SMED30001401

Overview
NameSMED30001401
Smed IDSMED30001401
Length (bp)1266
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30001401 (SMED30001401) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30001401 (SMED30001401) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001401 (SMED30001401) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001401 (SMED30001401) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001401

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Category 3 cellSMED30001401SMESG000059904.1 SMESG000042945.1 SMESG000007620.1 SMESG000072638.1 SMESG000039380.1 SMESG000042352.1 SMESG000028417.1 dd_Smed_v6_10138_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30001401 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000304:69760..71026 +5625
v31.000058:76206..77466 -5620
v31.000117:43513..44777 +5574
v31.004926:42533..43799 -5447
v31.000853:17663..18927 -5420
v31.000472:42081..43343 +5419
v31.000285:45890..47157 -5410
v31.000188:68773..70032 -5397
v31.010902:14424..15685 -5393
v31.012867:5574..6837 -5367
v31.012445:10153..11414 -5366
v31.000191:14686..15949 +5364
v31.000674:101618..102886 -5363
v31.007979:16318..17581 +5362
v31.009954:19375..20634 -5361
v31.014719:1416..2680 +5358
v31.018792:5356..6621 -5351
v31.020056:9850..11112 +5348
v31.003729:39076..40336 -5348
v31.004701:22493..23756 +5345
v31.028845:2963..4225 +5341
v31.003526:35978..37238 +5340
v31.008498:40447..41711 -5338
v31.014204:11236..12499 +5335
v31.003409:4508..5768 -5334
v31.002968:10003..11264 -5330
v31.000078:37832..39094 +5330
v31.003288:32299..33558 -5329
v31.007231:15172..16436 -5328
v31.004835:45536..46796 +5322
v31.000135:39575..40838 -5320
v31.012391:3242..4511 +5319
v31.031447:3326..4587 +5317
v31.012607:1976..3238 +5316
v31.008729:7927..9187 +5313
v31.008498:10973..12234 -5313
v31.000633:19609..20879 +5312
v31.001520:83144..84407 -5310
v31.029034:4870..6128 -5307
v31.013498:5532..6793 -5305
v31.017345:5489..6751 -5300
v31.007277:3611..4878 +5298
v31.004231:40469..41730 -5292
v31.001366:20219..21485 +5292
v31.018063:6646..7911 +5291
v31.007277:31032..32306 +5289
v31.000189:141083..142345 -5284
v31.004575:27741..29005 -5277
v31.022387:5344..6612 -5272
v31.003828:11605..12867 -5269
v31.000836:91698..92965 -5269
v31.000611:109240..110499 +5268
v31.003464:46829..48104 +5266
v31.000015:375218..376486 +5266
v31.005470:4080..5341 +5263
v31.024842:7810..9077 -5260
v31.003942:52614..53881 -5259
v31.013506:398..1667 -5258
v31.000300:43783..45042 -5258
v31.004647:43687..44949 -5248
v31.004377:28636..31269 -5246
v31.000094:202953..204227 -5243
v31.007465:4149..5413 +5241
v31.004574:41244..42512 -5241
v31.001180:11283..12552 -5240
v31.001054:100128..101393 -5240
v31.004432:31323..32592 +5233
v31.000065:109474..111168 +5233
v31.001037:64249..65519 +5226
v31.025002:7090..8359 +5225
v31.004662:31959..33225 +5222
v31.004660:33658..34921 +5221
v31.000198:179966..181239 +5221
v31.003272:15471..16728 -5217
v31.003521:19897..21166 -5216
v31.028218:3170..4440 -5214
v31.001568:71081..72341 +5214
v31.007236:13443..14708 +5213
v31.000817:62648..63914 -5213
v31.001865:53650..54921 -5212
v31.033907:390..1656 +5211
v31.012681:11733..12997 -5207
v31.002887:49866..51127 +5207
v31.014907:1808..3074 -5203
v31.000038:226871..228142 +5203
v31.001756:50114..51388 +5200
v31.001614:58642..59910 -5200
v31.000826:119791..121056 -5199
v31.001771:27405..28678 -5198
v31.000396:103319..104580 +5193
v31.000138:104512..105781 +5193
v31.000134:87234..88497 +5193
v31.000065:142205..143466 +5191
v31.000110:186521..187784 +5185
v31.016740:1037..2307 +5183
v31.003825:34861..36132 -5178
v31.001314:147298..148563 -5177
v31.000466:119743..121005 +5176
v31.003912:22468..23737 -5175
v31.000956:41064..42328 +5169
v31.017970:3427..4700 -5168
v31.002586:28432..29694 +5167
v31.000594:71377..72648 +5166
v31.010420:6777..8044 -5165
v31.004335:4627..5894 -5163
v31.000573:138125..139385 +5163
v31.001943:53111..54379 +5162
v31.000487:21049..22321 +5162
v31.001246:9523..10774 +5161
v31.000640:23767..25023 -5161
v31.000216:62948..64218 +5161
v31.010444:17095..18353 -5160
v31.031901:354..1619 -5158
v31.000133:109448..110714 -5157
v31.003804:16761..18037 -5153
v31.010677:16815..18084 -5152
v31.000555:142845..144110 +5148
v31.023531:5400..6670 +5144
v31.003219:34477..35741 +5144
v31.015694:9246..10510 -5138
v31.005446:2629..3896 +5138
v31.000065:105088..106349 +5137
v31.000306:176898..178099 -5130
v31.008684:248..1517 +5127
v31.000535:54376..55643 -5127
v31.010469:9086..10360 +5126
v31.001405:119448..120715 -5126
v31.000255:48171..49432 +5126
v31.005875:14020..15284 -5124
v31.006579:6421..7693 -5123
v31.004409:16740..18010 -5123
v31.000634:65584..66849 +5123
v31.005252:11729..13000 -5121
v31.003631:26309..27574 -5117
v31.007207:12757..14017 -5116
v31.002126:65388..66649 -5116
v31.007177:2337..3599 -5115
v31.010122:27329..28596 +5114
v31.002820:42352..43619 -5114
v31.000522:106455..107727 +5112
v31.035878:809..2068 -5111
v31.034639:1001..2260 -5111
v31.000052:118410..119677 -5108
v31.004448:37449..38710 -5107
v31.001381:106615..107881 -5105
v31.012987:14190..15439 +5099
v31.000046:109636..110900 -5099
v31.000166:45424..46685 -5098
v31.002647:81954..83221 +5097
v31.001848:12169..13439 +5088
v31.001209:93256..94525 +5085
v31.014358:10018..11289 -5082
v31.015719:225..1490 +5081
v31.000808:44949..46215 -5081
v31.000012:231056..232314 +5075
v31.004925:37188..38455 -5073
v31.000149:126389..127662 -5073
v31.004302:52504..53766 -5068
v31.012297:10516..11787 -5067
v31.000364:83526..84794 +5067
v31.001150:51746..53011 +5057
v31.000304:141981..143252 +5049
v31.005132:17943..19195 -5047
v31.001223:33333..34593 +5042
v31.002242:2984..4245 +5039
v31.002142:87677..88941 +5037
v31.020450:3033..4295 -5036
v31.007385:8528..9798 -5035
v31.012918:1211..2482 -5032
v31.013153:7901..9166 -5027
v31.011223:4263..5532 -5024
v31.013702:11429..12692 +5013
v31.014273:8972..10237 -5012
v31.000290:139495..140755 +5006
v31.006337:7204..8459 +5005
v31.000369:129974..131239 +5003
v31.017391:3262..4526 -5001
v31.006550:21164..22440 +5001
v31.011260:4532..5793 -4995
v31.001876:65043..66318 -4993
v31.001471:23836..25103 -4981
v31.006207:12357..13625 +4976
v31.003045:73984..75236 +4974
v31.021037:2510..3772 -4970
v31.007016:40239..41497 -4970
v31.016412:6417..7682 -4967
v31.001981:60492..61756 +4967
v31.000213:164258..165497 +4965
v31.014849:4057..5324 -4960
v31.014850:9847..11110 +4959
v31.003831:27888..29152 +4954
v31.001039:111455..112718 +4939
v31.000478:106539..107809 +4926
v31.022787:8659..9852 -4916
v31.006806:25698..26965 -4910
v31.000084:26278..27543 +4907
v31.005918:8425..9685 -4906
v31.022979:7630..8861 -4904
v31.007422:9112..10372 +4904
v31.021666:6181..7429 -4869
v31.015669:7877..9144 -4867
v31.010865:13345..14601 +4865
v31.001621:39378..40644 -4846
v31.005907:35717..36927 -4839
v31.002666:11336..12603 -4798
v31.000417:43419..44683 -4755
v31.001023:58661..59822 +4747
v31.016554:9027..10294 +4746
v31.001750:58643..59853 -4737
v31.001811:44548..45720 +4732
v31.004438:33578..34840 +4719
v31.009413:27398..28608 -4716
v31.007188:15284..16552 +4716
v31.001213:3438..4648 +4716
v31.002330:40179..41388 -4715
v31.003185:30652..31923 -4711
v31.002613:10967..12177 +4707
v31.010321:9137..10347 -4703
v31.024573:6786..8053 -4690
v31.004052:8938..10192 +4682
v31.001263:79173..80364 -4676
v31.014683:9157..10367 +4671
v31.009317:11007..12217 +4671
v31.010154:10106..11321 -4655
v31.014144:15611..16874 +4653
v31.002539:28563..29771 +4649
v31.013603:12011..13254 +4627
v31.020465:12533..13801 +4615
v31.000522:51790..52984 -4599
v31.000077:279728..285573 -4578
v31.006810:27470..28674 -4545
v31.000588:121555..122751 +4534
v31.003637:7419..8629 +4503
v31.006816:21375..22627 +4473
v31.008415:5968..7163 -4451
v31.002681:61486..62660 +4443
v31.039011:2858..3901 -4403
v31.000354:64384..65408 +4238
v31.014915:14910..16106 -4136
v31.016338:15607..16803 -4127
v31.022702:3667..4732 +4126
v31.000610:69945..71143 +4106
v31.002508:54987..56183 -4104
v31.002372:53016..54212 +4095
v31.016907:11257..12465 -4086
v31.006285:4079..5120 +4017
v31.001665:31463..32658 -3981
v31.003450:52944..54139 +3861
v31.006678:12049..13246 +3855
v31.006139:3453..4704 +3457
v31.000650:116211..117406 +3427
v31.003024:11526..12605 -3280
v31.002625:3646..4895 -3150
v31.000633:23408..24606 -2884
Homology
BLAST of SMED30001401 vs. Planmine SMEST
Match: SMESG000042945.1 (SMESG000042945.1)

HSP 1 Score: 487.263 bits (1253), Expect = 2.420e-172
Identity = 276/289 (95.50%), Postives = 280/289 (96.89%), Query Frame = 2
Query:  308 QENXXXXXXXXXXXRVSKIKIPILKMQPGYKIPKSSRKSDISALQLNHDLCQQKYNKLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPANHLPETTQAGPAQTPRTSKKHHPSKNXXXXXXXXAEGLTIXXXXXXXXXXXXXXXXXXHPEFVKEDDPTPTPKRSTESVLPTHAKETDEVRICLDISPVENSITTMRERSPTLASRWMDEFGEELCHTVPQVGTTPFQPLRNKRKFPVDIDE 1174
            QENLKKI PKILIKRVSKIKIP LKM PGYKIPKSSRKSD SALQLNHDLCQQKYNKLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPA HLPETTQAGPAQTPRTSKKHHPSKNRRRRERRRAEGLTILNNAAQVLEEAAALVAEQHPEFVK+DDP PTPKRSTE VLP H KETDE+++CLDISPVENSITTMRERSPTLASRWMDEFGEELCHTVPQVGTTPFQPLRNKRKFPVDIDE
Sbjct:   84 QENLKKILPKILIKRVSKIKIPFLKMHPGYKIPKSSRKSDTSALQLNHDLCQQKYNKLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPAGHLPETTQAGPAQTPRTSKKHHPSKNRRRRERRRAEGLTILNNAAQVLEEAAALVAEQHPEFVKDDDPAPTPKRSTEPVLPIHVKETDEMQMCLDISPVENSITTMRERSPTLASRWMDEFGEELCHTVPQVGTTPFQPLRNKRKFPVDIDE 372          
BLAST of SMED30001401 vs. Planmine SMEST
Match: SMESG000039380.1 (SMESG000039380.1)

HSP 1 Score: 427.172 bits (1097), Expect = 2.557e-150
Identity = 237/264 (89.77%), Postives = 243/264 (92.05%), Query Frame = 2
Query:  383 MQPGYKIPKSSRKSDISALQLNHDLCQQKYNKLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPANHLPETTQAGPAQTPRTSKKHHPSKNXXXXXXXXAEGLTIXXXXXXXXXXXXXXXXXXHPEFVKEDDPTPTPKRSTESVLPTHAKETDEVRICLDISPVENSITTMRERSPTLASRWMDEFGEELCHTVPQVGTTPFQPLRNKRKFPVDIDE 1174
            M  GYKIPKSSRKSD SALQL+HDLCQQKYNKLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPA+HLPE TQAGPAQT RTSKKHHPSKNRRRRERRRAEGLTILNNAAQVLEEAAALV EQHPEFV ED P   PK STE V+P   KETDE+ ICLDISPVENS TT +ERSPTL S WM+EFGEELCHTVPQVGTTPFQPLRNKRKFPVDIDE
Sbjct:    1 MHSGYKIPKSSRKSDTSALQLDHDLCQQKYNKLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPASHLPEPTQAGPAQTLRTSKKHHPSKNRRRRERRRAEGLTILNNAAQVLEEAAALVTEQHPEFVTEDVPASNPKGSTELVMPIQVKETDEIPICLDISPVENSTTTTKERSPTLTSCWMNEFGEELCHTVPQVGTTPFQPLRNKRKFPVDIDE 264          
BLAST of SMED30001401 vs. Planmine SMEST
Match: SMESG000072638.1 (SMESG000072638.1)

HSP 1 Score: 428.328 bits (1100), Expect = 6.383e-148
Identity = 237/260 (91.15%), Postives = 242/260 (93.08%), Query Frame = 2
Query:  395 YKIPKSSRKSDISALQLNHDLCQQKYNKLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPANHLPETTQAGPAQTPRTSKKHHPSKNXXXXXXXXAEGLTIXXXXXXXXXXXXXXXXXXHPEFVKEDDPTPTPKRSTESVLPTHAKETDEVRICLDISPVENSITTMRERSPTLASRWMDEFGEELCHTVPQVGTTPFQPLRNKRKFPVDIDE 1174
            YKIPKSSRKSD SA QL+HDLCQ+KYNKLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPANHLPE  QAGPAQ PRTSKKHHPSKNRRRRERRRAEGLTILNNAAQVLEEAAALVAEQHPEFV EDDP   PK STE V+P   KETDE +ICL ISPVENS TTM+ERSPTLAS WMDEFGEELCHTVPQVGTTPFQPLRNKRKFPVDIDE
Sbjct:  194 YKIPKSSRKSDTSASQLDHDLCQRKYNKLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPANHLPEIAQAGPAQIPRTSKKHHPSKNRRRRERRRAEGLTILNNAAQVLEEAAALVAEQHPEFVTEDDPASNPKGSTELVIPIQVKETDERQICLGISPVENSTTTMKERSPTLASCWMDEFGEELCHTVPQVGTTPFQPLRNKRKFPVDIDE 453          
BLAST of SMED30001401 vs. Planmine SMEST
Match: SMESG000059904.1 (SMESG000059904.1)

HSP 1 Score: 404.445 bits (1038), Expect = 4.341e-140
Identity = 225/246 (91.46%), Postives = 231/246 (93.90%), Query Frame = 2
Query:  437 LQLNHDLCQQKYNKLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPANHLPETTQAGPAQTPRTSKKHHPSKNXXXXXXXXAEGLTIXXXXXXXXXXXXXXXXXXHPEFVKEDDPTPTPKRSTESVLPTHAKETDEVRICLDISPVENSITTMRERSPTLASRWMDEFGEELCHTVPQVGTTPFQPLRNKRKFPVDIDE 1174
            LQLNHD CQQKYNKL AEHERTLGTWFAPEAVKILQDKIH LSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPANHLPETTQAGPAQTPRTSKKHHPSKNRRRRERRRAEGLTILNNAAQVLEEAAALVAEQHPEFVK+DD T T KRS E +LP H KETDE++ICLDISP+EN  TT +ERSPTLAS WMDEFGEELCHTVPQVGT PFQPLRNKRKFPVDIDE
Sbjct:  100 LQLNHDFCQQKYNKLFAEHERTLGTWFAPEAVKILQDKIHELSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPANHLPETTQAGPAQTPRTSKKHHPSKNRRRRERRRAEGLTILNNAAQVLEEAAALVAEQHPEFVKKDDTTLTLKRSKEHMLPIHVKETDEMQICLDISPIENPSTTTKERSPTLASCWMDEFGEELCHTVPQVGTIPFQPLRNKRKFPVDIDE 345          

HSP 2 Score: 112.849 bits (281), Expect = 1.115e-27
Identity = 56/88 (63.64%), Postives = 68/88 (77.27%), Query Frame = 2
Query:  524 EAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPANHLPETTQAGPAQTPRTSKKHHP 787
            E VK L  +IHRL+R R+DLI+ENRAQRIIINDQ  VL+ASFT+AEL KR+AGRDLA+KLNLIP  H+PE  + G A+ P+  K   P
Sbjct:   12 EFVKALHQQIHRLTRYRDDLISENRAQRIIINDQIPVLIASFTKAELTKRIAGRDLAVKLNLIPPTHIPEKNEVGQAKPPKPVKNATP 99          
BLAST of SMED30001401 vs. Planmine SMEST
Match: SMESG000042352.1 (SMESG000042352.1)

HSP 1 Score: 358.221 bits (918), Expect = 8.543e-119
Identity = 202/238 (84.87%), Postives = 212/238 (89.08%), Query Frame = 2
Query:  461 QQKYNKLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPANHLPETTQAGPAQTPRTSKKHHPSKNXXXXXXXXAEGLTIXXXXXXXXXXXXXXXXXXHPEFVKEDDPTPTPKRSTESVLPTHAKETDEVRICLDISPVENSITTMRERSPTLASRWMDEFGEELCHTVPQVGTTPFQPLRNKRKFPVDIDE 1174
            QQKYNKLLAEHERTLGTWFAPEAVKIL  KIHRL RCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDL LKLNLIPANHLPET QAGPAQTPRTSKKHHPSKNRRRRERRRAEGLT+LNNAAQVLEEAAALVAEQHPEFVK+DD  P P    ES L  +  ETDE++ICLD+  V NS T  +ERSPTL S W+D+FGEEL H+VPQVGTTPFQPLRNKRKFPVDIDE
Sbjct:  346 QQKYNKLLAEHERTLGTWFAPEAVKILHGKIHRLPRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAGRDLTLKLNLIPANHLPETNQAGPAQTPRTSKKHHPSKNRRRRERRRAEGLTMLNNAAQVLEEAAALVAEQHPEFVKKDDFIPNPANPVESALQIYTDETDEMQICLDVLTVNNSTTKTKERSPTLVSYWVDDFGEELHHSVPQVGTTPFQPLRNKRKFPVDIDE 583          
The following BLAST results are available for this feature:
BLAST of SMED30001401 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001401 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042945.12.420e-17295.50SMESG000042945.1[more]
SMESG000039380.12.557e-15089.77SMESG000039380.1[more]
SMESG000072638.16.383e-14891.15SMESG000072638.1[more]
SMESG000059904.14.341e-14091.46SMESG000059904.1[more]
SMESG000042352.18.543e-11984.87SMESG000042352.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001401 ID=SMED30001401|Name=SMED30001401|organism=Schmidtea mediterranea sexual|type=transcript|length=1266bp
TTTTCTCTTTAAATTTTTGTTTTTGTAAGCAGTATTCTTATCGAACATTT
CCAAATAAAAATTATTTTTCCATAAATTCAGCAAATGACTGGAGCATCAG
AATTTTTCTTTTCTGCATCGAATGTTTTGTTTTACTAGTTCTAATGCCAA
ATAGGACATCTGCACAATTAATATCAAACCATGAAATGAATGCAATAGAG
AATGTTGAGGAATGTTCGGACTAATTAATTTTAAATTTTATAATTATTAT
ATTTAATATATTTGCAAACATAACCCACTAATGAAATGAAACTCTCCCTC
GTTTAGTCAGGAAAATCTCAAGAAAATCCCTCCGAAAATTCTCATCAAAC
GTGTTTCCAAAATCAAAATTCCTATTCTAAAAATGCAACCAGGATACAAA
ATTCCCAAGTCATCGCGAAAATCAGATATCTCGGCATTACAATTAAATCA
CGATCTATGCCAACAAAAGTATAACAAACTGCTCGCGGAGCACGAACGCA
CACTCGGCACGTGGTTCGCTCCCGAAGCGGTCAAAATCCTCCAGGATAAA
ATCCACCGGCTGTCTAGATGCCGAGAGGATTTAATTGCAGAGAACCGGGC
TCAACGAATCATAATAAATGACCAGAGCGCCGTCTTGGTGGCATCATTCA
CGGAAGCCGAATTGGTAAAACGCCTCGCGGGTCGCGATCTGGCCTTAAAG
TTGAATTTGATCCCCGCGAACCATCTTCCGGAAACAACTCAAGCTGGTCC
AGCTCAGACACCCAGGACCAGCAAGAAGCACCATCCCAGCAAAAATCGTC
GTCGCCGTGAACGACGCCGAGCTGAAGGCCTCACAATTTTAAACAATGCT
GCACAAGTGCTCGAAGAAGCCGCCGCACTCGTCGCAGAACAGCACCCAGA
ATTTGTGAAAGAAGATGACCCCACTCCAACCCCGAAAAGATCAACAGAAT
CGGTGCTACCAACTCATGCGAAGGAAACTGATGAGGTGCGAATATGTCTA
GACATTTCACCCGTCGAAAATTCCATAACGACAATGAGAGAGAGATCGCC
GACTCTCGCGAGCCGCTGGATGGATGAATTCGGAGAAGAATTATGCCATA
CCGTTCCTCAGGTTGGAACTACCCCATTTCAACCCCTCCGGAACAAACGA
AAGTTCCCCGTCGATATCGACGAATGACTACCCAATGGGAAGAAGGACGG
ATTCCATTATCCTGATATTATTTATATATTTATGTACTGATTATATTTTT
GTGATTCCTTTTTGTT
back to top

protein sequence of SMED30001401-orf-1

>SMED30001401-orf-1 ID=SMED30001401-orf-1|Name=SMED30001401-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=265bp
MQPGYKIPKSSRKSDISALQLNHDLCQQKYNKLLAEHERTLGTWFAPEAV
KILQDKIHRLSRCREDLIAENRAQRIIINDQSAVLVASFTEAELVKRLAG
RDLALKLNLIPANHLPETTQAGPAQTPRTSKKHHPSKNRRRRERRRAEGL
TILNNAAQVLEEAAALVAEQHPEFVKEDDPTPTPKRSTESVLPTHAKETD
EVRICLDISPVENSITTMRERSPTLASRWMDEFGEELCHTVPQVGTTPFQ
PLRNKRKFPVDIDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell