIGLFAKIQLSRNKAIAALLQDGESLDVLMKLSPEELLLRWVNFHLKTVG--MSITNFSADIKDSKVYFHLLEQIAPDGSKEDVPRVEIDMTGLYEKDLKKRAELMLQQAERLGCREFVTATDVVTGNA------KLNLAFVATLFNKHPAL-TKPENQEWIVEDESREERTFRNW 394          

HSP 2 Score: 60.4622 bits (145), Expect = 1.591e-9
Identity = 70/257 (27.24%), Postives = 111/257 (43.19%), Query Frame = 3
Query:  351 SKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLN---KGESLKGFFKKQENLVLAIN-SAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIY-LLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            +K EN E      S EER +  W+N+L            P  +    +Y   +D +++ +L  K  V    + RV +   KG    G  KK EN   A+       G  +V +G  D+ DG + + L L+WQ++R          Y  NL   L  GE   D       DL+I WVN  L +AD  + I++FK+  ++    +  L+  I PE     L+  +      D +  A+  +  A  + +KV+   ED+V
Sbjct:  372 TKPENQEWIVEDESREERTFRNWMNSL---------GVTPHVHY---IYGDLQDAMVILQLYEKIKVKVDWNNRVNHPPFKGVG-GGHLKKIENCNYAVELGKQKAGFSLVGIGGQDLYDGNEMLTLALMWQLMRR---------YTLNLLEDLGHGEVAGD-------DLIISWVNKTLAEADKSSSIKSFKDKSISTSLPVLDLIDAIQPESVNFELVKRDAESNA-DKLDNAKYAVSMARKIGAKVYALPEDLV 598          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: pls3 (plastin-3 [Source:NCBI gene;Acc:101161915])

HSP 1 Score: 225.328 bits (573), Expect = 1.783e-67
Identity = 148/390 (37.95%), Postives = 225/390 (57.69%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELKNFEEILLVLK--KDSIINHVFTQMNLTQEKDDLKIYSKDE--NFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NG+I    L    +  G  L    ++EI   L   K  ++ +F+E L ++K  + S +   F +  + +++  L I    E  +  ++H+ S  E   +  WINT LE D D +   LP     + ++    DG++LCK+IN + P+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  H++LGL+WQ+I+ GL   I L  N  L ALL  GE+++DL KLSPE+LL+RW N+ L+ A    +I NF  D+ + +AY +LL+QI+P+ K       +  + +N       D ++RAE +L+ A  L  + FVT  D+VN N       KLNLAF+ANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   25 NGFISDYELSELLKEAGHPLPGYRVREILQELDRNKDNQI-SFDEFLAIVKELRGSQVAKTFRKA-INRKEGILAIGGTSELSSVGTQHSFSEEERFAFVNWINTALEKDPDCQH-VLPMNPNTDSLFTSVGDGIVLCKMINLSAPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGALDLKEGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANYHLENAGY-KKINNFSSDIKDSKAYFHLLNQISPKGKD----EGQPCIDINMAGFNEKDDLKRAEAMLQQADRLGCRQFVTPTDVVNGN------PKLNLAFVANLFNKYPALTKPENQDIDWGLLEGETREERTFRNW 398          

HSP 2 Score: 56.6102 bits (135), Expect = 3.064e-8
Identity = 53/197 (26.90%), Postives = 91/197 (46.19%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAP 968
            + EER +  W+N+L  N         P  N    +Y   +D L++ +L  K  +P   + +V NK     L    KK EN   A+    S    +V +G  D++DG   + L ++WQ++R          Y  N+   L  G+ V+D       D++++WVN  L  A+  T+I +FK+ ++    + + L+  I P
Sbjct:  389 TREERTFRNWMNSLGVN---------PHVNH---LYGDLQDALVILQLYEKIKIPVDWNNKV-NKPPYPKLGTNMKKLENCNYAVELGRSAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRR---------YTLNVLEDLGDGDKVND-------DIIVKWVNKTLADAEKSTKISSFKDKEISTSLSVLELIDAIQP 556          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: pls3 (plastin-3 [Source:NCBI gene;Acc:101161915])

HSP 1 Score: 225.328 bits (573), Expect = 4.609e-67
Identity = 148/390 (37.95%), Postives = 225/390 (57.69%), Query Frame = 3
Query:  126 NGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELKNFEEILLVLK--KDSIINHVFTQMNLTQEKDDLKIYSKDE--NFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVN-------DPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXX--XXXXXXXXXXKTYRNW 1256
            NG+I    L    +  G  L    ++EI   L   K  ++ +F+E L ++K  + S +   F +  + +++  L I    E  +  ++H+ S  E   +  WINT LE D D +   LP     + ++    DG++LCK+IN + P+TIDER +NK +     F  QENL LA+NSA++IGC VVN+G  D+ +G  H++LGL+WQ+I+ GL   I L  N  L ALL  GE+++DL KLSPE+LL+RW N+ L+ A    +I NF  D+ + +AY +LL+QI+P+ K       +  + +N       D ++RAE +L+ A  L  + FVT  D+VN N       KLNLAF+ANLFN YP+L + +N+ +    +  ET EE+T+RNW
Sbjct:   25 NGFISDYELSELLKEAGHPLPGYRVREILQELDRNKDNQI-SFDEFLAIVKELRGSQVAKTFRKA-INRKEGILAIGGTSELSSVGTQHSFSEEERFAFVNWINTALEKDPDCQH-VLPMNPNTDSLFTSVGDGIVLCKMINLSAPDTIDERTINKKKLTP--FTIQENLNLALNSASAIGCHVVNIGALDLKEGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANYHLENAGY-KKINNFSSDIKDSKAYFHLLNQISPKGKD----EGQPCIDINMAGFNEKDDLKRAEAMLQQADRLGCRQFVTPTDVVNGN------PKLNLAFVANLFNKYPALTKPENQDIDWGLLEGETREERTFRNW 398          

HSP 2 Score: 63.5438 bits (153), Expect = 1.978e-10
Identity = 62/242 (25.62%), Postives = 110/242 (45.45%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINK-AVPNTIDERVLNKGE--SLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIV 1103
            + EER +  W+N+L  N         P  N    +Y   +D L++ +L  K  +P   + +V NK     L    KK EN   A+    S    +V +G  D++DG   + L ++WQ++R          Y  N+   L  G+ V+D       D++++WVN  L  A+  T+I +FK+ ++    + + L+  I P      LI    +    D ++ A+  +  A  + ++V+   ED+V
Sbjct:  389 TREERTFRNWMNSLGVN---------PHVN---HLYGDLQDALVILQLYEKIKIPVDWNNKV-NKPPYPKLGTNMKKLENCNYAVELGRSAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRR---------YTLNVLEDLGDGDKVND-------DIIVKWVNKTLADAEKSTKISSFKDKEISTSLSVLELIDAIQPGSVNYELIKTSSLSDA-DKLENAKYAISMARKIGARVYALPEDLV 600          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000007726.1 (SMESG000007726.1)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 391/392 (99.74%), Postives = 391/392 (99.74%), Query Frame = 3
Query:   81 ELINELNSRIPEYGENGYIYTTSLRTAFEIVGLELSEQEIKEIENSLSSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            ELINELNSRIPEYGENGYIYTTSLRTAFEIVGLELSE EIKEIENSLSSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLEEIKNEIVIEIIEETLEEKTYRNW
Sbjct:    5 ELINELNSRIPEYGENGYIYTTSLRTAFEIVGLELSEPEIKEIENSLSSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLEEIKNEIVIEIIEETLEEKTYRNW 396          

HSP 2 Score: 50.447 bits (119), Expect = 1.724e-6
Identity = 53/216 (24.54%), Postives = 96/216 (44.44%), Query Frame = 3
Query:  471 FTNMNEDVYDKSKDGLLLCKLINKAVPNTID-ERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNA-------TTLNSKVFVTI 1091
             T +N   YD + DGL+   + +K  P  ++  +V+   +S +  F++Q N    I +       + N+   +I +  K  +LGL +Q++R   +          L  L   G+ +DD         +I WVN  L+KA   +RI +FK+ ++      I L+  I P   +  LIS + +   +  +  A  +  NA        +LN K+ +T+
Sbjct:  403 LTQVNTFYYDTT-DGLVFLYIFDKLNPGCVNWSKVVRNFDSKRRLFQEQGNCNEVIEAGKKCNLKIQNMSGENIRNRDKVYILGLCFQMMRYNTIKV--------LEKLCGGGKKIDDKD-------IISWVNDTLEKAGKTSRITSFKDRNIATSLPVIDLVDAIKPGSVQYSLISSDRLKDASYAVSMARKIGANAFVLPDHIASLNQKMIMTL 602          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000081113.1 (SMESG000081113.1)

HSP 1 Score: 348.977 bits (894), Expect = 8.926e-115
Identity = 190/395 (48.10%), Postives = 276/395 (69.87%), Query Frame = 3
Query:   81 ELINELNSRIPEYGENGYIYTTSLRTAFEIVGLELSEQEIKE-IENSLSSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDE--NFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            E +NEL+   P   ++ +I  ++++ A +++G  L   E +E I++   ++  + ++ F  +   +K+   I   F Q  + +E+ D+K  +KD+  +  +KHTV  +EERG+S WI+ +L  D  L   YLP  +  +++Y+K +DG+LLCKLIN AVP+T+DERV+N G SLK  FKK ENL LA+NSA +IGCC+VN+GP DI  GTKH++LGL+WQVIR GLLG +NL+++  L ALL   E++DDLK+L+PE+LL+RWVN+ L+KA    RI NFKED+ + E Y +LL+QIAP DK+  ++ P  I+K  D ++RAEL+L NA+ L+++VF+  ED+     RG+NREKLNLAF+ANLFN+YP+L     +  IEI EETLEEKTYRNW
Sbjct:   15 ETLNELHDLFPSL-KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDP-LCAPYLPIKH--DELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPAL---IVDSDIEIREETLEEKTYRNW 402          

HSP 2 Score: 55.4546 bits (132), Expect = 5.444e-8
Identity = 54/243 (22.22%), Postives = 115/243 (47.33%), Query Frame = 3
Query:  390 SAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTID-ERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNAN 1112
            + EE+ Y  W+N++            P+    +D+Y   K+GL+L +LI+   P  ++ ++++   +  K  F+   N    I  A  +   +VN+   +I D T +++LGL +Q++R+         Y   L + + PG+  D       +D +I W N + + A+  ++I +FK+  +   +  + L+  I P      L++       N+P+Q A+  +  A  + ++++   + +V+ N
Sbjct:  393 TLEEKTYRNWMNSM---------GVTPYV---KDIYSDLKNGLVLLQLIDLLQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRS---------YTMKLLSKVLPGKKDD-------KD-IIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLT-------NEPLQDAKFTISQARRIGARIYALPQHLVDVN 599          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000081126.1 (SMESG000081126.1)

HSP 1 Score: 333.569 bits (854), Expect = 7.838e-109
Identity = 190/395 (48.10%), Postives = 272/395 (68.86%), Query Frame = 3
Query:   81 ELINELNSRIPEYGENGYIYTTSLRTAFEIVGLELSEQEIKEIE-NSLSSVKYLELKNFEEILLVLKKDSI--INHVFTQMNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXXXXXXXXXXXKTYRNW 1256
            E+I ELN+R      NG+I   +++ A +I+G  L+  +++++  N  ++   + ++ F EI    K+  I  IN    ++   +E    K+    E  ++ HT+  +EERG+S WI+ +L  D  L   YLP  +  +++Y+K +DG+LLCKLIN AVP+T+DERV+N G SLK  FKK ENL LA+NSA +IGCC+VN+GP DI  GTKH++LGL+WQVIR GLLG +NL+++  L ALL   E++DDLK+L+PE+LL+RWVN+ L+KA    RI NFKED+ + E Y +LL+QIAP DK+  ++ P  I+K  D ++RAEL+L NA+ L+++VF+  ED+     RG+NREKLNLAF+ANLFN+YP+L     +  IEI EETLEEKTYRNW
Sbjct:   15 EIIVELNNRFLTLS-NGFIERKNIQEALKILGFSLAGYQLRDLMINIPTNHDEIPIEMFLEIYSKAKELKINPINSYQPKIKSDKENIPRKV---SEGTQAIHTICDSEERGFSNWISRVLSKDP-LCASYLPIKH--DELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPAL---IVDSDIEIREETLEEKTYRNW 399          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000070679.1 (SMESG000070679.1)

HSP 1 Score: 311.997 bits (798), Expect = 2.163e-101
Identity = 165/318 (51.89%), Postives = 226/318 (71.07%), Query Frame = 3
Query:  315 NLTQEKDDLKIYSK---DENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLXXXXXXXXX-XXXXXXXXXKTYRNW 1256
            N T  K  L + S     ++ ++   VS AEER YS+WIN  L N+E + +KYLP       +Y+   DG+LLCK+IN +VP+TID R +N G+ L+  F K ENL LA+ SA+SIGCCVVN+GP D+ +G KHI+LGL+WQ+IR GL+G+INL  +  L ALL  GES++DLK+LSPE++LIRWVN+ ++KA+   RI NF  D+M+ E Y YL++QIAP + +S ++ P EI++ ND +QRAE VL NA+ +N+K FV   DI     +GKNREKLN+AF+A+LFN+YP+L   +  I   +I+EETLEEKTYRNW
Sbjct:    5 NKTSRKPSLIVQSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEE-ICQKYLPIDY--NKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNW 319          

HSP 2 Score: 53.9138 bits (128), Expect = 1.425e-7
Identity = 72/326 (22.09%), Postives = 142/326 (43.56%), Query Frame = 3
Query:  186 SEQEIKEIENSLSSVKYLELKNFEE---ILLVLKKD--------SIINHVFTQ---MNLTQEKDDLKIYSKDENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTID-ERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKK-ADCPTRIRNFKE-DVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNAN 1112
            S   ++  EN LS+   +  K F E   I +V +K         + + H+F     +N+T+     K+  + +  E      + EE+ Y  W+N++        E YL +      +Y   ++G+ L  LI+   P T++ E V  K   ++  F+ Q+N +  IN A  +   +V +   +I +    ++LGL +Q++R          Y   L   L P    ++  K   +  +I W N + +      + IR+FK+ ++ + +  ++L+  I P        S +  M  N+P+  A+  +  A  + + V+   + +V+ N
Sbjct:  238 SNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITE-----KVIQEFDIVEE-----TLEEKTYRNWMNSMG------VEPYLNY------LYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRK---------YTFQLLQKLQP----NNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPN-------SVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLN 521          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000048251.1 (SMESG000048251.1)

HSP 1 Score: 192.971 bits (489), Expect = 5.729e-56
Identity = 94/261 (36.02%), Postives = 153/261 (58.62%), Query Frame = 3
Query:  393 AEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSY 1175
            +E+R YS WIN +L ND D ++ YLP     +D+YDK +DG++LCKL+N ++P  IDER +N+G+ L  + +K ENL L +N+A   GC + N    DI  G K+  +  IWQ+IR G L  +    +P +  L   G+S+DDL++ S  D++IR+ N+ L K+     + ++ +D  +C  Y +L +++AP   +  +ISP  I +      RA  +++N   L ++ F+T +DI+N   R  +  KL+L  I  LF  +
Sbjct:   16 SEKRAYSRWINKVLANDPDCRQ-YLPLDPYGDDIYDKVQDGVILCKLLNISLPGAIDERTMNRGQRLLNYAQKMENLALVLNAARCRGCSMGNADINDIYAGVKYATIDFIWQIIRIGFLHDVTFHNHPEIVELKKVGDSLDDLREQSSHDIIIRYANYHLSKSGMRNFVNDYDDDFKDCLVYAHLTYRVAPATIRGKMISPTNITRERCVEARARNIIRNLEELGAESFLTEDDIINGFERRDSCSKLHLCTIGYLFKHF 275          
The following BLAST results are available for this feature:
BLAST of Plastin 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LCP19.813e-7238.92lymphocyte cytosolic protein 1 [Source:HGNC Symbol... [more]
LCP19.813e-7238.92lymphocyte cytosolic protein 1 [Source:HGNC Symbol... [more]
PLS36.346e-6538.01plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
PLS36.346e-6538.01plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
PLS32.741e-6236.66plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
back to top
BLAST of Plastin 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
plst-15.030e-1943.38PLaSTin (Actin bundling protein) homolog [Source:... [more]
plst-19.711e-1941.73PLaSTin (Actin bundling protein) homolog [Source:... [more]
anc-11.045e-732.28Nuclear anchorage protein 1 [Source:UniProtKB/Swi... [more]
anc-12.973e-732.79Nuclear anchorage protein 1 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fim7.497e-7137.76gene:FBgn0024238 transcript:FBtr0074442[more]
Fim9.592e-7137.76gene:FBgn0024238 transcript:FBtr0074441[more]
Fim1.426e-7037.76gene:FBgn0024238 transcript:FBtr0074443[more]
cher6.430e-624.81gene:FBgn0014141 transcript:FBtr0337101[more]
cher8.276e-624.81gene:FBgn0014141 transcript:FBtr0303364[more]
back to top
BLAST of Plastin 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lcp11.665e-7238.76lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
pls35.676e-6838.40plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls35.676e-6838.40plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls12.589e-6636.76plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pls16.818e-6637.28plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
colgalt22.361e-6940.87collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.079e-6839.80collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.293e-6839.45collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.375e-6840.20collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.529e-6840.20collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lcp11.685e-7339.43lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Lcp11.685e-7339.43lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Lcp11.685e-7339.43lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Pls33.002e-6537.24plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
Pls33.726e-6537.24plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Plastin 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61233|PLSL_MOUSE1.179e-7239.43Plastin-2 OS=Mus musculus OX=10090 GN=Lcp1 PE=1 SV... [more]
sp|Q6P698|PLSL_DANRE1.231e-7138.76Plastin-2 OS=Danio rerio OX=7955 GN=lcp1 PE=2 SV=1[more]
sp|P13796|PLSL_HUMAN4.713e-7138.92Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=... [more]
sp|P54680|FIMB_DICDI2.828e-6738.10Fimbrin OS=Dictyostelium discoideum OX=44689 GN=fi... [more]
sp|A6H742|PLSI_BOVIN1.987e-6536.76Plastin-1 OS=Bos taurus OX=9913 GN=PLS1 PE=2 SV=1[more]
back to top
BLAST of Plastin 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JAL87.862e-10345.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GSA32.178e-10245.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0R3WQZ82.264e-10246.75Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A564YG167.450e-10246.25Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A1I8JCX63.917e-10045.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lcp11.806e-7038.14lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
pls31.224e-5040.52plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls11.277e-3533.12plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lcp15.378e-1125.31lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAC63.347e-6138.74Fimbrin, actin-bundling protein; cooperates with S... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO403823.859e-7038.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324841.155e-6542.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lcp11.708e-7039.06plastin-2 [Source:NCBI gene;Acc:101162720][more]
ENSORLT00000047068.12.251e-6838.48plastin-3-like [Source:NCBI gene;Acc:101157305][more]
ENSORLT00000011106.23.721e-6838.48plastin-3-like [Source:NCBI gene;Acc:101157305][more]
pls31.783e-6737.95plastin-3 [Source:NCBI gene;Acc:101161915][more]
pls34.609e-6737.95plastin-3 [Source:NCBI gene;Acc:101161915][more]
back to top
BLAST of Plastin 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007726.11.724e-699.74SMESG000007726.1[more]
SMESG000081113.18.926e-11548.10SMESG000081113.1[more]
SMESG000081126.17.838e-10948.10SMESG000081126.1[more]
SMESG000070679.12.163e-10151.89SMESG000070679.1[more]
SMESG000048251.15.729e-5636.02SMESG000048251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001402 ID=SMED30001402|Name=Plastin 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1256bp
CTGAATATGCATCATTGACAATAGATGTATAAATTGACTTAATTATCGGC
CTAATTATCATTTTCCTTATGTTACCATTAGAACTTATTAACGAACTAAA
CAGCCGAATACCCGAATATGGTGAAAATGGCTACATTTATACAACTTCAC
TTCGAACGGCTTTTGAAATCGTCGGATTAGAACTGTCGGAACAAGAAATT
AAAGAAATTGAAAACTCATTGTCATCGGTAAAGTATTTGGAATTGAAAAA
CTTTGAAGAAATTTTGTTGGTTTTGAAAAAGGATTCGATAATAAATCATG
TTTTTACACAAATGAATTTGACTCAGGAAAAGGATGACTTGAAGATTTAT
TCAAAAGATGAAAATTTTGAATCGAAACATACAGTAAGTTCGGCTGAAGA
AAGAGGTTATTCAGAATGGATTAACACACTTTTGGAAAACGACGAAGATT
TAAAAGAAAAATATTTGCCATTCACCAATATGAACGAAGATGTATATGAT
AAATCTAAGGATGGTTTACTGCTATGCAAACTAATTAATAAGGCTGTTCC
GAATACTATAGATGAAAGAGTCTTAAATAAAGGTGAATCGTTAAAAGGTT
TTTTTAAAAAACAAGAGAATCTAGTTTTGGCTATTAATTCTGCTGCTTCA
ATTGGTTGTTGTGTAGTAAATGTCGGTCCTGGTGACATCAGTGACGGAAC
AAAGCATATTATGCTGGGATTAATTTGGCAGGTAATCAGAGCCGGTCTTT
TGGGTCAAATAAACTTGGTTTATAATCCAAATTTGACTGCTCTTTTATTT
CCAGGTGAGTCTGTGGATGATCTTAAAAAACTATCACCAGAAGATTTATT
AATAAGATGGGTAAATTTCCAATTAAAGAAAGCTGATTGTCCAACAAGGA
TCCGAAATTTTAAAGAAGATGTAATGAATTGTGAAGCTTACATATATCTT
TTGCATCAAATTGCTCCAGAAGATAAAAAGTCTTTATTGATTTCCCCGGA
AGAGATCATGAAAGTCAATGATCCAATTCAACGAGCAGAGCTCGTCTTGA
AAAATGCAACAACTCTGAACTCAAAGGTCTTTGTAACTATCGAAGATATT
GTTAATGCAAATGTCAGAGGAAAAAATCGTGAGAAACTCAATTTAGCGTT
CATTGCTAATTTATTTAATAGTTATCCCTCATTAGAGGAAATAAAAAATG
AAATAGTAATTGAGATAATTGAAGAAACATTGGAAGAAAAAACATACAGA
AATTGG
back to top

protein sequence of SMED30001402-orf-1

>SMED30001402-orf-1 ID=SMED30001402-orf-1|Name=SMED30001402-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=396bp
MLPLELINELNSRIPEYGENGYIYTTSLRTAFEIVGLELSEQEIKEIENS
LSSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDENF
ESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGL
LLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVV
NVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVD
DLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAP
EDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVR
GKNREKLNLAFIANLFNSYPSLEEIKNEIVIEIIEETLEEKTYRNW
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0005515protein binding
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0051017actin filament bundle assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR039959Fimbrin/Plastin
IPR001715CH-domain
IPR001589Actinin_actin-bd_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 110..225
e-value: 2.2E-21
score: 87.0
coord: 257..368
e-value: 3.2E-9
score: 46.6
IPR001715Calponin homology domainPFAMPF00307CHcoord: 110..225
e-value: 2.3E-17
score: 63.1
coord: 256..370
e-value: 9.8E-14
score: 51.5
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 255..370
score: 17.118
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 108..227
score: 19.784
IPR001715Calponin homology domainCDDcd00014CHcoord: 110..227
e-value: 4.6416E-18
score: 76.9659
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 230..366
e-value: 6.1E-33
score: 115.6
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 99..229
e-value: 5.3E-34
score: 118.8
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 107..396
NoneNo IPR availablePANTHERPTHR19961:SF18FI19014P1coord: 20..396
IPR039959Fimbrin/PlastinPANTHERPTHR19961FIMBRIN/PLASTINcoord: 20..396
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00020ACTININ_2coord: 199..223