DNA replication licensing factor MCM8

Overview
NameDNA replication licensing factor MCM8
Smed IDSMED30001391
Length (bp)2777
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA replication licensing factor MCM8 (SMED30001391) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA replication licensing factor MCM8 (SMED30001391) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA replication licensing factor MCM8 (SMED30001391) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA replication licensing factor MCM8 (SMED30001391) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001391

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30001391SMESG000004906.1 SmedASXL_005494SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30001391SMESG000004906.1 SmedASXL_009366SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30001391SMESG000004906.1 SmedASXL_009366SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30001391SMESG000004906.1 SmedASXL_005494SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
tail regionSMED30001391SMESG000004906.1 dd_Smed_v6_22244_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30001391SMESG000004906.1 dd_Smed_v4_22244_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001391SMESG000004906.1 SMED_26504_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30001391SMESG000004906.1 SMED_26504_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30001391SMESG000004906.1 SMED_11330_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30001391SMESG000004906.1 SMED_11330_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30001391SMESG000004906.1 SMED_07904_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30001391SMESG000004906.1 SMED_07904_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Human
Match: MCM8 (minichromosome maintenance 8 homologous recombination repair factor [Source:HGNC Symbol;Acc:HGNC:16147])

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 378/803 (47.07%), Postives = 531/803 (66.13%), Query Frame = 1
Query:  139 STKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN------------NISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGD-VKMDVDS-ENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGS--TFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            STK    ++++L    PY GW +YF  E Y ++S  + +I+AF  +F+   ++L   + IE K   ++D+ +L     +T +I +   E +   ++ +  M LA+H ++  +             +S+   + +   +I+ R+ N+ P+ +  N++AN  G +I+L+G VV+V+ +KP+C ++ F C  C   Q   LPD  K+++PT+C   VC+ +SF  L+ S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C L+ DLVD+CVPGD V +TGIV   +A      S      C+F L +  N+I   KG   K   D  ++    EFS+KDLYAI+ I +E NLFKL+V SLCP I+GHELVKA L LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+AC +APR VY+CG + TT+GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKAKTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ +M++   ++   E  S     ERL     E+ D IP QLLRKYI YA++YV+P+LS+EAA +LQ+FYL LRK+   ++ +PITTRQLES++RLTEA+AR ELRE A ++DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L   +ER+ ++ F +  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   58 STKTPQSMQSTLDRFIPYKGWKLYFS-EVYSDSSPLIEKIQAFEKFFT-RHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDG-KYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSD--------------DQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEG---SRNKNDKCMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELVKAGLALALFGGSQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTTSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEHHDHLLSEHVIAIRAGKQRTISSATVARMNSQDSNTSVLEVVSEKPLSERLKVVPGETIDPIPHQLLRKYIGYARQYVYPRLSTEAARVLQDFYLELRKQSQRLNSSPITTRQLESLIRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQT 839          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Human
Match: MCM8 (minichromosome maintenance 8 homologous recombination repair factor [Source:HGNC Symbol;Acc:HGNC:16147])

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 378/803 (47.07%), Postives = 531/803 (66.13%), Query Frame = 1
Query:  139 STKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN------------NISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGD-VKMDVDS-ENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGS--TFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            STK    ++++L    PY GW +YF  E Y ++S  + +I+AF  +F+   ++L   + IE K   ++D+ +L     +T +I +   E +   ++ +  M LA+H ++  +             +S+   + +   +I+ R+ N+ P+ +  N++AN  G +I+L+G VV+V+ +KP+C ++ F C  C   Q   LPD  K+++PT+C   VC+ +SF  L+ S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C L+ DLVD+CVPGD V +TGIV   +A      S      C+F L +  N+I   KG   K   D  ++    EFS+KDLYAI+ I +E NLFKL+V SLCP I+GHELVKA L LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+AC +APR VY+CG + TT+GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKAKTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ +M++   ++   E  S     ERL     E+ D IP QLLRKYI YA++YV+P+LS+EAA +LQ+FYL LRK+   ++ +PITTRQLES++RLTEA+AR ELRE A ++DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L   +ER+ ++ F +  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   58 STKTPQSMQSTLDRFIPYKGWKLYFS-EVYSDSSPLIEKIQAFEKFFT-RHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDG-KYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSD--------------DQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEG---SRNKNDKCMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELVKAGLALALFGGSQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTTSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEHHDHLLSEHVIAIRAGKQRTISSATVARMNSQDSNTSVLEVVSEKPLSERLKVVPGETIDPIPHQLLRKYIGYARQYVYPRLSTEAARVLQDFYLELRKQSQRLNSSPITTRQLESLIRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQT 839          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Human
Match: MCM8 (minichromosome maintenance 8 homologous recombination repair factor [Source:HGNC Symbol;Acc:HGNC:16147])

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 374/803 (46.58%), Postives = 525/803 (65.38%), Query Frame = 1
Query:  139 STKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN------------NISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGD-VKMDVDS-ENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGS--TFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            STK    ++++L    PY GW +YF  E Y ++S  + +I+AF  +F+   ++L   + IE K   ++D+ +L     +T +I +   E +   ++ +  M LA+H ++  +             +S+   + +   +I+ R+ N+ P+ +  N++AN  G +I+L+G VV+V+ +KP+C ++ F C  C   Q   LPD  K+++PT+C   VC+ +SF  L+ S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C L+ DLVD+CVPGD V +TGIV   +A                      N+I   KG   K   D  ++    EFS+KDLYAI+ I +E NLFKL+V SLCP I+GHELVKA L LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+AC +APR VY+CG + TT+GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKAKTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ +M++   ++   E  S     ERL     E+ D IP QLLRKYI YA++YV+P+LS+EAA +LQ+FYL LRK+   ++ +PITTRQLES++RLTEA+AR ELRE A ++DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L   +ER+ ++ F +  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   58 STKTPQSMQSTLDRFIPYKGWKLYFS-EVYSDSSPLIEKIQAFEKFFT-RHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDG-KYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSD--------------DQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAE-------------------EANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELVKAGLALALFGGSQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTTSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEHHDHLLSEHVIAIRAGKQRTISSATVARMNSQDSNTSVLEVVSEKPLSERLKVVPGETIDPIPHQLLRKYIGYARQYVYPRLSTEAARVLQDFYLELRKQSQRLNSSPITTRQLESLIRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQT 823          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Human
Match: AL035461.4 (novel protein)

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 365/786 (46.44%), Postives = 513/786 (65.27%), Query Frame = 1
Query:  139 STKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN------------NISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGD-VKMDVDS-ENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGS--TFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLN 2436
            STK    ++++L    PY GW +YF  E Y ++S  + +I+AF  +F+   ++L   + IE K   ++D+ +L     +T +I +   E +   ++ +  M LA+H ++  +             +S+   + +   +I+ R+ N+ P+ +  N++AN  G +I+L+G VV+V+ +KP+C ++ F C  C   Q   LPD  K+++PT+C   VC+ +SF  L+ S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C L+ DLVD+CVPGD V +TGIV   +A      S      C+F L +  N+I   KG   K   D  ++    EFS+KDLYAI+ I +E NLFKL+V SLCP I+GHELVKA L LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+AC +APR VY+CG + TT+GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKAKTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ +M++   ++   E  S     ERL     E+ D IP QLLRKYI YA++YV+P+LS+EAA +LQ+FYL LRK+   ++ +PITTRQLES++RLTEA+AR ELRE A ++DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L   +ER+ ++ F +  ++QIA   NI+  +   I N L+
Sbjct:   58 STKTPQSMQSTLDRFIPYKGWKLYFS-EVYSDSSPLIEKIQAFEKFFT-RHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDG-KYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSD--------------DQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEG---SRNKNDKCMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELVKAGLALALFGGSQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTTSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEHHDHLLSEHVIAIRAGKQRTISSATVARMNSQDSNTSVLEVVSEKPLSERLKVVPGETIDPIPHQLLRKYIGYARQYVYPRLSTEAARVLQDFYLELRKQSQRLNSSPITTRQLESLIRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQYENPWTIPNMLS 822          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Human
Match: MCM8 (minichromosome maintenance 8 homologous recombination repair factor [Source:HGNC Symbol;Acc:HGNC:16147])

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 376/843 (44.60%), Postives = 527/843 (62.51%), Query Frame = 1
Query:  139 STKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVF-----------ANNISSISNSDLPNI-YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGD-VKMDVDS-ENSYDAEFSVKDLYAIEAIHSEPNLFKLLVA---SLCP------SIYGH-------------------------------ELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGS--TFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            STK    ++++L    PY GW +YF  E Y ++S  + +I+AF  +F+   ++L   + IE K   ++D+ +L     +T +I +   E +   ++ +  M LA+H ++            A    S     + N+ +I+ R+ N+ P+ +  N++AN  G +I+L+G VV+V+ +KP+C ++ F C  C   Q   LPD  K+++PT+C   VC+ +SF  L+ S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C L+ DLVD+CVPGD V +TGIV   +A      S      C+F L +  N+I   KG   K   D  ++    EFS+KDLYAI+ I +E NLFKL+V    +L P      +I  H                                LVKA L LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+AC +APR VY+CG + TT+GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKAKTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ +M++   ++   E  S     ERL     E+ D IP QLLRKYI YA++YV+P+LS+EAA +LQ+FYL LRK+   ++ +PITTRQLES++RLTEA+AR ELRE A ++DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L   +ER+ ++ F +  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   58 STKTPQSMQSTLDRFIPYKGWKLYFS-EVYSDSSPLIEKIQAFEKFFT-RHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDG-KYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSD--------------DQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEG---SRNKNDKCMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVKWSLALSPRLEYSGAISAHCNLHLPSSNSSPTSACRVAGTTGMRHQTQLLLLVKAGLALALFGGSQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTTSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEHHDHLLSEHVIAIRAGKQRTISSATVARMNSQDSNTSVLEVVSEKPLSERLKVVPGETIDPIPHQLLRKYIGYARQYVYPRLSTEAARVLQDFYLELRKQSQRLNSSPITTRQLESLIRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQT 879          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 297.36 bits (760), Expect = 7.158e-87
Identity = 198/574 (34.49%), Postives = 299/574 (52.09%), Query Frame = 1
Query:  508 INVRIANFSPICKSLN-LQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKS-FEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTE-SASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDN-DSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMM 2217
            I VRI+   P+ + +  L+   +   I   G V   + + P    VK+ C+ C       +  + +   PT C +  C+ K  FE   E+  TV  +YQ I +QE+                 +K   GR+P++ + IL+ DL D+C PGDE+ VTG+       S N+ Q        +FN ++H N+I       KM  D       + + +D+ AI  +  +PN+ + + +S+ PSIYGH+ VK ++ LALF G  K    K+R  +RG+ ++L+ GDPG  KSQ L+ A  IAPRSV   G   +  GLT    +        LEAGA+V++D G C IDEFDKMS Q   S+ EAMEQQSISI+KAG+V +L AR +V+AA+NP  G YN  +T AEN+ ++ P+LSRFD++ ++ D  + V D +L++ V+  H     + +   +++ D +    M +  G                 IP  LLRKYI YA++  HP L  + +      +  +RK         IT R +ESM+RL+EA A+  LR   N++D      +MLES +
Sbjct:  257 IKVRISQL-PVEEDIRMLRQVHLNMLIRTAGVVTIASGILPQLAVVKYDCVACGYLLGPFVQQNDEEVRPTICPS--CQGKGPFELNVEN--TVYHNYQRITMQESP----------------NKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNFDGSLNYKQGFP-----VFNTLIHANHITNKD---KMASD-------QLTDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHR--LRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHHPD-AKKIVKEGDELEEDQMDERTGVRL--------------IPQDLLRKYIIYAREKCHPTLPEQHSEKFSNIFAQMRKESMATGSVAITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAAIRVMLESFV 777          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 297.36 bits (760), Expect = 7.158e-87
Identity = 198/574 (34.49%), Postives = 299/574 (52.09%), Query Frame = 1
Query:  508 INVRIANFSPICKSLN-LQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKS-FEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTE-SASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDN-DSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMM 2217
            I VRI+   P+ + +  L+   +   I   G V   + + P    VK+ C+ C       +  + +   PT C +  C+ K  FE   E+  TV  +YQ I +QE+                 +K   GR+P++ + IL+ DL D+C PGDE+ VTG+       S N+ Q        +FN ++H N+I       KM  D       + + +D+ AI  +  +PN+ + + +S+ PSIYGH+ VK ++ LALF G  K    K+R  +RG+ ++L+ GDPG  KSQ L+ A  IAPRSV   G   +  GLT    +        LEAGA+V++D G C IDEFDKMS Q   S+ EAMEQQSISI+KAG+V +L AR +V+AA+NP  G YN  +T AEN+ ++ P+LSRFD++ ++ D  + V D +L++ V+  H     + +   +++ D +    M +  G                 IP  LLRKYI YA++  HP L  + +      +  +RK         IT R +ESM+RL+EA A+  LR   N++D      +MLES +
Sbjct:  257 IKVRISQL-PVEEDIRMLRQVHLNMLIRTAGVVTIASGILPQLAVVKYDCVACGYLLGPFVQQNDEEVRPTICPS--CQGKGPFELNVEN--TVYHNYQRITMQESP----------------NKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNFDGSLNYKQGFP-----VFNTLIHANHITNKD---KMASD-------QLTDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHR--LRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHHPD-AKKIVKEGDELEEDQMDERTGVRL--------------IPQDLLRKYIIYAREKCHPTLPEQHSEKFSNIFAQMRKESMATGSVAITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAAIRVMLESFV 777          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Celegans
Match: mcm-4 (DNA replication licensing factor mcm-4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XQ8])

HSP 1 Score: 285.034 bits (728), Expect = 8.654e-83
Identity = 189/571 (33.10%), Postives = 276/571 (48.34%), Query Frame = 1
Query:  508 INVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAE-FSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESM 2214
            I +R  N         L  N +   I++ G V + + + P      F+C  C    I    D  +   P  C N    +  F+ +   + +V +D QV++LQE+  D P                 G  P T++      LV++  PGD + VTGI        N  Q + +         LH           KMD    +  + E  + + +  I  +   P++   L  S+ PSIY H+ VK  LL  LFGG  K     N+  +R   +IL+ GDPG  KSQMLQ    + PRS Y  G   +  GLT S S+D D+    L+ GALV++DNG CCIDEFDKM+    + L E MEQQ++SIAKAG++C L+AR SVLAAANP    +N+ KT+ EN+ +   LLSRFDL+++++D  +E+ D +L  H++SL+ E                                   G++E  +++   LLR YIAYAK  +HPKLS EA+  + E YL +RK            RQLES++RL+EA A+  L +  +  D +    L  E++
Sbjct:  221 IELRPFNAQKTRNMRGLNPNDVDQLITISGMVTRTSSLIPEMRSGYFQCAVCAF-GIESEVDKGRIEEPVVCTN-CSNTHCFQLVH--NRSVFLDKQVVKLQESPDDMP----------------SGETPHTVSVYAHGSLVESVQPGDRITVTGIFRATGMKVNPKQRALASVYRTSIDALHFR---------KMDTSRLHQDNGETITEERIQQIIELSKRPDIMDALAQSIAPSIYEHDDVKRGLLCLLFGGTRKDDETTNKTKLRSEINILLCGDPGTSKSQMLQYVYRLLPRSQYTSGKGSSAVGLTASVSRDADTKQLVLQTGALVLADNGVCCIDEFDKMNESARSVLHEVMEQQTLSIAKAGIICQLNARASVLAAANPVDSKWNRNKTIVENITLPHTLLSRFDLIFLIVDAQDEMQDRRLGNHLVSLYFEND---------------------------------GNQEKTEHVDMNLLRDYIAYAKANIHPKLSEEASQFIIEKYLFMRKAGAQHGQITAYPRQLESLIRLSEAHAKIRLSQEVSVDDVEKAFTLWREAL 729          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Celegans
Match: mcm-4 (DNA replication licensing factor mcm-4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XQ8])

HSP 1 Score: 285.034 bits (728), Expect = 8.654e-83
Identity = 189/571 (33.10%), Postives = 276/571 (48.34%), Query Frame = 1
Query:  508 INVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAE-FSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESM 2214
            I +R  N         L  N +   I++ G V + + + P      F+C  C    I    D  +   P  C N    +  F+ +   + +V +D QV++LQE+  D P                 G  P T++      LV++  PGD + VTGI        N  Q + +         LH           KMD    +  + E  + + +  I  +   P++   L  S+ PSIY H+ VK  LL  LFGG  K     N+  +R   +IL+ GDPG  KSQMLQ    + PRS Y  G   +  GLT S S+D D+    L+ GALV++DNG CCIDEFDKM+    + L E MEQQ++SIAKAG++C L+AR SVLAAANP    +N+ KT+ EN+ +   LLSRFDL+++++D  +E+ D +L  H++SL+ E                                   G++E  +++   LLR YIAYAK  +HPKLS EA+  + E YL +RK            RQLES++RL+EA A+  L +  +  D +    L  E++
Sbjct:  221 IELRPFNAQKTRNMRGLNPNDVDQLITISGMVTRTSSLIPEMRSGYFQCAVCAF-GIESEVDKGRIEEPVVCTN-CSNTHCFQLVH--NRSVFLDKQVVKLQESPDDMP----------------SGETPHTVSVYAHGSLVESVQPGDRITVTGIFRATGMKVNPKQRALASVYRTSIDALHFR---------KMDTSRLHQDNGETITEERIQQIIELSKRPDIMDALAQSIAPSIYEHDDVKRGLLCLLFGGTRKDDETTNKTKLRSEINILLCGDPGTSKSQMLQYVYRLLPRSQYTSGKGSSAVGLTASVSRDADTKQLVLQTGALVLADNGVCCIDEFDKMNESARSVLHEVMEQQTLSIAKAGIICQLNARASVLAAANPVDSKWNRNKTIVENITLPHTLLSRFDLIFLIVDAQDEMQDRRLGNHLVSLYFEND---------------------------------GNQEKTEHVDMNLLRDYIAYAKANIHPKLSEEASQFIIEKYLFMRKAGAQHGQITAYPRQLESLIRLSEAHAKIRLSQEVSVDDVEKAFTLWREAL 729          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Celegans
Match: mcm-6 (DNA replication licensing factor mcm-6 [Source:UniProtKB/Swiss-Prot;Acc:P34647])

HSP 1 Score: 259.61 bits (662), Expect = 7.407e-74
Identity = 196/662 (29.61%), Postives = 326/662 (49.24%), Query Frame = 1
Query:  274 YFSCLKLNLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPD---DYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVM--------------TESASTNFHQSSGSGSNCLFNLVLHVNNI--------CRLK-------GDVKMDVDSENSYD--AEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTP---ITTRQLESMVRLTEAKAR 2145
            Y S +K   E+++ +K+ I       + +++ K  +      +    R+   MC ALH L   +         +    + V + N     K   L A+++G  + + G +V+ + V P   R  F C  C     V   D    +++  PT+C N  C +++   L  +  T  +D+Q IR+QET ++ P                 G IP+T++ I+  ++V+   PGD+  + G ++               E+++ N  +++           L V ++        C ++       GD    V+  +  D  ++ S +D   ++ +  +  + K +V SL P+IYG+  VK  +LL L GGV K   D+   ++RG+ ++ +VGDP   KSQ+L++    +PR++Y  G + + AGLT +  KD +S    +EAGAL+++DNG CCIDEFDKM  +   ++ EAMEQQ+ISI KAG+   L+AR S+LAAANP  G Y++++ +  N++MSAP++SRFDL ++++D  NEV D  ++R +L  H   S +    S+ ++D                                  ++KYIA+A+ +  PK+S +AA  L   Y  LR        T    IT RQLES+VRL+EA AR
Sbjct:   40 YKSAMK---ELVQPEKNTI-----FINMQHLYKFSNNLATTIELQYYRVYPFMCEALH-LATLDACDESERQQMFKKQLYVSLFNLDAKTKVRELSADKVGGLVRIAGQIVRTHPVHPELSRACFVCEDCG----VTTRDVQQQFRYTQPTKCANPQCMNRTRFSLDVNSSTF-VDFQKIRIQETQAELP----------------RGSIPRTVDVIVRGEMVETVQPGDKCDIVGTLIVIPDIAQLSTPGLRAETSNQNRGRATDKSEGITGLKALGVRDLTYKMAFLACHIQQTESLVGGDASGAVEETDYLDLWSKMSTEDRATLKKMSDDKKIEKNIVDSLFPNIYGNHEVKLGVLLMLLGGVAKKSRDEG-TSLRGDINVCLVGDPSTAKSQVLKAVEEFSPRAIYTSGKASSAAGLTAAVVKDEESFEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARASILAAANPVNGRYDRSRPLKYNVQMSAPIMSRFDLFFVLVDECNEVTDYAIARRILDNHRAISEHTERDSVYKIDD---------------------------------IKKYIAFARCF-KPKISDKAAETLVREYKKLRMSDSNNAATSSWRITVRQLESLVRLSEALAR 636          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Fly
Match: Mcm6 (gene:FBgn0025815 transcript:FBtr0070952)

HSP 1 Score: 297.745 bits (761), Expect = 2.413e-87
Identity = 197/596 (33.05%), Postives = 321/596 (53.86%), Query Frame = 1
Query:  544 KSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKS-KSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVM------------TESASTNFHQSSGSGSNCLFNL-VLHVNNI---------------CRLKG-DVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDS-GTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHT--EQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTP---ITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGV 2223
            K  +L  ++IG+ I + G VV+ + V P  +   F CL C+ E I  +   +KF  PT C N VC + K F  + + ++++ +D+Q IR+QET ++ P                 G IP+ +  IL  +LV+    GD    TG ++            T + +++ H+  G G + +  L  L +  +                R  G D+ M   +      + +  + + I  +  + NL++ L++SL PSIYG++ VK  +LL  FGGV K   +K   ++RG+ ++ IVGDP   KSQ L+     +PR++Y  G + + AGLT +  +D +S    +EAGAL+++DNG CCIDEFDKM  +   ++ EAMEQQ+ISIA+AG+   L+ARTS+LAAANP  G Y+++K++ +N+++SAP++SRFDL +I++D  NEV+D  ++R ++ LH+  E+S+ R              + T+E                      ++LR Y+ +A+++  P +S EA ++L E Y  LR+R     G     IT RQLESM+RL+EA A+ E      E+  K+   L+ +S++ V
Sbjct:  116 KVRDLTTSKIGTLIRISGQVVRTHPVHPELVSGVFMCLDCQTE-IRNVEQQFKFTNPTICRNPVCSNRKRF--MLDVEKSLFLDFQKIRIQETQAELP----------------RGCIPRAVEIILRSELVETVQAGDRYDFTGTLIVVPDVSVLAGVGTRAENSSRHKP-GEGMDGVTGLKALGMRELNYRMAFLACSVQATTARFGGTDLPMSEVTAEDMKKQMTDAEWHKIYEMSKDRNLYQNLISSLFPSIYGNDEVKRGILLQQFGGVAKTTTEKT--SLRGDINVCIVGDPSTAKSQFLKQVSDFSPRAIYTSGKASSAAGLTAAVVRDEESFDFVIEAGALMLADNGICCIDEFDKMDQRDQVAIHEAMEQQTISIARAGVRATLNARTSILAAANPINGRYDRSKSLQQNIQLSAPIMSRFDLFFILVDECNEVVDYAIARKIVDLHSNIEESVER--------------AYTRE----------------------EVLR-YVTFARQF-KPVISQEAGHMLVENYGHLRQRDTGTSGRSTWRITVRQLESMIRLSEAMAKLECSNRVLERHVKEAFRLLNKSIIRV 651          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Fly
Match: Mcm2 (gene:FBgn0014861 transcript:FBtr0081827)

HSP 1 Score: 293.893 bits (751), Expect = 2.134e-85
Identity = 205/633 (32.39%), Postives = 314/633 (49.61%), Query Frame = 1
Query:  328 IIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNC-LFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMM 2217
            ++ Y DL + E+   V+  F  E  F    I  ++   +   +F       +        I+VRI+    I +    +   +   +   G V     V P    +K+ C+ C       +        P  C    C+S    P     ++T+  +YQ I LQE+    P                 GRIP++ + IL+ DL D C PGDE+ VTGI      + N+  S  +     +F  V+  N++  +  D K  V S        + +D+  I+ +  +P + + +VAS+ PSIYGH+ +K +L LALFGG +K   +K++V  RG+ ++LI GDPG  KSQ L+    +APR+V+  G   +  GLT    ++  S    LEAGALV++D G C IDEFDKM+ Q   S+ EAMEQQSISI+KAG+V +L AR +V+AAANP  G Y+ + T +EN+ +S P+LSRFD++ ++ D  + + D +L++ V+  H                      M   P       L     ++ D IP  LLR+YI YAK+ + PKL++   + + + Y  LR+        PIT R +ES++R++EA AR  LRE   E D      +MLES +
Sbjct:  216 VVSYTDLANKEH---VLAYFLPEAPFQMLEIFDKVAKDMVLSIFPTYERVTTE-------IHVRISELPLIEELRTFRKLHLNQLVRTLGVVTATTGVLPQLSVIKYDCVKCGYVLGPFVQSQNTEIKPGSCPE--CQSTG--PFSINMEQTLYRNYQKITLQESPGRIPA----------------GRIPRSKDVILLADLCDQCKPGDELEVTGIY-----TNNYDGSLNTDQGFPVFATVIIANHV--VVKDSKQVVQS-------LTDEDIATIQKLSKDPRIVERVVASMAPSIYGHDYIKRALALALFGGESKNPGEKHKV--RGDINLLICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVGLTAYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSH----------------------MKHHPSEEEQPELEEPQLKTVDEIPQDLLRQYIVYAKENIRPKLTNIDEDKIAKMYAQLRQESFATGSLPITVRHIESVIRMSEAHARMHLRENVMEADVSMAIRMMLESFI 780          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0345797)

HSP 1 Score: 270.011 bits (689), Expect = 5.380e-77
Identity = 187/578 (32.35%), Postives = 277/578 (47.92%), Query Frame = 1
Query:  508 INVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDEL 2238
            I VR  N        +L    +   IS+ G V++ + V P      F C  C     V + D  +   PT C N  C +     L  +    T D Q+++LQE+  D                   G+ P  +      DLVD   PGD V VTGI       T      G  S+       HV+ +   K D K   + E   D  F  + +  ++ +  +P+++  L  ++ PSIY ++ +K  +LL LFGG  K      R   R   H+L+ GDPG  KSQMLQ    + PRS Y  G   +  GLT   +KD ++    L+ GALV++DNG CCIDEFDKM+    + L E MEQQ++SIAKAG++C L+ARTS+LAAANP    +NK K + +N+++   LLSRFDL++++LD  +E+ D +L+ H++SL+                      +T+             H+E        +LR YIAYA++++ P LS EA   L + Y+ +RK            RQLES++RL+EA A+  L       D ++   L  E++    +D L
Sbjct:  261 IQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEV-DRGRINQPTLCTN--CNTNHCFRLIHNRSEFT-DKQLVKLQESPDDM----------------AAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTG-----GLSSSVKSVYKTHVDVVHFRKVDNKRLYEDEEGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYY---------------------VTR-------------HEEEDTMFDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAYPRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRLHREALKQSATDPL 779          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0088982)

HSP 1 Score: 270.011 bits (689), Expect = 5.380e-77
Identity = 187/578 (32.35%), Postives = 277/578 (47.92%), Query Frame = 1
Query:  508 INVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDEL 2238
            I VR  N        +L    +   IS+ G V++ + V P      F C  C     V + D  +   PT C N  C +     L  +    T D Q+++LQE+  D                   G+ P  +      DLVD   PGD V VTGI       T      G  S+       HV+ +   K D K   + E   D  F  + +  ++ +  +P+++  L  ++ PSIY ++ +K  +LL LFGG  K      R   R   H+L+ GDPG  KSQMLQ    + PRS Y  G   +  GLT   +KD ++    L+ GALV++DNG CCIDEFDKM+    + L E MEQQ++SIAKAG++C L+ARTS+LAAANP    +NK K + +N+++   LLSRFDL++++LD  +E+ D +L+ H++SL+                      +T+             H+E        +LR YIAYA++++ P LS EA   L + Y+ +RK            RQLES++RL+EA A+  L       D ++   L  E++    +D L
Sbjct:  261 IQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEV-DRGRINQPTLCTN--CNTNHCFRLIHNRSEFT-DKQLVKLQESPDDM----------------AAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTG-----GLSSSVKSVYKTHVDVVHFRKVDNKRLYEDEEGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYY---------------------VTR-------------HEEEDTMFDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAYPRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRLHREALKQSATDPL 779          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Fly
Match: rec (gene:FBgn0003227 transcript:FBtr0334595)

HSP 1 Score: 261.536 bits (667), Expect = 7.580e-74
Identity = 228/819 (27.84%), Postives = 396/819 (48.35%), Query Frame = 1
Query:  190 YHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNLEMIEIKKHAIIDYNDLC-----SSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN----NISSISNSDLPNIY---------INVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSK-SFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICG--GSVTTAGLTVSFSKDNDSGTALEAGALVI-SDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHT-----------------------EQSLNRSSSSIRQMDTMSF---HSMTKEPGSTFHERLSYGHKES-CDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMD--GTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERS---GSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLL 2484
            Y GW +YF  E+Y E ++   RI A  +Y+       + + I+      +  LC     S   + +V      + + +  R +  + LA+HT+V  +    N S+ +    P  Y         I  R  +F P+     +  +++ +  S++G V  V +         FRC  C+ E  +     ++   P +C    C ++  F PL+ S  T     Q+IR++E+           S ++ HD   E  +P  ++  L  DLVD    G EV+VTGI+  +    +   ++G  SN +   +  V+            +   +S   EFS +DL AI  I++EPN FKLLV S+ P +YGHEL KA+ LL+L GG    G +   +      ++L+VGDPG+GK+++LQS   IA R  ++ G  G+ +   L V+F+  N     L+AG+L++ S  G C +D+ DK++++Q A LL+ ++ + +++  AG   +  A+ SV+A ANP  G Y++ + + +N+ +S  LL  F LVYI+LD+P+E  D  L+ HV +LH                        E SLN  ++  +  DT+     +    +      +RL    +E   D +PP L++K+++YA++ ++P L+ +A+N +  ++L L+   +  +   + I   QL +++ L++A+AR +L  + + Q  +DV  L+ ES+      E G         G     +  S +L + L+    RS   G   F + ++K+I   A I L+    +V   N  G+LL KG   Y+++
Sbjct:  112 YSGWRLYFLREKYEEGNELATRIMAVEAYYQRNPHTFDFVMIRDRG---FFPLCAAGIKSDAQLKEVWPSLSEDIREHPLRTLGTLSLAMHTVVVNHQLDCNDSTTAMVSTPEQYVLPTPRVRKIYARPDDFVPVESIEGISHSRVDTLFSIRGFVSNVGEPSYSLTWQAFRCSRCQMEIAMRQRGTFQ-PRPYQCKRSECVARDEFVPLRSSPYTRLSIRQIIRVEES-----------SLNLVHD--FETSMPAEMDVELRHDLVDAVRVGQEVVVTGILKLQELGDD--TTTGDTSNQMQPYLKAVS------------IRDASSIKREFSERDLEAIVMINAEPNSFKLLVQSIAPEVYGHELPKAACLLSLLGGK---GAETEAI------NVLLVGDPGIGKTKILQSCAQIAERGAHVSGKRGAQSAQQLGVTFAGRNKR--VLQAGSLMMASGGGHCTLDDVDKLASKQ-AVLLQCLQSEEVNLPLAGAFASFPAQPSVIACANPQRGQYDEGRYLLQNINISPSLLREFHLVYILLDKPSE-RDMSLTAHVRALHAGARKRARIAARYALKPKMSDSMCEVSLNVPAAG-KDDDTIKTEDDNDSIMQQDYDLDKRLEVLPEEGDLDLLPPILIKKFLSYARQELNPVLNEDASNAVLRYFLELKGSCNLDEDVSSQIGAGQLLAIIHLSQARARLDLSHVVSPQHVRDVIALLTESITQTSLKE-GSSRQGTRGGGGAGGGAGKSAQLRNFLELTKRRSAALGRRIFEFDELKEIGTRAGI-LTGFSQLVEMANLGGYLLMKGANMYEVV 883          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Zebrafish
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:ZFIN;Acc:ZDB-GENE-120927-1])

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 373/804 (46.39%), Postives = 521/804 (64.80%), Query Frame = 1
Query:  148 KVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALH---TLVFANNISSI-SNSDLP-------NI-YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGI--VMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDV-DSENSYDA-EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDT----MSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            +  + + +L   CPY GW +YF  E ++E+S  V +I+ F  YF+  +++L   + IE K   ++DY DL S++ ++  + +   + +   ++I+  + +A+H   TL    + + +    +LP       NI +I+ R+ N+ P+    +L+AN  G F+ ++G VV+V+ +KP+C+++ F C +C + Q V LPD  K+ +PT+C+   C+ +SF P + S  T+T+D+Q I++QE  S               D+   GRIP+T+ C L +DLVD+CVPGD V +TG+  V  E  ST   +       C+F L +  N++   KG     V +SE    + EFS+KDLYAI+ I ++ +LFKL+V SLCP IYGH LVKA L LALFGG  K+ +DKNR+ IRG+ H+LIVGDPGLGKSQMLQ+ C +APR VY+CG + TT+GLTVS S+D+ SG  ALEAGALV+ D G CCIDEFDKM + QH +LLEAMEQQSIS+AKAG+VC L ARTS++AAANP  GHYNK KTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +S   S ++  + +T    +S   ++ E      + L     E+ D IP QLLRKY+ YA+ YVHP LS+EAA +LQ+FYL LRK+    D TPITTRQLES++RLTEA+AR ELRE A + DA+DV E+M  S+   YSDE G L+F RSQ GSGMS  S  KK +S L   +ER+  S F   D++Q+A +  I++ D E  +  LNEQG+LLKKG   Y+L T
Sbjct:   73 QARVTQATLDITCPYKGWRLYFS-EGFVESSPYVEKIKVFEQYFTS-QIDLYDKDEIERKGSILVDYKDLLSNKQVSHSLPDLARDLKEMPEKILDCLGVAIHQVLTLDLERHAAELQGQEELPAGIRPIINIPHISARLYNYEPLTPLKSLRANLYGKFVVIRGTVVRVSNIKPLCMKLAFVCNSCGDTQSVTLPDG-KYTMPTKCLQSECRGRSFTPNRSSPFTLTVDWQTIKVQELMSG--------------DQRESGRIPRTIECELTQDLVDSCVPGDMVTITGVIKVSNEEGSTRNKKD-----KCMFLLYIQANSVSNSKGQKSKAVSESEGQGPSVEFSIKDLYAIQEIQAQEDLFKLIVNSLCPVIYGHLLVKAGLALALFGGCQKYVDDKNRIPIRGDPHMLIVGDPGLGKSQMLQAVCNVAPRGVYVCGNTTTTSGLTVSLSRDSGSGDYALEAGALVLGDQGICCIDEFDKMGS-QHQALLEAMEQQSISLAKAGIVCTLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAMRAGKSGAVSGAAATRFNTHESSISILEVSSE--KPLADTLKLVPGEAFDPIPHQLLRKYVGYARHYVHPTLSAEAAQVLQDFYLELRKQNQTADSTPITTRQLESLIRLTEARARVELREKATQSDAEDVVEIMKHSLTDTYSDEFGRLDFDRSQLGSGMSNRSKVKKFVSALNKLAERTSKSMFELQDLRQLAKDLQIQVVDFEGFICALNEQGYLLKKGHRMYQLQT 851          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Zebrafish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:ZFIN;Acc:ZDB-GENE-020419-24])

HSP 1 Score: 292.738 bits (748), Expect = 7.373e-85
Identity = 200/574 (34.84%), Postives = 290/574 (50.52%), Query Frame = 1
Query:  508 INVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNC--LFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMM 2217
            I+VRI N   + +  +L+   +   I   G V     V P    VK+ C  C            +   P  C     + +S  P +   ++TV  +YQ I +QE+                  K   GR+P++ + IL+ DLVD C PGDE+ +TGI        N +  S + +N   +F  V+  N+I R    V +         AE + +D+ AI A+  +  + + + AS+ PSIY HE +K  L LALFGG  K    K++V  RG+ ++L+ GDPG  KSQ L+    +A R+V+  G   +  GLT    +   S    LEAGALV++D G C IDEFDKM+ Q   S+ EAMEQQSISI+KAG+V +L AR +V+AAANP  G Y+ + T +EN+ ++ P++SRFD++ ++ D  + V D  L+R V+  H                 +  H   KE G    E +   +      IP +LLRKYI YAK+ V PKL+    + +   Y  LRK        PIT R +ESM+R+ EA AR  LR+   E D      +MLES +
Sbjct:  269 IHVRIGNLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCNFILGPFFQSQNQEVKPGSC----PECQSLGPFEINMEQTVYQNYQRITIQESPG----------------KVAAGRLPRSKDAILLADLVDMCKPGDEIELTGIY------HNNYDGSLNMANGFPVFATVILANHIARKDEGVAV---------AELTDEDVKAIVALSKDERIGERIFASIGPSIYAHEDIKRGLALALFGGEAKNPGGKHKV--RGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSH-----------------IKHHPSNKEGGVAGLEEVVLPNTFDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVLEDDVNMAIRVMLESFI 788          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Zebrafish
Match: mcm4 (minichromosome maintenance complex component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9544])

HSP 1 Score: 290.041 bits (741), Expect = 2.808e-84
Identity = 195/569 (34.27%), Postives = 283/569 (49.74%), Query Frame = 1
Query:  553 NLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCK-NEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVK----MDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRK---RRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSD 2232
            NL    I   I++ G V++ +Q+ P      FRC  C  N ++ V  D  + A P  C N  C +     L   + +V  D Q+I+LQE+  D P                 G+ P T       DLVD   PGD V +TGI        N  QS       ++    H++ I   K D K    +D D E      F+ + +  ++ + ++P++++ L ++L PSIY HE +K  +LL LFGG  K      R   R   +IL+ GDPG  KSQ+LQ    + PR  Y  G   +  GLT    KD ++    L+ GALV+SDNG CCIDEFDKMS    + L E MEQQ++SIAKAG++C L+ARTS+LAAANP    +N  KT  EN+++   LLSRFDL+++MLD  +E  D +L+ H++SL+ +                              E++   H +        +L+ YIA+A+  VHP+LS EA+  L E Y+ +RK    R  +   P   RQLES++RL EA A+          D ++ K L  E++    +D
Sbjct:  255 NLNPEDIDQLITISGMVIRTSQLIPEMQEAFFRCQVCAFNTRVEV--DRGRIAEPAVCRN--CNTTHSMALVH-NRSVFSDKQMIKLQESPEDMPA----------------GQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAAPMRLNPRQSQ---VKSVYKT--HIDAIHFRKTDEKRLHGLDEDGEQKL---FTKERVALLKELAAKPDVYERLSSALAPSIYEHEDIKKGILLQLFGGTRKDFTQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQS----------------------------EEQIEEEHLDMA------VLKDYIAFARTTVHPRLSEEASQALIEAYVDMRKIGSGRGMVSAYP---RQLESLIRLAEAHAKVRFSGKVETIDVEEAKRLHREALKQSATD 757          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Zebrafish
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 281.182 bits (718), Expect = 3.005e-81
Identity = 190/588 (32.31%), Postives = 301/588 (51.19%), Query Frame = 1
Query:  496 PNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVM--------------TESAS-----TNFHQSSGSGSNCL------FNLVLHVNNIC----RLKG-DVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDG-------TPITTRQLESMVRLTEAKAR 2145
            P+    V  + F    K   L   +IG+ + + G VV+ + V P  +   F CL C++  I  +   +K+  PT C N VC ++    + +++++  +D+Q +R+QET ++ P                 G IP+++  IL  + V+    GD    TG ++               E++S       F      G   L      + L    N +     R  G +++ +  +  S   + +V++   +  +  + NL+  L  SL P+I+G++ +K  +LL LFGGV K   +    ++RG+ ++ IVGDP   KSQ L+     APR+VY  G + + AGLT +  KD +S    +EAGAL+++DNG CCIDEFDKM  +   ++ EAMEQQ+ISI KAG+   L+ARTS+LAAANP  G YN+AK++ +N+ MSAP++SRFDL +I++D  NEV D  ++R ++ LH      R+  S+                    ER+      S D I     ++YI +A+++  PK++ EA   + + Y  LR+R    DG         IT RQLESM+RL+E  AR
Sbjct:  100 PSKEFYVAFSEFPSRQKIRELSTVRIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQS-VIKDVEQQFKYTQPTICKNPVCANRR-RFMLDTNKSRFVDFQKVRIQETQAELP----------------RGSIPRSVEVILRAEAVETAQAGDRCDFTGTLIVVPDVSAMALAGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQTAESVKNQMTVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEG--TSLRGDINVCIVGDPSTSKSQFLKHVEDFAPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRAKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHA-----RNVESV--------------------ERVY-----STDEI-----QRYILFARQF-QPKITVEAQEFVVDQYKRLRQR----DGGGTTKSAWRITVRQLESMLRLSEGMAR 627          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Zebrafish
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 281.182 bits (718), Expect = 3.634e-81
Identity = 190/588 (32.31%), Postives = 301/588 (51.19%), Query Frame = 1
Query:  496 PNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVM--------------TESAS-----TNFHQSSGSGSNCL------FNLVLHVNNIC----RLKG-DVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDG-------TPITTRQLESMVRLTEAKAR 2145
            P+    V  + F    K   L   +IG+ + + G VV+ + V P  +   F CL C++  I  +   +K+  PT C N VC ++    + +++++  +D+Q +R+QET ++ P                 G IP+++  IL  + V+    GD    TG ++               E++S       F      G   L      + L    N +     R  G +++ +  +  S   + +V++   +  +  + NL+  L  SL P+I+G++ +K  +LL LFGGV K   +    ++RG+ ++ IVGDP   KSQ L+     APR+VY  G + + AGLT +  KD +S    +EAGAL+++DNG CCIDEFDKM  +   ++ EAMEQQ+ISI KAG+   L+ARTS+LAAANP  G YN+AK++ +N+ MSAP++SRFDL +I++D  NEV D  ++R ++ LH      R+  S+                    ER+      S D I     ++YI +A+++  PK++ EA   + + Y  LR+R    DG         IT RQLESM+RL+E  AR
Sbjct:  100 PSKEFYVAFSEFPSRQKIRELSTVRIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQS-VIKDVEQQFKYTQPTICKNPVCANRR-RFMLDTNKSRFVDFQKVRIQETQAELP----------------RGSIPRSVEVILRAEAVETAQAGDRCDFTGTLIVVPDVSAMALAGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQTAESVKNQMTVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEG--TSLRGDINVCIVGDPSTSKSQFLKHVEDFAPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRAKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHA-----RNVESV--------------------ERVY-----STDEI-----QRYILFARQF-QPKITVEAQEFVVDQYKRLRQR----DGGGTTKSAWRITVRQLESMLRLSEGMAR 627          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Xenopus
Match: pde10a (phosphodiesterase 10A [Source:Xenbase;Acc:XB-GENE-1013417])

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 366/802 (45.64%), Postives = 517/802 (64.46%), Query Frame = 1
Query:  136 SSTKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFS-CLKL-NLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN---------NISSISNSDLPNI---YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGS-TFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            ++  K  + +T+L    PY GW +YF  E Y ++S  + ++ AF  +F+  ++L + + IE K   ++DY DL   E ++  I    +E +   ++I+  M LA+H ++  +             +   + P +   +I+ R+ N+ P+    NL+A+  G +++L+G VV+V+ +KP+C+++ F C  C + Q    PD  K+AVPT+C    C+ +SF   + S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C LI+DLVD+CVPGD V VTGIV   +     +  +   + C+F L +  N++   KG      D   S+ A  +FS+KDLYAI+ I ++ NLF+L+V SLCP+IYGHELVKA L LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+ C +APR VY+CG + TT+GLTV+ S+D+ +G   LEAGAL++ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNK KTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++       +S+         S  S+ +EP      ERL     E  D IP QLLRKY+ YA++YVHP LS +AA +LQ+FYL LRK+   +D TPITTRQLES++RLTEA+AR ELRE A + DA++V ++M  S++G +SDE G L+F RSQ GSGMS  S +KK IS L   +E++ ++ F +  ++QIA    I++ D E  V +LN+QG+LLKKGP  Y+L T
Sbjct:   17 TAPPKPQLTQTTLDKYIPYKGWKLYFS-EAYSDSSPFLEKVRAFEKFFTKQIELYDKDEIERKGSILVDYKDLLQDEDLSASI-PMSSELKEMPEKILECMGLAIHQVLTKDLERHAAELQEQEGLRTEEAPIVNVPFIHARVFNYDPLTPLKNLRASLYGKYVALRGTVVRVSNIKPLCVKMAFSCNMCGDIQSFPFPDG-KYAVPTKCPVPECRGRSFTANRSSPLTVTVDWQTIKVQELMSD--------------DQREAGRIPRTVECELIQDLVDSCVPGDMVTVTGIVKVSNTRDGMYNKN---NKCMFLLYIEANSVSNSKGHKIKSTDDSESHGASMDFSLKDLYAIQEIQAQENLFQLIVNSLCPTIYGHELVKAGLSLALFGGCQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAVCNVAPRGVYVCGNTTTTSGLTVTLSRDSATGDFGLEAGALILGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGIVCSLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAMRAGAKEMQSADLTCPTTQNSNTSVLEEPSERPLGERLKLRPGEHFDPIPHQLLRKYVGYARQYVHPTLSPDAAQVLQDFYLELRKQNQGIDSTPITTRQLESLIRLTEARARLELREKATKDDAEEVVQIMKYSLLGTFSDEFGKLDFHRSQHGSGMSNRSKAKKFISALNRIAEQTYNNLFEFQQLRQIAKELQIQVIDFEGFVGSLNDQGYLLKKGPRVYQLQT 797          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Xenopus
Match: pde10a (phosphodiesterase 10A [Source:Xenbase;Acc:XB-GENE-1013417])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 366/802 (45.64%), Postives = 517/802 (64.46%), Query Frame = 1
Query:  136 SSTKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFS-CLKL-NLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN---------NISSISNSDLPNI---YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGS-TFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            ++  K  + +T+L    PY GW +YF  E Y ++S  + ++ AF  +F+  ++L + + IE K   ++DY DL   E ++  I    +E +   ++I+  M LA+H ++  +             +   + P +   +I+ R+ N+ P+    NL+A+  G +++L+G VV+V+ +KP+C+++ F C  C + Q    PD  K+AVPT+C    C+ +SF   + S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C LI+DLVD+CVPGD V VTGIV   +      ++  +   C+F L +  N++   KG      D   S+ A  +FS+KDLYAI+ I ++ NLF+L+V SLCP+IYGHELVKA L LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+ C +APR VY+CG + TT+GLTV+ S+D+ +G   LEAGAL++ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNK KTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++       +S+         S  S+ +EP      ERL     E  D IP QLLRKY+ YA++YVHP LS +AA +LQ+FYL LRK+   +D TPITTRQLES++RLTEA+AR ELRE A + DA++V ++M  S++G +SDE G L+F RSQ GSGMS  S +KK IS L   +E++ ++ F +  ++QIA    I++ D E  V +LN+QG+LLKKGP  Y+L T
Sbjct:   36 TAPPKPQLTQTTLDKYIPYKGWKLYFS-EAYSDSSPFLEKVRAFEKFFTKQIELYDKDEIERKGSILVDYKDLLQDEDLSASI-PMSSELKEMPEKILECMGLAIHQVLTKDLERHAAELQEQEGLRTEEAPIVNVPFIHARVFNYDPLTPLKNLRASLYGKYVALRGTVVRVSNIKPLCVKMAFSCNMCGDIQSFPFPDG-KYAVPTKCPVPECRGRSFTANRSSPLTVTVDWQTIKVQELMSD--------------DQREAGRIPRTVECELIQDLVDSCVPGDMVTVTGIVKVSNTRDGGFKNKNN--KCMFLLYIEANSVSNSKGHKIKSTDDSESHGASMDFSLKDLYAIQEIQAQENLFQLIVNSLCPTIYGHELVKAGLSLALFGGCQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAVCNVAPRGVYVCGNTTTTSGLTVTLSRDSATGDFGLEAGALILGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGIVCSLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAMRAGAKEMQSADLTCPTTQNSNTSVLEEPSERPLGERLKLRPGEHFDPIPHQLLRKYVGYARQYVHPTLSPDAAQVLQDFYLELRKQNQGIDSTPITTRQLESLIRLTEARARLELREKATKDDAEEVVQIMKYSLLGTFSDEFGKLDFHRSQHGSGMSNRSKAKKFISALNRIAEQTYNNLFEFQQLRQIAKELQIQVIDFEGFVGSLNDQGYLLKKGPRVYQLQT 817          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Xenopus
Match: pde10a (phosphodiesterase 10A [Source:Xenbase;Acc:XB-GENE-1013417])

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 367/806 (45.53%), Postives = 521/806 (64.64%), Query Frame = 1
Query:  136 SSTKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFS-CLKL-NLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN---------NISSISNSDLPNI---YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTE----QSLNRSSSSIRQMDTMSFHSMTKEP-GSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            ++  K  + +T+L    PY GW +YF  E Y ++S  + ++ AF  +F+  ++L + + IE K   ++DY DL   E ++  I    +E +   ++I+  M LA+H ++  +             +   + P +   +I+ R+ N+ P+    NL+A+  G +++L+G VV+V+ +KP+C+++ F C  C + Q    PD  K+AVPT+C    C+ +SF   + S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C LI+DLVD+CVPGD V VTGIV  + ++T         + C+F L +  N++   KG      D   S+ A  +FS+KDLYAI+ I ++ NLF+L+V SLCP+IYGHELVKA L LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+ C +APR VY+CG + TT+GLTV+ S+D+ +G   LEAGAL++ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNK KTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++       QS + +  + +  +T      ++ P G     RL  G  E  D IP QLLRKY+ YA++YVHP LS +AA +LQ+FYL LRK+   +D TPITTRQLES++RLTEA+AR ELRE A + DA++V ++M  S++G +SDE G L+F RSQ GSGMS  S +KK IS L   +E++ ++ F +  ++QIA    I++ D E  V +LN+QG+LLKKGP  Y+L T
Sbjct:   44 TAPPKPQLTQTTLDKYIPYKGWKLYFS-EAYSDSSPFLEKVRAFEKFFTKQIELYDKDEIERKGSILVDYKDLLQDEDLSASI-PMSSELKEMPEKILECMGLAIHQVLTKDLERHAAELQEQEGLRTEEAPIVNVPFIHARVFNYDPLTPLKNLRASLYGKYVALRGTVVRVSNIKPLCVKMAFSCNMCGDIQSFPFPDG-KYAVPTKCPVPECRGRSFTANRSSPLTVTVDWQTIKVQELMSD--------------DQREAGRIPRTVECELIQDLVDSCVPGDMVTVTGIV--KVSNTRDGGFKNKNNKCMFLLYIEANSVSNSKGHKIKSTDDSESHGASMDFSLKDLYAIQEIQAQENLFQLIVNSLCPTIYGHELVKAGLSLALFGGCQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAVCNVAPRGVYVCGNTTTTSGLTVTLSRDSATGDFGLEAGALILGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGIVCSLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAMRAGAKEMQSADLTCPTTQNSNTSVLEEPSERPLGERLKVRLRPG--EHFDPIPHQLLRKYVGYARQYVHPTLSPDAAQVLQDFYLELRKQNQGIDSTPITTRQLESLIRLTEARARLELREKATKDDAEEVVQIMKYSLLGTFSDEFGKLDFHRSQHGSGMSNRSKAKKFISALNRIAEQTYNNLFEFQQLRQIAKELQIQVIDFEGFVGSLNDQGYLLKKGPRVYQLQT 827          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Xenopus
Match: pde10a (phosphodiesterase 10A [Source:Xenbase;Acc:XB-GENE-1013417])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 355/775 (45.81%), Postives = 503/775 (64.90%), Query Frame = 1
Query:  226 YMETSQTVMRIEAFSSYFS-CLKL-NLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN---------NISSISNSDLPNI---YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTE----QSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            Y ++S  + ++ AF  +F+  ++L + + IE K   ++DY DL   E ++  I    +E +   ++I+  M LA+H ++  +             +   + P +   +I+ R+ N+ P+    NL+A+  G +++L+G VV+V+ +KP+C+++ F C  C + Q    PD  K+AVPT+C    C+ +SF   + S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C LI+DLVD+CVPGD V VTGIV   +      ++  +   C+F L +  N++   KG      D   S+ A  +FS+KDLYAI+ I ++ NLF+L+V SLCP+IYGHELVKA L LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+ C +APR VY+CG + TT+GLTV+ S+D+ +G   LEAGAL++ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNK KTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++       QS + +  + +  +T      ++ P     ERL     E  D IP QLLRKY+ YA++YVHP LS +AA +LQ+FYL LRK+   +D TPITTRQLES++RLTEA+AR ELRE A + DA++V ++M  S++G +SDE G L+F RSQ GSGMS  S +KK IS L   +E++ ++ F +  ++QIA    I++ D E  V +LN+QG+LLKKGP  Y+L T
Sbjct:   47 YSDSSPFLEKVRAFEKFFTKQIELYDKDEIERKGSILVDYKDLLQDEDLSASI-PMSSELKEMPEKILECMGLAIHQVLTKDLERHAAELQEQEGLRTEEAPIVNVPFIHARVFNYDPLTPLKNLRASLYGKYVALRGTVVRVSNIKPLCVKMAFSCNMCGDIQSFPFPDG-KYAVPTKCPVPECRGRSFTANRSSPLTVTVDWQTIKVQELMSD--------------DQREAGRIPRTVECELIQDLVDSCVPGDMVTVTGIVKVSNTRDGGFKNKNN--KCMFLLYIEANSVSNSKGHKIKSTDDSESHGASMDFSLKDLYAIQEIQAQENLFQLIVNSLCPTIYGHELVKAGLSLALFGGCQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAVCNVAPRGVYVCGNTTTTSGLTVTLSRDSATGDFGLEAGALILGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGIVCSLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAMRAGAKEMQSADLTCPTTQNSNTSVLEEPSERP---LGERLKLRPGEHFDPIPHQLLRKYVGYARQYVHPTLSPDAAQVLQDFYLELRKQNQGIDSTPITTRQLESLIRLTEARARLELREKATKDDAEEVVQIMKYSLLGTFSDEFGKLDFHRSQHGSGMSNRSKAKKFISALNRIAEQTYNNLFEFQQLRQIAKELQIQVIDFEGFVGSLNDQGYLLKKGPRVYQLQT 799          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Xenopus
Match: pde10a (phosphodiesterase 10A [Source:Xenbase;Acc:XB-GENE-1013417])

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 358/802 (44.64%), Postives = 509/802 (63.47%), Query Frame = 1
Query:  136 SSTKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFS-CLKL-NLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN---------NISSISNSDLPNI---YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGS-TFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            ++  K  + +T+L    PY GW +YF  E Y ++S  + ++ AF  +F+  ++L + + IE K   ++DY DL   E ++  I    +E +   ++I+  M LA+H ++  +             +   + P +   +I+ R+ N+ P+    NL+A+  G +++L+G VV+V+ +KP+C+++ F C  C + Q    PD  K+AVPT+C    C+ +SF   + S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C LI+DLVD+CVPGD V VTGIV   +      ++  +   C+F L +  N++   KG      D   S+ A  +FS+KDLYAI+ I ++ NLF+L+V       Y  +LVKA L LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+ C +APR VY+CG + TT+GLTV+ S+D+ +G   LEAGAL++ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNK KTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++       +S+         S  S+ +EP      ERL     E  D IP QLLRKY+ YA++YVHP LS +AA +LQ+FYL LRK+   +D TPITTRQLES++RLTEA+AR ELRE A + DA++V ++M  S++G +SDE G L+F RSQ GSGMS  S +KK IS L   +E++ ++ F +  ++QIA    I++ D E  V +LN+QG+LLKKGP  Y+L T
Sbjct:   49 TAPPKPQLTQTTLDKYIPYKGWKLYFS-EAYSDSSPFLEKVRAFEKFFTKQIELYDKDEIERKGSILVDYKDLLQDEDLSASI-PMSSELKEMPEKILECMGLAIHQVLTKDLERHAAELQEQEGLRTEEAPIVNVPFIHARVFNYDPLTPLKNLRASLYGKYVALRGTVVRVSNIKPLCVKMAFSCNMCGDIQSFPFPDG-KYAVPTKCPVPECRGRSFTANRSSPLTVTVDWQTIKVQELMSD--------------DQREAGRIPRTVECELIQDLVDSCVPGDMVTVTGIVKVSNTRDGGFKNKNN--KCMFLLYIEANSVSNSKGHKIKSTDDSESHGASMDFSLKDLYAIQEIQAQENLFQLIVNDKI--FYVVQLVKAGLSLALFGGCQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAVCNVAPRGVYVCGNTTTTSGLTVTLSRDSATGDFGLEAGALILGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGIVCSLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAMRAGAKEMQSADLTCPTTQNSNTSVLEEPSERPLGERLKLRPGEHFDPIPHQLLRKYVGYARQYVHPTLSPDAAQVLQDFYLELRKQNQGIDSTPITTRQLESLIRLTEARARLELREKATKDDAEEVVQIMKYSLLGTFSDEFGKLDFHRSQHGSGMSNRSKAKKFISALNRIAEQTYNNLFEFQQLRQIAKELQIQVIDFEGFVGSLNDQGYLLKKGPRVYQLQT 828          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Mouse
Match: Mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:MGI Symbol;Acc:MGI:1913884])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 372/800 (46.50%), Postives = 520/800 (65.00%), Query Frame = 1
Query:  163 KTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN---------NISSISNS-----DLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQM-----DTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            +++L    PY GW +YF  E Y   S  + +I+AF  +F+   ++L   + IE K   ++D+ +L  ++ IT +I + +N  +   ++ +  M LA+H ++  +             +SN      ++P+IY   R+ N+ P+    N++A   G +IS++G VV+V+ +KP+C  + F+C  C   Q   LPD  K+ +PT+C    C+ +SF PL+ S  TVT+D+Q+I++QE  SD               +   GRIP+T+ C L+ DLVD+CVPGD V VTGIV     S +   S      C+F L +  N++   KG      +    +    EFS+KDLYAI  I +E NL KL+V SLCP I+GHELVKA L LALFGG  K+ +DKNR+ IRG+ H+LIVGDPGLGKSQMLQ+AC +APR VY+CG + T++GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKA+TV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ ++     +T     ++++P     ERL     E  D IP QLLRKYI YA++YVHP+LS++AA  LQ+FYL LRK+   +  +PITTRQLES++RLTEA+AR ELRE A  +DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L + +ER+ ++ F Y  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   59 QSTLDQFIPYKGWKLYFS-EVYSNNSPFIEKIQAFEKFFT-RHIDLYDKDEIERKGSILVDFKELTKADEITNLIPDIENALRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNGGETMVNVPHIY--ARVYNYEPLTHLKNIRATCYGKYISIRGTVVRVSNIKPLCTNMAFQCAACGEIQSFPLPDG-KYTLPTKCPVPACRGRSFAPLRSSPLTVTLDWQLIKIQELMSDA--------------QREAGRIPRTIECELVHDLVDSCVPGDTVTVTGIV---KVSNSEEGSRNKNDKCMFLLYIEANSVSNSKGPKAQTAEDGCKHGTLMEFSLKDLYAIREIQAEENLLKLVVNSLCPVIFGHELVKAGLTLALFGGSQKYADDKNRIPIRGDPHVLIVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTSSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKARTVSENLKMGSALLSRFDLVFILLDTPNEQHDHLLSEHVIAIRAGKQKAVSSATVTRVLSQDSNTSVLEVVSEKP---LSERLKVAPGEQTDPIPHQLLRKYIGYARQYVHPRLSTDAAQALQDFYLELRKQSQRVGSSPITTRQLESLIRLTEARARLELREEATREDAEDIIEIMKHSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNSIAERTYNNIFQYHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKIYQLQT 832          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Mouse
Match: Mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:MGI Symbol;Acc:MGI:1913884])

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 364/779 (46.73%), Postives = 508/779 (65.21%), Query Frame = 1
Query:  226 YMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN---------NISSISNS-----DLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQM-----DTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            Y   S  + +I+AF  +F+   ++L   + IE K   ++D+ +L  ++ IT +I + +N  +   ++ +  M LA+H ++  +             +SN      ++P+IY   R+ N+ P+    N++A   G +IS++G VV+V+ +KP+C  + F+C  C   Q   LPD  K+ +PT+C    C+ +SF PL+ S  TVT+D+Q+I++QE  SD               +   GRIP+T+ C L+ DLVD+CVPGD V VTGIV     S +   S      C+F L +  N++   KG      +    +    EFS+KDLYAI  I +E NL KL+V SLCP I+GHELVKA L LALFGG  K+ +DKNR+ IRG+ H+LIVGDPGLGKSQMLQ+AC +APR VY+CG + T++GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKA+TV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ ++     +T     ++++P     ERL     E  D IP QLLRKYI YA++YVHP+LS++AA  LQ+FYL LRK+   +  +PITTRQLES++RLTEA+AR ELRE A  +DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L + +ER+ ++ F Y  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   51 YSNNSPFIEKIQAFEKFFT-RHIDLYDKDEIERKGSILVDFKELTKADEITNLIPDIENALRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNGGETMVNVPHIY--ARVYNYEPLTHLKNIRATCYGKYISIRGTVVRVSNIKPLCTNMAFQCAACGEIQSFPLPDG-KYTLPTKCPVPACRGRSFAPLRSSPLTVTLDWQLIKIQELMSDA--------------QREAGRIPRTIECELVHDLVDSCVPGDTVTVTGIV---KVSNSEEGSRNKNDKCMFLLYIEANSVSNSKGPKAQTAEDGCKHGTLMEFSLKDLYAIREIQAEENLLKLVVNSLCPVIFGHELVKAGLTLALFGGSQKYADDKNRIPIRGDPHVLIVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTSSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKARTVSENLKMGSALLSRFDLVFILLDTPNEQHDHLLSEHVIAIRAGKQKAVSSATVTRVLSQDSNTSVLEVVSEKP---LSERLKVAPGEQTDPIPHQLLRKYIGYARQYVHPRLSTDAAQALQDFYLELRKQSQRVGSSPITTRQLESLIRLTEARARLELREEATREDAEDIIEIMKHSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNSIAERTYNNIFQYHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKIYQLQT 804          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Mouse
Match: Mcm2 (minichromosome maintenance complex component 2 [Source:MGI Symbol;Acc:MGI:105380])

HSP 1 Score: 290.426 bits (742), Expect = 6.766e-84
Identity = 210/642 (32.71%), Postives = 328/642 (51.09%), Query Frame = 1
Query:  310 EIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLP---DDYKFAVPTRCVNRVCKSKSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNC-LFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMM 2217
            E ++  +++Y DL + E+   V+  F  E      +I  E  L +  L        I+N      +I+VRI++   + +  +L+   +   I   G V     V P    VK+ C  C     V+ P      +   P  C    C+S    P +   +ET+  +YQ IR+QE+                  K   GR+P++ + IL+ DLVD+C PGDE+ +TGI        N+  S  + +   +F  ++  N++   K D K+ V        E + +D+  I  +  +  + + + AS+ PSIYGHE +K  L LALFGG  K    K++V  RG+ ++L+ GDPG  KSQ L+    ++ R+++  G   +  GLT    +   S    LEAGALV++D G C IDEFDKM+ Q   S+ EAMEQQSISI+KAG+V +L AR +V+AAANP  G Y+ + T +EN+ ++ P++SRFD++ ++ D  + V D  L+R V+  H      R   S ++ + ++ +  T EP        +YG     + +P ++L+KYI YAK+ V PKL+    + +   Y  LRK        PIT R +ESM+R+ EA AR  LR+   E D      +M+ES +
Sbjct:  225 ENRESLVVNYEDLAAREH---VLAYFLPEAPAELLQIFDEAALEV-VLAMYPKYDRITN------HIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCSKC---NFVLGPFCQSQNQEVKPGSCPE--CQSAG--PFEINMEETIYQNYQRIRIQESPG----------------KVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIY-----HNNYDGSLNTANGFPVFATIILANHVA--KKDNKVAV-------GELTDEDVKMITGLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKV--RGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHV-----RHHPSNKKDEGLT-NGGTLEPAMPN----TYG----VEPLPQEVLKKYIIYAKERVRPKLNQMDQDKVARMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVMEDDVNMAIRVMMESFI 803          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Mouse
Match: Mcm6 (minichromosome maintenance complex component 6 [Source:MGI Symbol;Acc:MGI:1298227])

HSP 1 Score: 287.73 bits (735), Expect = 9.312e-84
Identity = 211/678 (31.12%), Postives = 339/678 (50.00%), Query Frame = 1
Query:  385 FKNEFQFNCQ----------RIILEMCLALHTLV-------FANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKS-KSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMT-----------ESASTNFHQSSGSG-----------------SNCLFNLVLHVNNI-CRLKG-DVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHT--EQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTP-------ITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGI 2244
            F +  QFN Q          R+   +C AL T V       FA +   ++  DLP  +            K   L +++IG    + G VV+ + V P  +   F CL C+   I  +   +K+  P  C N VC + K F  L +++++  +D+Q +R+QET ++ P                 G IP++L  IL  + V++   GD    TG ++              A TN   S   G                 S  L  L  HV     R  G +++ +  +  S   + +VK+   +  +  + NL+  L  SL P+I+G++ VK  +LL LFGGV K   +    ++RG+ ++ IVGDP   KSQ L+     +PR+VY  G + + AGLT +  +D +S    +EAGAL+++DNG CCIDEFDKM  +   ++ EAMEQQ+ISI KAG+   L+ARTS+LAAANP +GHY+++K++ +N+ +SAP++SRFDL +I++D  NEV D  ++R ++ LH+  E+S++R                                  S D+I     R+Y+ +A+++  PK+S E+ + + E Y  LR+R    DG+        IT RQLESM+RL+E+ AR    +    +  K+   L+ +S++ V + ++ +
Sbjct:   65 FADLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPFAKDFY-VAFQDLPTRH------------KIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQT-VIKDVEQQFKYTQPNICRNPVCANRKRF--LLDTNKSRFVDFQKVRIQETQAELP----------------RGSIPRSLEVILRAEAVESAQAGDRCDFTGALIVVPDVSKLSTPGARAETNSRVSGADGYETEGIRGLRALGVRDLSYRLVFLACHVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGT--SLRGDINVCIVGDPSTAKSQFLKHVDEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRIEESIDRVY--------------------------------SLDDI-----RRYLLFARQF-KPKISKESEDFIVEQYKRLRQR----DGSGVTKSSWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNL 666          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Mouse
Match: Mcm6 (minichromosome maintenance complex component 6 [Source:MGI Symbol;Acc:MGI:1298227])

HSP 1 Score: 287.73 bits (735), Expect = 1.505e-83
Identity = 207/645 (32.09%), Postives = 324/645 (50.23%), Query Frame = 1
Query:  385 FKNEFQFNCQ----------RIILEMCLALHTLV-------FANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKS-KSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMT-----------ESASTNFHQSSGSG-----------------SNCLFNLVLHVNNI-CRLKG-DVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHT--EQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTP-------ITTRQLESMVRLTEAKAR 2145
            F +  QFN Q          R+   +C AL T V       FA +   ++  DLP  +            K   L +++IG    + G VV+ + V P  +   F CL C+   I  +   +K+  P  C N VC + K F  L +++++  +D+Q +R+QET ++ P                 G IP++L  IL  + V++   GD    TG ++              A TN   S   G                 S  L  L  HV     R  G +++ +  +  S   + +VK+   +  +  + NL+  L  SL P+I+G++ VK  +LL LFGGV K   +    ++RG+ ++ IVGDP   KSQ L+     +PR+VY  G + + AGLT +  +D +S    +EAGAL+++DNG CCIDEFDKM  +   ++ EAMEQQ+ISI KAG+   L+ARTS+LAAANP +GHY+++K++ +N+ +SAP++SRFDL +I++D  NEV D  ++R ++ LH+  E+S++R                                  S D+I     R+Y+ +A+++  PK+S E+ + + E Y  LR+R    DG+        IT RQLESM+RL+E+ AR
Sbjct:   65 FADLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPFAKDFY-VAFQDLPTRH------------KIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQT-VIKDVEQQFKYTQPNICRNPVCANRKRF--LLDTNKSRFVDFQKVRIQETQAELP----------------RGSIPRSLEVILRAEAVESAQAGDRCDFTGALIVVPDVSKLSTPGARAETNSRVSGADGYETEGIRGLRALGVRDLSYRLVFLACHVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGT--SLRGDINVCIVGDPSTAKSQFLKHVDEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRIEESIDRVY--------------------------------SLDDI-----RRYLLFARQF-KPKISKESEDFIVEQYKRLRQR----DGSGVTKSSWRITVRQLESMIRLSESMAR 633          
BLAST of DNA replication licensing factor MCM8 vs. UniProt/SwissProt
Match: sp|D3ZVK1|MCM8_RAT (DNA helicase MCM8 OS=Rattus norvegicus OX=10116 GN=Mcm8 PE=3 SV=1)

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 372/802 (46.38%), Postives = 520/802 (64.84%), Query Frame = 1
Query:  163 KTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLV----------------FANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQM-----DTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            +++L    PY GW +YF  E Y   S    +I+AF  +F+   ++L   + IE K   ++D+ +L     IT +I + +N  +   ++ +  M LA+H ++                  N   ++ N  +P+IY   R+ N+ P+    N++A   G +IS++G VV+V+ +KP+C ++ F+C  C   Q   LPD  K+ +PT+C    C+ +SF PL+ S  TVT+D+Q+I++QE  SD               +   GRIP+T+ C L+ DLVD+CVPGD V VTGIV     S +   S      C+F L +  N++   KG      +    +    EFS+KDLYAI+ I +E NL KL+V SLCP I+GHELVKA L+LALFGG  K+ +DKNR+ IRG+ H+LIVGDPGLGKSQMLQ+AC +APR VY+CG + T++GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKA+TV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ ++     +T     ++++P     ERL     E  D IP QLLRKYI YA++YVHP+LS+EAA  LQ+FYL LRK+   +  +PITTRQLES++RLTEA+AR ELRE A ++DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L + +ER+ ++ F +  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   56 QSTLDQFIPYKGWKLYFS-EVYSNNSPLTEKIQAFEKFFT-RHIDLYDKDEIERKGSILVDFKELTKDNEITNLIPDIENALRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLCNGGGTMVN--VPHIY--ARVYNYEPLTHLKNIRATCYGKYISIRGTVVRVSNIKPLCTKMAFQCAACGEIQSFPLPDG-KYNLPTKCPVPACRGRSFTPLRSSPLTVTMDWQLIKIQELMSDA--------------QREAGRIPRTIECELVHDLVDSCVPGDTVTVTGIV---KVSNSEEGSRSKNDKCMFLLYIEANSVSNSKGQKAQTAEDGCKHGTLMEFSLKDLYAIQEIQAEENLLKLIVNSLCPVIFGHELVKAGLMLALFGGSQKYADDKNRIPIRGDPHVLIVGDPGLGKSQMLQAACNVAPRGVYVCGNTATSSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKARTVSENLKMGSALLSRFDLVFILLDTPNEQHDHLLSEHVIAIRAGKQRAVSSATVSRVLSQDSNTSVLEVVSEKP---LSERLKVAPGEKTDPIPHQLLRKYIGYARQYVHPRLSTEAAQALQDFYLELRKQSQRVGSSPITTRQLESLIRLTEARARLELREEATKEDAEDIIEIMKHSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNSIAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKIYQLQT 829          
BLAST of DNA replication licensing factor MCM8 vs. UniProt/SwissProt
Match: sp|Q9CWV1|MCM8_MOUSE (DNA helicase MCM8 OS=Mus musculus OX=10090 GN=Mcm8 PE=1 SV=3)

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 372/800 (46.50%), Postives = 520/800 (65.00%), Query Frame = 1
Query:  163 KTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN---------NISSISNS-----DLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQM-----DTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            +++L    PY GW +YF  E Y   S  + +I+AF  +F+   ++L   + IE K   ++D+ +L  ++ IT +I + +N  +   ++ +  M LA+H ++  +             +SN      ++P+IY   R+ N+ P+    N++A   G +IS++G VV+V+ +KP+C  + F+C  C   Q   LPD  K+ +PT+C    C+ +SF PL+ S  TVT+D+Q+I++QE  SD               +   GRIP+T+ C L+ DLVD+CVPGD V VTGIV     S +   S      C+F L +  N++   KG      +    +    EFS+KDLYAI  I +E NL KL+V SLCP I+GHELVKA L LALFGG  K+ +DKNR+ IRG+ H+LIVGDPGLGKSQMLQ+AC +APR VY+CG + T++GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKA+TV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ ++     +T     ++++P     ERL     E  D IP QLLRKYI YA++YVHP+LS++AA  LQ+FYL LRK+   +  +PITTRQLES++RLTEA+AR ELRE A  +DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L + +ER+ ++ F Y  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   59 QSTLDQFIPYKGWKLYFS-EVYSNNSPFIEKIQAFEKFFT-RHIDLYDKDEIERKGSILVDFKELTKADEITNLIPDIENALRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNGGETMVNVPHIY--ARVYNYEPLTHLKNIRATCYGKYISIRGTVVRVSNIKPLCTNMAFQCAACGEIQSFPLPDG-KYTLPTKCPVPACRGRSFAPLRSSPLTVTLDWQLIKIQELMSDA--------------QREAGRIPRTIECELVHDLVDSCVPGDTVTVTGIV---KVSNSEEGSRNKNDKCMFLLYIEANSVSNSKGPKAQTAEDGCKHGTLMEFSLKDLYAIREIQAEENLLKLVVNSLCPVIFGHELVKAGLTLALFGGSQKYADDKNRIPIRGDPHVLIVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTSSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKARTVSENLKMGSALLSRFDLVFILLDTPNEQHDHLLSEHVIAIRAGKQKAVSSATVTRVLSQDSNTSVLEVVSEKP---LSERLKVAPGEQTDPIPHQLLRKYIGYARQYVHPRLSTDAAQALQDFYLELRKQSQRVGSSPITTRQLESLIRLTEARARLELREEATREDAEDIIEIMKHSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNSIAERTYNNIFQYHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKIYQLQT 832          
BLAST of DNA replication licensing factor MCM8 vs. UniProt/SwissProt
Match: sp|Q9UJA3|MCM8_HUMAN (DNA helicase MCM8 OS=Homo sapiens OX=9606 GN=MCM8 PE=1 SV=2)

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 378/803 (47.07%), Postives = 531/803 (66.13%), Query Frame = 1
Query:  139 STKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN------------NISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGD-VKMDVDS-ENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGS--TFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            STK    ++++L    PY GW +YF  E Y ++S  + +I+AF  +F+   ++L   + IE K   ++D+ +L     +T +I +   E +   ++ +  M LA+H ++  +             +S+   + +   +I+ R+ N+ P+ +  N++AN  G +I+L+G VV+V+ +KP+C ++ F C  C   Q   LPD  K+++PT+C   VC+ +SF  L+ S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C L+ DLVD+CVPGD V +TGIV   +A      S      C+F L +  N+I   KG   K   D  ++    EFS+KDLYAI+ I +E NLFKL+V SLCP I+GHELVKA L LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+AC +APR VY+CG + TT+GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKAKTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ +M++   ++   E  S     ERL     E+ D IP QLLRKYI YA++YV+P+LS+EAA +LQ+FYL LRK+   ++ +PITTRQLES++RLTEA+AR ELRE A ++DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L   +ER+ ++ F +  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   58 STKTPQSMQSTLDRFIPYKGWKLYFS-EVYSDSSPLIEKIQAFEKFFT-RHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDG-KYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSD--------------DQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEG---SRNKNDKCMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELVKAGLALALFGGSQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTTSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEHHDHLLSEHVIAIRAGKQRTISSATVARMNSQDSNTSVLEVVSEKPLSERLKVVPGETIDPIPHQLLRKYIGYARQYVYPRLSTEAARVLQDFYLELRKQSQRLNSSPITTRQLESLIRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQT 839          
BLAST of DNA replication licensing factor MCM8 vs. UniProt/SwissProt
Match: sp|I0IUP3|MCM8_CHICK (DNA helicase MCM8 OS=Gallus gallus OX=9031 GN=MCM8 PE=1 SV=1)

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 366/795 (46.04%), Postives = 516/795 (64.91%), Query Frame = 1
Query:  157 ILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLV---FANNISSIS-NSDLP-------NI-YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            +++++L    PY GW +YF  E Y + S  V + +AF  +F   ++ L   + IE K   ++DY +L     +TK I     E +   Q+I+  M LA+H ++      + + +     LP       N+  I+ R+ N+ P+ +  N++AN  G +I+L+G VV+V+ +KP+C ++ F C TC + Q V LPD  K+ +PT+C+   C+ +SF P + S  T T+D+Q +++QE  SD              D+   GRIP+T+ C L++DLVD+CVPGD V +TG+V    +ST    S      C+F L +  N++   KG    + + E    +  EFS+KDLYA++ I +E NLF+++V SLCP+IYGHE+VKA L LALFGG  KF +DKNR+ +RG+ H+LIVGDPGLGKSQMLQ+ C +APR VY+CG + T++GLTV+ S+D  SG  ALEAGALV+ D G C IDEFDKM + QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKAKTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+ + + +      +         ERL     E+ D IP QLLRKY+ YA++YVHP LS EAA +LQEFYL LRK+      TPITTRQLES++RLTEA++R ELRE   ++DA+DV E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ +S L + +ER+ S+ F+   ++Q+A    I++ D E+ + +LN+QG+LLKKG   Y+L T
Sbjct:   55 LVQSTLDQFIPYKGWKLYFS-EAYADKSPFVQKTQAFEKFF-MQRIELYDKDEIERKGSILVDYKELIEDRELTKSIPNISTELRDMPQKILQCMGLAIHQVLTKDLERHAAELQVQEGLPLDGEPIINVPLIHARLYNYEPLTQLKNVRANCYGKYIALRGTVVRVSNIKPLCTKLAFVCGTCGDVQSVPLPDG-KYTLPTKCLVPECRGRSFTPDRSSPLTATVDWQSVKVQELMSD--------------DQREAGRIPRTIECELVQDLVDSCVPGDVVTITGVVKV--SSTEEGASKNKNDKCVFLLYIEANSVSNSKGQKTKNFEEETFQRSFMEFSLKDLYAVQEIQAEENLFRIIVNSLCPAIYGHEIVKAGLALALFGGCQKFVDDKNRIPVRGDPHVLIVGDPGLGKSQMLQAVCNVAPRGVYVCGNTSTSSGLTVTLSRDGASGDFALEAGALVLGDQGICGIDEFDKMGS-QHQALLEAMEQQSISLAKAGIVCSLPARTSIVAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAIRAGKQAVCSSAVVSRTNVQDRSVLEVVSDRPLLERLKISPGENFDAIPHQLLRKYVGYARQYVHPHLSPEAAQVLQEFYLELRKQNQGASSTPITTRQLESLIRLTEARSRLELREKCTKEDAEDVIEIMKYSMLGTYSDEFGKLDFERSQHGSGMSNRSQAKRFVSALSSIAERTYSNLFDLQQLRQVAKELQIRVFDFESFIESLNDQGYLLKKGSRLYQLQT 829          
BLAST of DNA replication licensing factor MCM8 vs. UniProt/SwissProt
Match: sp|E1BPX4|MCM8_BOVIN (DNA helicase MCM8 OS=Bos taurus OX=9913 GN=MCM8 PE=3 SV=2)

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 375/797 (47.05%), Postives = 521/797 (65.37%), Query Frame = 1
Query:  157 ILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVF-----------ANNISSISNSDLPNI-YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGS--TFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            +L+++L    PY GW +YF  E Y ++   + +IEAF S+F+  ++ L   + IE K   ++D+ +L + + I K+I    NE +   ++ +  M LA+H ++            A    S +   + N+ +I+ R+ N+ P+ +  N++AN  G +I+L+G VV+V+  KP+C ++ F C  C   Q + LPD  K+ +PT+C    C+ KSF  L+ S  TVT+D+Q I++QE  SD              D+   GRIP+T+ C L+ DLVD+CVPGD V +TG+V   +A                      N++   KG      +    + A  EFS+KDLYAI+ I SE NLFKL+V SLCP I+GHELVKA L LALFGG  K+ +DKNR+ IRG+ H+L+VGDPGLGKSQMLQ+ C++APR VY+CG + TT+GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAGMVC+L ARTS++AAANP  GHYNKAKTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ +M++   ++   E  S     ERL     E+ D IP QLLRKYI Y+++YV+P+LS+EAA ILQ FYL LRK+   +  +PITTRQLES++RLTEA+AR ELRE A ++DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  SA+K+ IS L   +ER+ ++ F +  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   56 LLQSTLDHFIPYKGWKLYFS-EVYSDSIPFIEKIEAFESFFT-ERIELYDKDEIERKGSILVDFKELINDDEIIKLIPNIANELRDTPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSRNGETVVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNTKPLCTKMAFLCAACGEIQSLSLPDG-KYNLPTKCPVPACRGKSFTALRSSPLTVTMDWQSIKIQELMSD--------------DQREAGRIPRTIECELVHDLVDSCVPGDTVTITGVVKVSNAE-------------------EANSVSNNKGQKTKASEDGCKHGALMEFSLKDLYAIQEIQSEENLFKLIVNSLCPVIFGHELVKAGLALALFGGSQKYADDKNRIPIRGDPHVLVVGDPGLGKSQMLQAVCSVAPRGVYVCGNTTTTSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGMVCSLPARTSIIAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVIAIRAGKQRAVSSATVARMNSQDSNTSILEVVSDKPLSERLKVVPGETIDPIPHQLLRKYIGYSRQYVYPRLSTEAAQILQNFYLELRKQSQRLSSSPITTRQLESLIRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGMSNRSAAKRFISALNKIAERTYNNLFQFHQLQQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQT 815          
BLAST of DNA replication licensing factor MCM8 vs. TrEMBL
Match: A0A1S3JYB5 (DNA helicase MCM8 OS=Lingula unguis OX=7574 GN=LOC106177222 PE=3 SV=1)

HSP 1 Score: 728.398 bits (1879), Expect = 0.000e+0
Identity = 392/788 (49.75%), Postives = 519/788 (65.86%), Query Frame = 1
Query:  187 PYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLK--LNLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFANNISSISNSD-----LPNI-------YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSN---CLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLTAGF 2496
            PY GW  YFP E Y   S TV R++ F  YF   K   N E IE K H  +D+ +LC    I   + +     +   ++++  + LALH  V ++ +      D     LP +        I+ RI N  PI +  NL+A+  G F+S+KG VV+V+ +KP+C ++ F C +C+  Q V+LPD  K+ VPT+CVN  CK+++F PL+ S  T TID+Q IR+QE  +D              D  + GRIP+T++C L  DLVD+CVPGD V V+GIV   S         G G N   C+F L LH N++   KG        E     +F++K+LYAIE I SE  LF+L+V SLCPSIYGHE+VKA L+L LFGG  K+ NDKNR+ +RG+ HIL+VGDPGLGKSQMLQ+   +APRSVY+CG + T++GLTV+ SK+  SG  ALEAGALV++D GCCCIDEFDKM + QH +LLEAMEQQSISIAKAG+VC+L ARTS+LAAANP  GHYNK KTV+ENLKM + LLSRFDLV+I+LD+P+E +DS LS HV+++H  +      ++ R+    +      E      ER+     E+ D IPPQLLRKY+ YA+KYVHPK++ EAA ++Q+FYL LRK+    D TPITTRQLES++RLTEA+AR ELRE A E DAKDV ++M  SM+  YS+ELG L+F RSQ GSGMS  +  K+LI+ LQ  SE + +S F   +++QIA +A I++ D E+ +++LN QGFLLKKGP  Y+L TAGF
Sbjct:   94 PYKGWRFYFPEEAYSPHSPTVTRVQVFEKYFINWKALYNAENIESKGHFTVDFKELCQDPVIQDGLSDLAALLKEMPEQMVNAIGLALHQ-VLSSGLEQDVQGDSEDPFLPPLSAPYSLPVIHARILNHEPITQLKNLKAHYYGKFVSVKGTVVRVSNIKPLCTKMAFECNSCRTVQSVILPDG-KYVVPTKCVNTNCKARTFIPLRSSHLTETIDWQTIRVQEIITD--------------DMRDSGRIPRTVDCELTNDLVDSCVPGDIVTVSGIVKVTSTE------KGRGRNKDKCMFLLYLHANSVNNSKG--PKSGAGEQGLAIDFTLKELYAIEEIQSEKKLFRLIVGSLCPSIYGHEMVKAGLVLGLFGGSQKYANDKNRIPVRGDPHILVVGDPGLGKSQMLQAVAGVAPRSVYVCGNTTTSSGLTVTLSKEGGSGDYALEAGALVLADQGCCCIDEFDKMGS-QHQALLEAMEQQSISIAKAGIVCSLPARTSILAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDKPDEEMDSMLSEHVMAMHAGKKRILQGTTARRNQEQNEAYSEWEADKPLSERIKVPRGENLDVIPPQLLRKYVGYARKYVHPKITKEAAKVIQQFYLDLRKQHQSRDSTPITTRQLESLIRLTEARARLELREEATEHDAKDVVDIMKFSMIDTYSNELGFLDFERSQHGSGMSSKAQGKRLIAALQKMSETTYNSLFTVQEMRQIAQSAGIQVRDFEDFISSLNNQGFLLKKGPRVYQLQTAGF 856          
BLAST of DNA replication licensing factor MCM8 vs. TrEMBL
Match: A0A0L8GIE4 (MCM domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22033113mg PE=3 SV=1)

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 376/782 (48.08%), Postives = 513/782 (65.60%), Query Frame = 1
Query:  157 ILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLK--LNLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN----NISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKL 2481
            +++  L    PY GW++YFP E Y   S TV +++ F  YFS  +   NL  IE ++H  + + ++ S   IT    +F  E + + ++II  + LA+H L+       + SS ++S LP IY   RI     I +  N++AN  G F+++KG VV+V  VKP+CI+++F C +C N +I++LPD  K+  P +C +  C+S+ F P + S +T +ID+Q IRLQE               +  D+   GRIP+T+ C L  DLVD+CVPGD V + GIV     +T+    S +   CLF L +  N++   KG              +F++K+LYAI+ IHSE +LF+LLV SLC SI GHE+VKA L+L LFGG  +F NDK+ VAIRG+ HIL+VGDPGLGKSQMLQ+   +APRSVY+CG S T +GLTV+  K+  S   ALEAGALV++D GCCCIDEFDKM   QH +LLEAMEQQSISIAKAG+VC+L AR S++AAANP  GHY+KA+TV+ENLKM   LLSRFDLV+I+LD+P+EV D+ LS HV+++H  +    S    +  DT SF  ++     T  ERL+    E  D IPPQL RKY+ YA+KYVHPK+  EAA++LQ+FYL LR++ H  D TPITTRQLES++RLTEA+AR+ELRE A ++DA+DV  +M  SM   YSDE G+L+F RSQ GSGMS  S  KK I+LLQ  +E++ +S F   ++K++A   N ++ D E  + +LN  G+LLKKGP  Y+L
Sbjct:   70 LVQNKLAFASPYKGWILYFPEEAYTAESPTVEKLKVFEEYFSKYEQLYNLYDIETQRHFYVSFAEMASDNIITTRFPDFPKELRDSPEKIIKCLGLAMHQLILTKRKEEHDSSETDSYLPMIY--ARIKECDNIVQLKNIKANYYGKFVTVKGTVVRVGNVKPLCIKMEFECNSCSNLEIILLPDG-KYVTPQKCTSSGCRSRVFHPKQSSPKTESIDWQTIRLQE---------------VMGDQNETGRIPRTIECDLTNDLVDSCVPGDTVSIAGIV---KVNTSNEGHSRNKDKCLFLLYIQANSVTNPKGKT---TGESAGLAMDFTMKELYAIQEIHSEKHLFRLLVGSLCSSICGHEMVKAGLVLGLFGGTQRFANDKDCVAIRGDPHILMVGDPGLGKSQMLQAVSNVAPRSVYVCGNSTTVSGLTVTLCKETGSNDHALEAGALVLADQGCCCIDEFDKMK-HQHQALLEAMEQQSISIAKAGIVCSLPARASIIAAANPIGGHYSKARTVSENLKMGNALLSRFDLVFILLDKPDEVKDNMLSSHVMAMHAGKKWKVSPFFTKSQDT-SFEDLS---NMTLQERLTIHPYEKIDLIPPQLFRKYVGYARKYVHPKIGKEAASVLQKFYLDLRRQHHSRDSTPITTRQLESLIRLTEARARAELREEATKEDAEDVITIMKYSMKETYSDEFGMLDFRRSQHGSGMSSRSQHKKFITLLQRKAEKTYNSIFTVQEMKELAKELNFQMIDFEGFLTSLNNHGYLLKKGPKVYQL 822          
BLAST of DNA replication licensing factor MCM8 vs. TrEMBL
Match: A0A3B3T3T5 (Minichromosome maintenance 8 homologous recombination repair factor OS=Paramormyrops kingsleyae OX=1676925 PE=3 SV=1)

HSP 1 Score: 686.411 bits (1770), Expect = 0.000e+0
Identity = 385/811 (47.47%), Postives = 531/811 (65.47%), Query Frame = 1
Query:  136 SSTKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN----NISSISNSDLP-------NI-YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSN----CLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMS-----FHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
              +++  + +T+L+  C Y GW +YF  E +ME+S  V +I+AF  YFS  ++ L   + IE K   ++DY DL   E ++        EF+   ++++  + LA+H ++  +     +       LP       NI YIN R+ NF P+     L+AN  G +++L+G VV+V+ +KP+C ++ F C  C + Q   LPD  KFA PT+C+   C+S+SF P + S  T+T+DYQ I++QE  SD              D+   GRIP+T+ C L +DLVD+ VPGD V +TG+V   S         G G N    C+F L L  N+I   KG    +     S  A  EFS+KDLYAI+ I ++ +L KL+V SLCP+IYGH LVKA L+LALFGG  K+ +DKNR+ IRG+ HIL+VGDPGLGKSQMLQ+ C +APR VY+CG + TT+GLTV+ S+D+ SG  ALEAGALV+SD G CCIDEFDKM + QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNK KTV+ENLKM + LLSRFDLV+I+LD PNE  D  +S HV+++ + +++ R+ +++   DT         ++  +P S   E L  G +ES D IP QLLRKYI YA+ YVHPKLS+EAA +LQ+FYL LR++    D TPITTRQLES++RLTEA+AR ELRE+A + DA+DV E+M  S++  YSDE G ++F RSQ GSGMS  S  KK ++ L   +ER+  + F Y  ++Q+A+  NI+++D E  ++ LNEQG+LLKKGP +Y+L T
Sbjct:   83 GGSQQPQMSQTTLIEKCHYKGWRLYFS-EAFMESSPYVQKIQAFERYFSS-RIELYDKDEIERKGSILVDYKDLIQDEQLSLAQPTLATEFKDMPEKLLDCLGLAIHQVLTMDLERHAVELQGQEGLPSGTAAVVNIPYINARVYNFEPLTPLKMLKANLYGKYVALRGTVVRVSNIKPLCAKMAFVCNNCGDTQSFHLPDG-KFATPTKCLQPGCRSRSFTPNRSSPLTLTVDYQTIKVQELISD--------------DQREAGRIPRTIECELTQDLVDSSVPGDTVTITGVVKVSS-------EEGYGRNKKDRCMFLLFLKANSISNSKGQKSKEEAEPESQGALVEFSLKDLYAIQEIQAQGDLLKLIVHSLCPTIYGHLLVKAGLVLALFGGCQKYMDDKNRIPIRGDPHILVVGDPGLGKSQMLQAVCNVAPRGVYVCGNTTTTSGLTVTLSRDSASGDYALEAGALVLSDQGICCIDEFDKMGS-QHQALLEAMEQQSISLAKAGIVCSLPARTSIVAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDYDHMVSDHVIAMRSGKTVVRAGATVSHTDTRESEISILEAVGDKPIS---ESLKVGPRESLDLIPHQLLRKYIGYARHYVHPKLSAEAAQVLQDFYLELRRQNQSADSTPITTRQLESLIRLTEARARLELREVATKSDAEDVVEIMKHSLLDTYSDEFGRIDFDRSQLGSGMSNRSQKKKFVAALNRMAERTYKTVFEYQQLRQLAMELNIQVADFEGFISGLNEQGYLLKKGPKTYQLQT 865          
BLAST of DNA replication licensing factor MCM8 vs. TrEMBL
Match: G3GSC8 (DNA replication licensing factor MCM8 OS=Cricetulus griseus OX=10029 GN=I79_000451 PE=3 SV=1)

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 378/804 (47.01%), Postives = 527/804 (65.55%), Query Frame = 1
Query:  157 ILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFS--CLKLNLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFAN------------NISSISNS--DLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVM---TESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDS--ENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQM-----DTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            +L+++L    PY GW +YF  E Y  +S  + +I+AF  +F+      + + IE K   ++D+ +L   + IT +I + +N  +   ++ +  M LA+H ++  +             +SS   +  ++P+I+   R+ N+ P+    N++AN  G +IS++G VV+V  +KP+C ++ FRC  C   Q   LPD  K+ +PT+C    C+ KSF PL+ S  TVT+D+Q+I++QE  SD               +   GRIP+T+ C L+ DLVD+CVPGD V +TGIV    TE  S N          C+F L +  N++   KG      +   ++    EFS+KDLYAI+ I +E NL KL+V SLCP I+GHELVKA L+LALFGG  K+ +DKNR+ IRG+ HILIVGDPGLGKSQMLQ+AC +APR VY+CG + T++GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKAKTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ +      +T     ++++P     ERL     E+ D IP QLLRKY+ YA++YVHPKLS+EAA  LQ+FYL LRK+   M  +PITTRQLES++RLTEA+AR ELRE A ++DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L + +ER+ ++ F +  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   57 LLQSTLDQFIPYKGWKLYFS-EVYSNSSPFIEKIQAFEKFFTRHIDFYDKDEIERKGSILVDFKELTKDDEITNLIPDIENTLRDTPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSSDGETMVNVPHIF--ARVYNYEPLTHLKNVRANCYGKYISIRGTVVRVGNIKPLCTKMAFRCAACGEIQSFPLPDG-KYNLPTKCPVPACRGKSFTPLRSSPLTVTVDWQLIKIQELMSDA--------------QREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNTEEGSRN------KNDKCMFLLYIEANSVSNSKGQKAQTAEDGCQHGTLMEFSLKDLYAIQEIQAEENLLKLIVNSLCPVIFGHELVKAGLVLALFGGSQKYADDKNRIPIRGDPHILIVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTSSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEQHDHLLSEHVIAIRAGKQRAVSSATVARALSQDSNTSVLEVVSEKP---LSERLKVAPGETTDPIPHQLLRKYVGYARQYVHPKLSTEAAQALQDFYLELRKQSQRMSSSPITTRQLESLIRLTEARARLELREEATKEDAEDIIEIMKHSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNSIAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKIYQLQT 832          
BLAST of DNA replication licensing factor MCM8 vs. TrEMBL
Match: A0A1U7QLN4 (DNA helicase MCM8 isoform X1 OS=Mesocricetus auratus OX=10036 GN=Mcm8 PE=3 SV=1)

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 377/806 (46.77%), Postives = 527/806 (65.38%), Query Frame = 1
Query:  157 ILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFS--CLKLNLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLV----------------FANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVM---TESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDS--ENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQM-----DTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            +L+++L    PY GW +YF  E Y  +S  + + +AF  +F+      + + IE K   ++D+ +L   + IT +I + +N  +   ++ +  M LA+H ++                 +N+  ++ N  +P+I+   R+ N+ P+    N++AN  G +IS++G VV+V  +KP+C ++ FRC  C   Q + LPD  K+ +PT+C    C+ KSF PL+ S  TVT+D+Q+I++QE  SD               +   GRIP+T+ C L+ DLVD+CVPGD V +TGIV    TE  S N          C+F L +  N++   KG      +   ++    EFS+KDLYAI+ I +E NL KL+V SLCP I+GHELVKA L+LALFGG  K+ +DKNR+ IRG+ HILIVGDPGLGKSQMLQ+AC +APR VY+CG + T++GLTV+ SKD+ SG  ALEAGALV+ D G C IDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNKAKTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS HV+++   +    SS+++ +      +T     ++++P     ERL     E+ D IP QLLRKY+ YA++YVHPKLS+EAA  LQ+FYL LRK+   M  +PITTRQLES++RLTEA+AR ELRE A ++DA+D+ E+M  SM+G YSDE G L+F RSQ GSGMS  S +K+ IS L + +ER+ ++ F +  ++QIA   NI+++D EN + +LN+QG+LLKKGP  Y+L T
Sbjct:   57 LLQSTLDQFIPYKGWKLYFS-EVYSNSSPFIEKTQAFEKFFTRHIDFYDKDEIERKGSILVDFKELTKDDEITDLIPDIENALRDTPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVN--VPHIF--ARVYNYEPLTHLKNVRANCYGKYISIRGTVVRVGNIKPLCTKMAFRCAACGEIQSIPLPDG-KYNLPTKCPVSACRGKSFAPLRSSPLTVTVDWQLIKIQELMSDA--------------QREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNTEEGSRN------KNDKCMFLLYIEANSVSNSKGQKAQTAEDGCQHGTLMEFSLKDLYAIQEIQAEENLLKLIVNSLCPVIFGHELVKAGLVLALFGGSQKYADDKNRIPIRGDPHILIVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTSSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKM-GNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEQHDHLLSEHVIAIRAGKQRAVSSATVARALSQDSNTSVLEVVSEKP---LSERLKVAPGETTDPIPHQLLRKYVGYARQYVHPKLSTEAAQALQDFYLELRKQSQRMSSSPITTRQLESLIRLTEARARLELREEATKEDAEDIIEIMKHSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNSIAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKIYQLQT 832          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Cavefish
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:NCBI gene;Acc:103047810])

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 363/803 (45.21%), Postives = 513/803 (63.89%), Query Frame = 1
Query:  157 ILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLV------FANNIS---SISNSDLPNI---YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSN----CLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSI----RQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            + + +L   CPY GW +YF  E ++E++  V +I+ F  YF+  +++L   + IE K   ++DY DL  ++ I+  + +   E +    +I+  + LA+H ++       A+ +     +     P I   +I+ RI N+ P+     L+AN  G F++++G VV+V+ +KP+C ++ F C +C + Q + LPD  K+  P++C  + C+ + F P + S  T+T+D+Q I++QE  SD              D+   GRIP+T+ C L +DLVD+CVPGD V +TGI+   +         GSG N    C+F L ++ N++   KG          S  A  EFS+KDLY I+ I ++ +LFKL+V SLCP+IYGH LVKA L LALFGG  K+ +DKNR+ IRG+ H+L+VGDPGLGKSQMLQ+ C ++PR +Y+CG + T++GLTVS S+D+ SG  ALEAGALV+ D G CCIDEFDKM   QH +LLEAMEQQSIS+AKAG+VC L ARTS++AAANP  GHYNK KTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS H++++   +    SS+++     Q   +S   ++ +      +RL     E+ D IP QLLRKY+ YA+ YVHP LS+EAA +LQ+FYL LRK+    D TPITTRQLES++RLTEA+AR ELRE A E DA+DV ++M  S+   YSDE G L+F RSQ GSGMS  S  KK +  L   +ERS  + F+ P+++Q+A    I++ D E  ++ LNEQG+LLKKG   Y+L T
Sbjct:  112 VTQATLDITCPYKGWRLYFS-EGFVESTPYVEKIKTFEQYFTS-QIDLYDKDEIERKGSILVDYKDLLLNKQISAALPDLARELRDMPDKILDCLGLAIHQVLTKDLERHADELQVQEGLPTEATPIINIPHISARIYNYEPLTPLKMLRANIYGKFVAIRGTVVRVSNIKPLCSKMAFICNSCGDTQSLDLPDG-KYTTPSKCPQKECRGRIFTPNRSSPLTLTVDWQTIKVQELISD--------------DQRESGRIPRTIECELTQDLVDSCVPGDMVTITGIIKVSN-------EEGSGRNKKDKCMFLLYINANSVSNSKGQKSKSASEPESQGASVEFSLKDLYGIQEIQAQEDLFKLIVNSLCPAIYGHLLVKAGLALALFGGCQKYVDDKNRIPIRGDPHVLVVGDPGLGKSQMLQAVCNVSPRGIYVCGNTTTSSGLTVSLSRDSGSGDYALEAGALVLGDQGICCIDEFDKM-GNQHQALLEAMEQQSISLAKAGIVCTLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHMLSEHIMAMRAGKKGMVSSAAVARNCTQESNISILEISSD--QPLSDRLKVLPGENFDPIPHQLLRKYVGYARHYVHPNLSAEAAQVLQDFYLELRKQNQSADSTPITTRQLESLIRLTEARARLELREKATESDAEDVVDIMKHSLADTYSDEFGRLDFDRSQLGSGMSNRSKVKKFVVALNQIAERSHRTLFDLPELRQLAKELQIQVVDFEGFISALNEQGYLLKKGHKKYQLQT 887          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Cavefish
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:NCBI gene;Acc:103047810])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 359/796 (45.10%), Postives = 507/796 (63.69%), Query Frame = 1
Query:  172 LVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLV------FANNIS---SISNSDLPNI---YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSN----CLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGS--TFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
            L SN  +  +  +F +  ++E++  V +I+ F  YF+  +++L   + IE K   ++DY DL  ++ I+  + +   E +    +I+  + LA+H ++       A+ +     +     P I   +I+ RI N+ P+     L+AN  G F++++G VV+V+ +KP+C ++ F C +C + Q + LPD  K+  P++C  + C+ + F P + S  T+T+D+Q I++QE  SD              D+   GRIP+T+ C L +DLVD+CVPGD V +TGI+   +         GSG N    C+F L ++ N++   KG          S  A  EFS+KDLY I+ I ++ +LFKL+V SLCP+IYGH LVKA L LALFGG  K+ +DKNR+ IRG+ H+L+VGDPGLGKSQMLQ+ C ++PR +Y+CG + T++GLTVS S+D+ SG  ALEAGALV+ D G CCIDEFDKM   QH +LLEAMEQQSIS+AKAG+VC L ARTS++AAANP  GHYNK KTV+ENLKM + LLSRFDLV+I+LD PNE  D  LS H++++   +    SS+++ +  T   +    E  S     +RL     E+ D IP QLLRKY+ YA+ YVHP LS+EAA +LQ+FYL LRK+    D TPITTRQLES++RLTEA+AR ELRE A E DA+DV ++M  S+   YSDE G L+F RSQ GSGMS  S  KK +  L   +ERS  + F+ P+++Q+A    I++ D E  ++ LNEQG+LLKKG   Y+L T
Sbjct:   13 LFSNLKFKSF--FFIIIGFVESTPYVEKIKTFEQYFTS-QIDLYDKDEIERKGSILVDYKDLLLNKQISAALPDLARELRDMPDKILDCLGLAIHQVLTKDLERHADELQVQEGLPTEATPIINIPHISARIYNYEPLTPLKMLRANIYGKFVAIRGTVVRVSNIKPLCSKMAFICNSCGDTQSLDLPDG-KYTTPSKCPQKECRGRIFTPNRSSPLTLTVDWQTIKVQELISD--------------DQRESGRIPRTIECELTQDLVDSCVPGDMVTITGIIKVSN-------EEGSGRNKKDKCMFLLYINANSVSNSKGQKSKSASEPESQGASVEFSLKDLYGIQEIQAQEDLFKLIVNSLCPAIYGHLLVKAGLALALFGGCQKYVDDKNRIPIRGDPHVLVVGDPGLGKSQMLQAVCNVSPRGIYVCGNTTTSSGLTVSLSRDSGSGDYALEAGALVLGDQGICCIDEFDKM-GNQHQALLEAMEQQSISLAKAGIVCTLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHMLSEHIMAMRAGKKGMVSSAAVARNCTQESNISILEISSDQPLSDRLKVLPGENFDPIPHQLLRKYVGYARHYVHPNLSAEAAQVLQDFYLELRKQNQSADSTPITTRQLESLIRLTEARARLELREKATESDAEDVVDIMKHSLADTYSDEFGRLDFDRSQLGSGMSNRSKVKKFVVALNQIAERSHRTLFDLPELRQLAKELQIQVVDFEGFISALNEQGYLLKKGHKKYQLQT 782          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 297.745 bits (761), Expect = 8.131e-87
Identity = 200/574 (34.84%), Postives = 291/574 (50.70%), Query Frame = 1
Query:  508 INVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNC--LFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDN-DSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMM 2217
            I+VRI N   + +  +L+   +   I   G V     V P    VK+ C  C            +   P  C     + +S  P +   ++TV  +YQ I +QE+                  K   GR+P++ + IL+ DLVD+C PGDE+ +TGI        N +  S + +N   +F  V+  N+I R    V +         AE + +D+ AI A+  +  + + + AS+ PSIYGHE +K  L LALFGG  K    K++V  RG+ ++L+ GDPG  KSQ L+    +A R+V+  G   +  GLT    +        LEAGALV++D G C IDEFDKM+ Q   S+ EAMEQQSISI+KAG+V +L AR +V+AAANP  G Y+ + T +EN+ ++ P++SRFD++ ++ D  + V D  L+R V+  H +                  H   KE G    E +   +      IP +LLRKYI YAK+ V PKL+    + +   Y  LRK        PIT R +ESM+R+ EA AR  LR+   E D      +MLES +
Sbjct:  260 IHVRIGNLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQNQEVKPGSC----PECQSLGPFEINMEQTVYQNYQRITIQESPG----------------KVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIY------HNNYDGSLNMANGFPVFATVILANHIARKDDRVAV---------AELTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKV--RGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKH-----------------HPSNKEGGVAGLEEVVLPNSSDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVMLESFI 779          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 297.745 bits (761), Expect = 9.054e-87
Identity = 200/574 (34.84%), Postives = 291/574 (50.70%), Query Frame = 1
Query:  508 INVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNC--LFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDN-DSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMM 2217
            I+VRI N   + +  +L+   +   I   G V     V P    VK+ C  C            +   P  C     + +S  P +   ++TV  +YQ I +QE+                  K   GR+P++ + IL+ DLVD+C PGDE+ +TGI        N +  S + +N   +F  V+  N+I R    V +         AE + +D+ AI A+  +  + + + AS+ PSIYGHE +K  L LALFGG  K    K++V  RG+ ++L+ GDPG  KSQ L+    +A R+V+  G   +  GLT    +        LEAGALV++D G C IDEFDKM+ Q   S+ EAMEQQSISI+KAG+V +L AR +V+AAANP  G Y+ + T +EN+ ++ P++SRFD++ ++ D  + V D  L+R V+  H +                  H   KE G    E +   +      IP +LLRKYI YAK+ V PKL+    + +   Y  LRK        PIT R +ESM+R+ EA AR  LR+   E D      +MLES +
Sbjct:  269 IHVRIGNLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQNQEVKPGSC----PECQSLGPFEINMEQTVYQNYQRITIQESPG----------------KVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIY------HNNYDGSLNMANGFPVFATVILANHIARKDDRVAV---------AELTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKV--RGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKH-----------------HPSNKEGGVAGLEEVVLPNSSDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVMLESFI 788          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 296.975 bits (759), Expect = 1.311e-86
Identity = 200/574 (34.84%), Postives = 291/574 (50.70%), Query Frame = 1
Query:  508 INVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNC--LFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDN-DSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMM 2217
            I+VRI N   + +  +L+   +   I   G V     V P    VK+ C  C            +   P  C     + +S  P +   ++TV  +YQ I +QE+                  K   GR+P++ + IL+ DLVD+C PGDE+ +TGI        N +  S + +N   +F  V+  N+I R    V +         AE + +D+ AI A+  +  + + + AS+ PSIYGHE +K  L LALFGG  K    K++V  RG+ ++L+ GDPG  KSQ L+    +A R+V+  G   +  GLT    +        LEAGALV++D G C IDEFDKM+ Q   S+ EAMEQQSISI+KAG+V +L AR +V+AAANP  G Y+ + T +EN+ ++ P++SRFD++ ++ D  + V D  L+R V+  H                 +  H   KE G    E +   +      IP +LLRKYI YAK+ V PKL+    + +   Y  LRK        PIT R +ESM+R+ EA AR  LR+   E D      +MLES +
Sbjct:  260 IHVRIGNLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQNQEVKPGSC----PECQSLGPFEINMEQTVYQNYQRITIQESPG----------------KVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIY------HNNYDGSLNMANGFPVFATVILANHIARKDDRVAV---------AELTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKV--RGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSH-----------------IKHHPSNKEGGVAGLEEVVLPNSSDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVMLESFI 779          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Sea Lamprey
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:ZFIN;Acc:ZDB-GENE-120927-1])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 363/813 (44.65%), Postives = 517/813 (63.59%), Query Frame = 1
Query:  136 SSTKKVNILKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYF-SCLKL-NLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVF--------------ANNISS---ISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTR---CVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA---EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMD-----TMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKL 2481
            SS+    +L+T+L   CPY GW +YFP E Y  +   V ++E F  +F + L+L N + IE K   ++D+ +L     +T  +    ++      R++  M LA+H +                   I+S   +  ++LP +     I N+ P+ +  NL+AN  G  ++++G VV+V  +KP+C R+ F C  C  EQ++ LP   KF +PT+   C +  C+S++F P + S  T T+D+Q I++QE               +H ++   GRIP+T+ C L  DLVD+CVPGD + +TGIV  + AS++  ++  +   C+F L +    +   KG  + D   E++      +FS+K+LYA++ I ++P+LF+LLV S+CP+IYGHELVKA L LALFGGV ++G DKNR+ +RG+ H+LIVGDPGLGKSQMLQ+ C IAPR VY+CG + TTAGLTV+ SKD  SG  ALEAGALV+ D G CCIDEFDKM   QH +LLEAMEQQSIS+AKAG+VC+L ARTS++AAANP  GHYNK+KTV+ENLKM + LLSRFDLV+I++D P+E  D  LS HV+++H  + +   +S  R        T S  S     G +  +RL     E+ D +P  LLRKY+ YA++YV P LS+EAA  LQ+FYL LR++ H  DGTPITTRQLES++RLTEA+AR ELRE A ++DA DV ++M  S     SDELG L+F R+Q GSGMS  SA+K+ ++ L   SE+  ++ F    ++Q+A +  ++++D E  +++LN QGFLL KG   Y+L
Sbjct:   55 SSSCHARVLQTTLDDFCPYPGWKLYFPSEVYCNSGGIVTKVEVFEKFFFARLELYNKDEIEEKGSILVDFKELVEDHCLTVAMPTLADDLAETPDRVLQYMGLAVHQVYLHCTPRLEIRISDLEEQKITSHGAVLRANLPTLPYRQIIYNYEPLTQLKNLRANCYGRLVAIRGTVVRVGNIKPLCTRLAFSCNACGTEQVLRLPYG-KFTLPTKRVKCADEDCRSRTFMPNRRSQLTETVDWQNIKVQEL--------------MHGEQREAGRIPRTVECELTHDLVDSCVPGDVITLTGIV--KVASSDEGRNKSNKDKCMFLLYIQAVAVSNTKGQ-RSDGGGEDTAPGVALDFSLKELYAVQEIQAQPHLFRLLVHSICPTIYGHELVKAGLALALFGGVQRYGTDKNRIPVRGDPHVLIVGDPGLGKSQMLQAVCNIAPRGVYVCGNTTTTAGLTVTLSKDGPSGDYALEAGALVLGDQGLCCIDEFDKMP-NQHQALLEAMEQQSISLAKAGVVCSLPARTSIVAAANPVCGHYNKSKTVSENLKMGSALLSRFDLVFILVDTPDEERDHVLSEHVMAMHAGKRMLAGASVSRAAAPGLKLTASSSSDDVLGGLSLSDRLKARRGEALDPVPHSLLRKYVGYARRYVRPCLSAEAAQTLQDFYLELRRQHHGGDGTPITTRQLESLIRLTEARARLELRENATKEDADDVIDIMKHSFSDTLSDELGTLHFERTQHGSGMSNRSAAKRFVTALARCSEQICNTMFTMQQLQQLARDIGLQVADFEGFISSLNTQGFLLHKGSKVYQL 848          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008164.1 (pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:ENSPMAG00000007367.1 transcript:ENSPMAT00000008164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 208.764 bits (530), Expect = 2.169e-59
Identity = 150/473 (31.71%), Postives = 235/473 (49.68%), Query Frame = 1
Query:  421 ILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSG-TALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLN 1833
            +L    AL  LV   N+         + Y+ +  +  +       L +  +G+ + ++G V K + V+P  +R    C   +        D               K +   PL+ E   ++  D+Q I LQE      +P          +K   G++P++ + +L  DLVD C PGD V V G           + S        F  +L  NN+ ++  +V      E+       V  +      HS+ N+F  L  SL PSI+GHE +K ++L  L GG  K  ++ +R  IRG+ ++L++GDP + KSQML+     APR++   G   +  GLT + + D ++G   LEAGA+V+ D G  CIDEFDKM+     ++ E MEQ  ++IAKAG+   L+AR SVLAAANP  G Y++ KT  EN+ +   LLSRFDL++I+LD+ +   D ++S HVL +H  +++ 
Sbjct:   10 LLAFQQALKELV--GNVDGTYAKQFESFYVGLEGSFGARHLSPRTLTSRFLGNMVCVEGIVTKCSLVRPKVVRSVHYCPATQKSIERKYSDLTSLDAFPSSAAYPTKDEESNPLETEYGLSIYRDHQTISLQE------MP----------EKAPAGQLPRSADVVLDDDLVDRCKPGDRVQVIGTFRCLPGKKAGYTSG------TFRTILIGNNVKQMNKEVVPTFSGED-------VNKIKTFSKTHSK-NIFDQLSKSLAPSIHGHEYIKKAVLCLLLGGTEKILDNGSR--IRGDINVLLIGDPSVAKSQMLRYVLHTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLGDRGVVCIDEFDKMTDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPIYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQTDPEYDREISDHVLRMHRYRAVG 448          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Sea Lamprey
Match: mcm5 (minichromosome maintenance complex component 5 [Source:ZFIN;Acc:ZDB-GENE-021209-1])

HSP 1 Score: 202.216 bits (513), Expect = 3.878e-56
Identity = 146/477 (30.61%), Postives = 233/477 (48.85%), Query Frame = 1
Query:  772 DETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSEN-SYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAK-AGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLR-------KRRHFMDGTPITTRQLESMVRLTEAKARSELREIANE 2172
            D+   +DYQ ++LQE     P                 G +P+ +     R L D  VPG+ + V GI   + A   F +  G G +     +   N   R+ G + +D D    S       ++   I  + + P++++ +  S+ PSIYG   +K ++   L GG  K   D   +  RG+ ++L++GDPG  KSQ+L+     +P  VY  G   + AGLT S  +D  +    +E GA+V++D G  CIDEFDKM      ++ EAMEQQ+IS  +  G+   L++R SVLAAAN   G ++ +K   EN+     +LSRFD+++I+ D  NE  D  L++HV+++H    LN  +    QM  +                           I    L+K+IAY +    P++S+EA   L+  Y+ +R       + R   +  PIT RQLE++VR++E++A+  L+  A E
Sbjct:   25 DKCKCVDYQTLKLQEAPDAVP----------------HGEMPRHMQLYCDRYLCDRVVPGNRITVMGIYSIKKA---FTKMQGKGRDRTGAGIR--NPYLRVVG-ITVDTDGAGRSMGIALHPQEEEEIRQLAASPSVYETIARSIAPSIYGFMDIKKAIASLLIGGSRKRLPDG--LTRRGDINLLLLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVMRDPATRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISTLRIGGITTTLNSRCSVLAAANSVFGRWDDSKG-EENIDFMPTILSRFDMIFIIKDEHNEKRDMILAKHVMNVH----LNAKT----QMQAVE------------------------GEIELSTLKKFIAYCRSKCGPRMSAEACEKLKNRYVLMRSGAREHDRDRDHRNSIPITVRQLEAIVRISESQAKMRLQPFATE 444          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006035.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.586 bits (488), Expect = 1.127e-51
Identity = 163/552 (29.53%), Postives = 261/552 (47.28%), Query Frame = 1
Query:  553 NLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKS-KSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAE-FSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSG-TALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKR-RHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVK 2193
            +++AN IG  ++++G V +  +VKP+ +   + C  C  E    +     F     C +R C++ KS   L  +S  +  + +Q +++QE                H D+   G IP+ +   +  +      PGD + +TGI +            G     L    L  + +      VKM+   +N  D E  S  +L  I    +E + ++ L AS+ P IYGHE VK +LLL L GGV +       + IRGN +I ++GDPG+ KSQ+L     +APRS Y  G   +  GLT +  +D  +G   LE GALV++D+G CCIDEFDKM+     S+ E MEQQ+ISIAK       S RT VL       G      +    +K+ A LLSRFDL++++ D+P+   D +L++H+  +H  Q  ++  S    +D                                +L+R+YIA  ++   P +    A+ +   Y+ +RK  R   D T  + R L +++RL+ A AR  L ++  ++D  + +
Sbjct:  150 DVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGAETYQPIAST-SFMPLALCPSRDCQTNKSGGRLYLQSRGSKFVKFQELKIQE----------------HSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIFLPVLKQGFRAMQQG----LLSETFLEAHRV------VKMNKTEDNELDVEELSESELRQI----TEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDR---SPRGMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRTRVLQLVGYGRGGGGSCCSRWLGIKLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVH--QHCHQPPSQHTPLDM-------------------------------KLMRRYIALCQRR-QPAVPDTLADYITAAYVEMRKEARVSKDTTFTSARTLLAILRLSTALARLRLVDVVEKEDVNEAR 633          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006014.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 5.713e-46
Identity = 161/556 (28.96%), Postives = 264/556 (47.48%), Query Frame = 1
Query:  553 NLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKS-KSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAE-FSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSG-TALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAE----NLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKR-RHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVK 2193
            +++AN IG  ++++G V +  +VKP+ +   + C  C  E    +     F     C +R C++ KS   L  +S  +  + +Q +++QE                H D+   G IP+ +   +  +      PGD + +TGI +            G     L    L  + +      VKM+   +N  D E  S  +L  I    +E + ++ L AS+ P IYGHE VK +LLL L GGV +       + IRGN +I ++GDPG+ KSQ+L     +APRS Y  G   +  GLT +  +D  +G   LE GALV++D+G CCIDEFDKM+     S+ E MEQQ+ISIAK       S R ++ +     T    +A  + +     L + A LLSRFDL++++ D+P+   D +L++H+  +H  Q  ++  S    +D                                +L+R+YIA  ++   P +    A+ +   Y+ +RK  R   D T  + R L +++RL+ A AR  L ++  ++D  +++
Sbjct:  150 DVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGAETYQPIAS-TSFMPLALCPSRDCQTNKSGGRLYLQSRGSKFVKFQELKIQE----------------HSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIFLPVLKQGFRAMQQG----LLSETFLEAHRV------VKMNKTEDNELDVEELSESELRQI----TEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDR---SPRGMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTR-ALCSDGGGRTVAAGRASRIDDCVWLALMLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVH--QHCHQPPSQHTPLDM-------------------------------KLMRRYIALCQRR-QPAVPDTLADYITAAYVEMRKEARVSKDTTFTSARTLLAILRLSTALARLRLVDVVEKEDVNEMR 636          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Yeast
Match: MCM2 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000000119])

HSP 1 Score: 284.648 bits (727), Expect = 3.746e-83
Identity = 193/586 (32.94%), Postives = 301/586 (51.37%), Query Frame = 1
Query:  508 INVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA-EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDN-DSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHT----EQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLS---------YGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMM 2217
            I+VRI++F  I     L+ + + S + + G V +   V P    VKF CL C +       D  +    + C N  CKSK   P +   ++TV  +YQ + LQE     P                 GR+P+    IL+ DLVD   PG+EV VTGI    +   N +  +G     +F  ++  N+I R +G+   +   E   D   ++ ++      I  +  +   +++S+ PSIYGH  +K ++  +LFGGV K  N K+  +IRG+ ++L++GDPG  KSQ+L+     A R+V+  G   +  GLT S  KD       LE GALV++D G C IDEFDKM+ Q   S+ EAMEQQSISI+KAG+V  L AR S++AAANPN G YN    +A+N+ ++ P+LSRFD++ ++ D  +E  D +L+  V+  H     E   +R    ++     +  S  ++     +E+L+            +E    IP +LL KYI YA+  ++PKL     + +   Y  LR+        PIT R LES++R+ E+ A+  L E  +  D     +++++S +
Sbjct:  293 IHVRISDFPTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIRISFCTN--CKSKG--PFRVNGEKTVYRNYQRVTLQEAPGTVP----------------PGRLPRHREVILLADLVDVSKPGEEVEVTGIYKN-NYDGNLNAKNGF---PVFATIIEANSIKRREGNTANE--GEEGLDVFSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKH--SIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKN----NGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDSFV 846          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Yeast
Match: MCM4 (Essential helicase component of heterohexameric MCM2-7 complexes; MCM2-7 complexes bind pre-replication complexes on DNA and melt DNA prior to replication; forms an Mcm4p-6p-7p subcomplex; shows nuclear accumulation in G1; homolog of S. pombe Cdc21p [Source:SGD;Acc:S000006223])

HSP 1 Score: 282.722 bits (722), Expect = 5.868e-82
Identity = 205/619 (33.12%), Postives = 299/619 (48.30%), Query Frame = 1
Query:  448 TLVFANNISSISNSDLPNI---YINVRIANFSPICKSLN-LQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDS--------ENSYD-------AEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRK----RRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSD 2232
            +L+  NN+    + DL  I   +  VR  N    CK +  L  N I   I+LKG V++   V P      F+C  C +   V + D      P RC    C   +   L  +  +   D QVI+LQET    P                +G+ P +++  +  +LVD+C  GD + VTG   +     N  Q         +  V+HV  +     D ++DVD+        +N  D        + + +DL  I  + +  +L+ LL  S+ PSIY  E VK  +LL LFGG  K      R   RG+ +IL+ GDP   KSQ+LQ    I PR VY  G   +  GLT   ++D D+    LE+GALV+SD G CCIDEFDKMS    + L E MEQQ+ISIAKAG++  L+AR+S+LA+ANP    YN    V EN+ +  PLLSRFDLVY++LD+ +E  D +L++H+ +L+ E                                    H    D +P + L  YI+YAK+++HP ++  A   L   Y+ +RK     R        TTRQLESM+RL EA A+ +L+ +   +D ++   L+  ++    +D
Sbjct:  282 SLIVDNNL----DYDLDEIETKFYKVRPYNVGS-CKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI-DRGVIQEPARCERIDCNEPNSMSLIHNRCSFA-DKQVIKLQETPDFVP----------------DGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVS----DKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRY--RGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPE--------------------------------HISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATD 839          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Yeast
Match: MCM6 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; forms a subcomplex with Mcm4p and Mcm7p [Source:SGD;Acc:S000003169])

HSP 1 Score: 279.641 bits (714), Expect = 2.217e-80
Identity = 192/602 (31.89%), Postives = 299/602 (49.67%), Query Frame = 1
Query:  526 NFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVV-LPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGD-------EVIVT--------GIVMTESASTNFHQSSGSGSNCLFN----------------LVLHVNNICRLKGDVKMDVDS--------------------ENSYDAE-----FSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRK--RRHFMDGT-PITTRQLESMVRLTEAKARS 2148
            N   + +  ++++ +IGS +S+ G V + ++V+P   +  F C  C+   IV  +   +K+  PT C N  C++++F  L  +  +  +D+Q +R+QE  ++ P                 G +P+TL+ IL  D V+   PGD       E++V         G+  + +  T     +  G N                    L  HV +I    G    D +S                    +N  D E      S  ++  ++ +  + +++  LV S+ P+++GHE VK  +LL + GGV K  +    + +RG+ +I +VGDP   KSQ L+     APRSVY  G + + AGLT +  +D + G   +EAGAL+++DNG CCIDEFDKM      ++ EAMEQQ+ISIAKAG+   L+ARTS+LAAANP  G YN+  ++  NL M+AP++SRFDL +++LD  NE +D++L+ H++ LH                 M      + P S                   + LR+YI YA+ +  P L+ EA + L E Y  LRK   + F   +  IT RQLESM+RL+EA AR+
Sbjct:  269 NLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCR--AIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVT-RSRFLDWQKVRIQENANEIPT----------------GSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRETELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHK--STVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLH-----------------MKRDEAIEPPFSA------------------EQLRRYIKYARTF-KPILTKEARSYLVEKYKELRKDDAQGFSRSSYRITVRQLESMIRLSEAIARA 813          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Yeast
Match: MCM5 (Component of the Mcm2-7 hexameric helicase complex; MCM complex is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase [Source:SGD;Acc:S000004264])

HSP 1 Score: 235.343 bits (599), Expect = 3.819e-66
Identity = 156/499 (31.26%), Postives = 256/499 (51.30%), Query Frame = 1
Query:  787 IDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDA--EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMD-------GTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYS-DELGILN 2250
            ID Q ++LQE     P+                G +P+ L     R L +  +PG  V + GI    ++          G N    + +    I  L   ++ DV++ + +++   F+ ++      +   P L+++L  S+ PSI+G+E +K +++  L GG  K   D  R  +RG+ ++L++GDPG  KSQ+L+    ++P +VY  G   + AGLT S  +D  +    LE GA+V++D G  CIDEFDKM  +   ++ EAMEQQ+ISIAKAG+   L++RTSVLAAANP  G Y+  K+  +N+     +LSRFD+++I+ D  NE  D  ++ HV+++HT  +                ++M  +             +E+   I  + +++YI Y +    P+LS +AA  L   ++++RK+    +         PIT RQLE+++R+TE+ A+ EL  IA E+   +   L   S M   S D +G LN
Sbjct:  251 IDQQFLKLQEIPELVPV----------------GEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSIYNSKNGAGSGRSGGGNGGSGVAIRTPYIKIL--GIQSDVETSSIWNSVTMFTEEEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMR--LRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNA----------------NAMQNQ------------QEENGSEISIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLN 701          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Yeast
Match: MCM3 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex [Source:SGD;Acc:S000000758])

HSP 1 Score: 228.024 bits (580), Expect = 1.025e-62
Identity = 181/597 (30.32%), Postives = 289/597 (48.41%), Query Frame = 1
Query:  556 LQANQIGSFISLKGNVVKVNQVKPVCIR-VKFRCLTCK--NEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCL--FNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGTA-LEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLH------------TEQSLNRSSSSIRQMDT------------------------MSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMG 2220
            L A  +   +S++G V K + V+P  IR V +   T +                +PT  +     ++  +   E   +  ID+Q I +QE     P                 G++P++++ IL  DLVD   PGD V V G+  +  A    +QS+   SN L  F  ++  N +  L    +    +      +F +++   I  +  + ++F +L  SL PSIYGH+ +K ++LL L GGV K  N +N   +RG+ +IL+VGDP   KSQ+L+     A  ++   G   +  GLT + + D ++G   LEAGA+V++D G  CIDEFDKM+     ++ E MEQQ+++IAKAG+   L+AR SV+AAANP  G Y+  +   +N+ +   LLSRFDL++++ D  NE+ D  +S HVL  H              + LN S +     D                           F+ + +        + +Y   E    +    LRKY+ YAK+ V P+L+ EA N++ + Y  LR   +    +PIT R LE+++RL  A A+  L +  N+ DAK    L+  +++G
Sbjct:  171 LTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPA----------------GQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKSLGAG-GMNQSN---SNTLIGFKTLILGNTVYPLH--ARSTGVAARQMLTDFDIRN---INKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVEK--NLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLLQAGAKLAKNKGNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRNDDN-TKKSPITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFALLG 739          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Nematostella
Match: EDO35060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMI2])

HSP 1 Score: 297.36 bits (760), Expect = 1.195e-87
Identity = 212/636 (33.33%), Postives = 324/636 (50.94%), Query Frame = 1
Query:  316 KKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMM 2217
            K+  +IDYN L + +   +V+  F  E      +I  E   A   +V A       N D     I+VRIA    + +  +L+   +   I   G V     + P    +K+ C  C            +   P  C    C+S+   P +   ++T+  +YQ I++QE+ S                K   GR+P+  + IL+ DLVD+C PGDE+ +TGI      S+  ++S+G     +F  ++  N I   K D KM V S        + +D+ AI A+  +  + + ++AS+ PSIYGHE +K +L L+LFGGV K    K++  IRG+ ++L+ GDPG  KSQ L+     APR+V+  G   +  GLT    +   +    LEAGALV++D G C IDEFDKM+     S+ EAMEQQSISI+KAG+V +L AR S+LAAANP  G Y+ + T AEN+ ++ P+LSRFD++ ++ D  + + D  L+R V++ H     N   +   + + M  H  T    +                IP  LL+KY+ YA++ VHP+L++   + + + +  LRK        PIT R +ESM+R+ E+ A+  LRE   E D      +MLES +
Sbjct:  151 KQSLVIDYNILANEQ---QVLAYFLPEAPTEMLQIFDE---AAKEVVLA----MFPNYDRITTEIHVRIAELPLMEELRSLRQLHVNQLIRTGGVVTSSTGIMPQLSVIKYDCPKCSFILGPFFQGSDQEVKPGSCPE--CQSRG--PFEINMEQTLYQNYQKIKIQESPS----------------KVAAGRLPRYKDVILMADLVDSCKPGDEIELTGIYKINYDSS-LNRSNGFP---VFATIIEANFIT--KQDDKMAVTS-------LTDEDIKAINALSKDERIGERIIASIGPSIYGHEDIKRALALSLFGGVAKDPGGKHK--IRGDINVLLCGDPGTAKSQFLKYVEKTAPRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADKGMCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCSILAAANPIGGRYDPSLTFAENVDLTEPILSRFDILCVVRDTVDAIQDELLARFVVNSHVRHHPNTPEN---EDEDMEVHMFTLRRNA----------------IPQDLLKKYMIYARERVHPRLNNMDQDKVAKMFADLRKESMATGSIPITVRHIESMIRMAESHAKMHLREYVMEDDVNMAIRVMLESFI 722          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Nematostella
Match: EDO33971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQR1])

HSP 1 Score: 285.034 bits (728), Expect = 3.318e-83
Identity = 198/648 (30.56%), Postives = 333/648 (51.39%), Query Frame = 1
Query:  415 RIILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTG--IVMTESAS---------TNFHQSSGSGSNC----------LFNLVLHVNNIC--------RLKG-DVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHT--EQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTP-------ITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDEL 2238
            R+   +C A+    FA +   +     PN    V   +     K   L + +IGS + + G VV+ + V P  +   F CL C+   I  +   +K+  PT C N +C++++   L + +++  +D+Q +R+QET ++ P                 G IP+++  IL  + V+    GD+   TG  IV+ + A          T   Q+SG G             + +L   ++ +         R  G D+  D  +  +   + + ++   I  +  + NL++ ++ S+ P+I+G++ VK  +LL LFGGV K   +K   ++RG+ +I +VGDP   KSQ L+     + R+VY  G + + AGLT +  KD +S    +EAGA++++DNG CCIDEFDKM  +   ++ EAMEQQ+IS+ KAG+  +L+ARTSVLAAANP  G Y++ K++ +NL MSAP++SRFDL +I++D  NEV+D  ++R ++ LH+  EQS+ R                             Y   E         +++Y+ +A+++  P ++ EA + + E Y  LR+R    DG+        IT RQLESM+RL+EA AR   ++    +  K+   L+ +S++ V + ++
Sbjct:   79 RVFPYLCQAVRN--FARDRGQVP----PNKEFYVSFIDLPTRHKIRELTSQKIGSLLRISGQVVRTHPVHPELVTATFTCLDCQT-VIKDVEQQFKYTQPTVCRNPICQNRARFAL-DINKSRYVDFQKVRIQETQAELP----------------RGCIPRSVEVILRAEAVEQAQAGDKCDFTGTLIVVPDIAQLATPGTRSETGQRQTSGEGYEAEGVRGLKALGVRDLTYRLSFLACSVQATNPRFGGKDLDGDDMTAEAIKKQMTPQEWQKIYEMSRDKNLYQNIINSIFPTIHGNDEVKRGVLLMLFGGVPKKTLEK--TSLRGDINICVVGDPSTAKSQFLKHVEEFSARAVYTSGKASSAAGLTAAVVKDEESSEFVIEAGAMMLADNGVCCIDEFDKMDPRDQVAIHEAMEQQTISLTKAGVKASLNARTSVLAAANPIGGRYDRTKSLKQNLNMSAPIMSRFDLFFILVDECNEVVDYAIARRIVDLHSRREQSVER----------------------------VYAVDE---------VQRYLTFARQF-KPTITKEAQDYMVEQYKHLRER----DGSSTTKSAWRITVRQLESMIRLSEAMARLYCQDKVEPKHVKEAYRLLNKSIIRVETPDI 658          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Nematostella
Match: EDO42446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E9])

HSP 1 Score: 259.225 bits (661), Expect = 4.865e-76
Identity = 194/585 (33.16%), Postives = 291/585 (49.74%), Query Frame = 1
Query:  496 PNIYINVRIANFSPICKSLNL----QANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKN--------EQIVVLPDDYKFAVPTRC-VNRVCKSKSFEPLKE--SDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLH-----VNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKL--LVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVL-SLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDA 2181
            PNI+  VR++N  PIC  L      +++ +G F+++ G V++V+ +K +    +F C  CK         EQ   +P       PT C     C S  F  L E  S+ T   DYQ I++QE                   K   G IP+++  +L  DLVD+C  GD+V ++G+VM             +   C   +V       VNN  R+   V  ++  E  +D EF  K        H +  L     ++AS CP +YG   VK ++ L L GGV +      RV  RG SH+L++GDPG GKSQ L+ +  I PRSV   G   T+AGLTV+  +D+     LEAGALV++D G CCIDEF+ +      S+ EAMEQQ+IS+AKAGMVC L+ RT++LAA NP  G  +  ++++ N  +++PLLSRFDLV+++ D  NE  D  +S  +L       S  + + ++  MD                                  L+ YI +AK  + P+L++++  +L+++Y   +++    +    T R LES++RL +A AR   RE    QDA
Sbjct:    5 PNIH--VRLSNL-PICPELKRSTIPKSSDMGRFLAVSGTVIRVSSIKMLEHEREFICSRCKYVFSAQADFEQFYTIPK------PTSCPSGEGCTSNKFNCLSEPGSNPTSCRDYQEIKIQE----------------QVQKLAVGTIPRSMWVVLEDDLVDSCKAGDDVTISGVVMRRWWPVI------AEVKCDLEVVFKANHVSVNNEQRIGAIVTEEMKQE--FD-EFWSK--------HKDKPLSGRNHILASFCPQVYGLYAVKLAVTLILMGGVQRVDASGTRV--RGESHMLLIGDPGTGKSQFLKYSAKIMPRSVLTTGIGSTSAGLTVAAVRDSGEWQ-LEAGALVLADGGLCCIDEFNSIREHDRGSIHEAMEQQTISVAKAGMVCKLNTRTTILAATNPK-GQLDIDQSLSVNTALASPLLSRFDLVFVLQDVKNEDWDRIVSSFILEGKGVRMSAEKPAEALWGMDR---------------------------------LQAYICHAKT-LEPQLNTDSNRVLRQYY-QCQRQADTRNAARTTLRLLESLIRLAQAHARLMYREHVTVQDA 508          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Nematostella
Match: EDO34425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPE9])

HSP 1 Score: 250.751 bits (639), Expect = 4.588e-71
Identity = 187/565 (33.10%), Postives = 283/565 (50.09%), Query Frame = 1
Query:  553 NLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKF-AVPTRCVNRVCKSKSFEPLKESDETVTI-DYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVM-TESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSE-PNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSG-TALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHT-----EQS-----LNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYG-HKESCDN-IPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDG----TPITTRQLESMVRLTEAKARSELREIANEQDAK 2184
            +L +  IGS + ++G V K + V+P  +R    C   K   I    D     AVPT  V    K +   PL+      T  D+Q   +QE     P                 G++P++++ I   DLVD C PGD V V G      S  + F  +SG+     F  VL VNN+  +  +V             FS  D+  I+       ++F++L  SL PSI+GHE +K ++L  L GG  K   +  R  +RG+ +IL++GDP   KSQML+     APR++   G   +  GLT + + D ++G   LEAGA+V++D G  CIDEFDKMS     ++ E MEQ  ++I+KAG+   L+AR SVLAAANP  G Y++ K   +N+ M   LLSRFDL++I+LD+ +   D ++S HVL +H      EQ          S  +   D          P    H+ + +G  K+  D  +    ++KYI  AK  + P L+  AA+++ + Y  LR + +  +     TP+T R LE+M+RL+ A A++ + +   E DA+
Sbjct:  112 SLSSRYIGSMVCVEGIVTKCSLVRPKVVRSVHYCPKTKKTLIRKYTDMTSLEAVPTSSVY-PTKDEDGNPLETEYGLCTYKDHQTFTIQEMPERAPA----------------GQLPRSVDIIADNDLVDKCKPGDRVQVIGTYRCLPSKRSGF--TSGT-----FRTVLIVNNVQVMSKEVA----------PNFSASDISKIKKFSKSKQDVFEVLAKSLAPSIHGHEFIKKAVLCLLLGGTEKVLENGTR--LRGDINILLIGDPSTAKSQMLRYVLHSAPRAIPTTGRGSSGVGLTAAVTTDPETGDRRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHAKLNARCSVLAAANPVFGRYDEFKNPMDNIGMQDSLLSRFDLLFIVLDQMDPDNDRRISEHVLRIHRYRKPGEQEGEALPFGEESDVLATRDPDQEEEDEDTPVYEKHDPMLFGKQKDKKDKFVSMAFMKKYIHVAKA-IKPALTKPAADLISKAYSELRDQENIGNDKAKTTPVTARTLETMIRLSTAHAKARMSKTITEGDAQ 639          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Nematostella
Match: EDO37946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEF9])

HSP 1 Score: 243.817 bits (621), Expect = 3.855e-69
Identity = 185/569 (32.51%), Postives = 280/569 (49.21%), Query Frame = 1
Query:  553 NLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSK--SFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDL--YAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGV--TKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGTA-LEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRK-RRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDE 2235
            N++A+ IG    ++G V++  +VKPV     + C  C  E    +     F     C +  CK+         ++  +  + +Q +++QE                H D+   G IP+++  I   +      PGD V VTGI +     T F Q +      L +  L  + I R+            + D E    DL    I A+ +E + +  L +SL P IYGHE +K +LLL L GGV  T  G     + IRGN +IL++GDPG+ KSQML     +APRS Y  G   T  GLT +  KD  +G   LE GALV++D G CCIDEFDKM      ++ E MEQQ++SIAKAG++  L+AR S+LAAANP  G YN  K+  +N+++ A LLSRFDL++++ D+P++  D +L++H+  +H                    HS    P S +            D +   L+R+YIA  K+   P +  E ++ +   Y+ +RK  R+  D T  + R L +++RL  A AR  L ++  ++D  +   LM  S   +  DE
Sbjct:  150 NVKADCIGKLTVVRGIVMRCTEVKPVVEVATYTCDQCGAESYQTI-QSQTFMPLLMCPSEECKTNRAGGRLYLQTRGSKFVKFQELKIQE----------------HSDQVPVGHIPRSMTIIAKGENTRLATPGDHVSVTGIFLP-MMKTGFRQMT---QGLLSDTFLEAHRIVRMN----------KTEDDEMPTDDLSDEEIRALSTEADFYDKLASSLAPEIYGHEDIKKALLLLLVGGVDCTPHG-----MKIRGNINILLMGDPGVAKSQMLSYIDRLAPRSQYTTGRGSTGVGLTAAVMKDPLTGEMILEGGALVLADKGVCCIDEFDKMMDGDRTAIHEVMEQQTVSIAKAGIMTTLNARVSILAAANPAYGRYNPKKSAEQNIQLPAALLSRFDLLWLIQDKPDKENDLRLAQHITYVHQ-------------------HS--AHPPSHY------------DPLDMNLMRRYIAACKEK-QPIVPGELSDYIVSAYVEMRKDARNNHDTTFTSARTLLAVLRLATALARLRLADVVEKEDVNEAMRLMEMSKASLSDDE 648          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Medaka
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:NCBI gene;Acc:101154800])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 357/798 (44.74%), Postives = 514/798 (64.41%), Query Frame = 1
Query:  160 LKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLV---FANNISSISNSDLP------NI-YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDY-KFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYD-------AEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
             +T+L ++CPY GW +YF  E ++++S +V +I+ F  YF+  +++L   + IE +   ++DY DL     +++ + +     +   + ++  + LA+H ++        + + + +LP      NI +I+ R+ N+ P+     L+A+  G  + +KG VV+V+ ++P+C R+ FRC TC +   + LP  + K+A PT+C+   C+S+SF PL+ S  T+T+D+Q+I++QE               +  ++   GRIP+T+ C L  DL D+CVPGD VIVTGIV       N   S G+   C+F L +   ++   KG +   V  E+S          EFS+K+LYA++ I S+P+L +LLV SLCP+IYGH LVKA+L LALFGG  K    KN V +RG+ HILIVGDPGLGKSQMLQ+ C +APR +Y+CG S +T GLTVS S+D  +G  ALEAGALV++D G CCIDEFDK+  QQ A LLEAMEQQS+S+AKAG+V +L ARTSV+AAANP  GHYN+ KTV+ENLKM + LLSRFD+V+++LD P+E  D  LS HV++    +  +  +   R         + +       ERL     ++ D IP  LLRKYI+YA++YVHP LS EAA  LQ+FYLSLR +    D TPITTRQLES++RLTEA+A+ ELRE+A   DA+DV E+M  S+   YSD LG L+F RSQ GSGMS+ SA+K+L++ L +H++R+G   F+   ++ +A   NIK+ D + ++++LNEQGFLLKKGP  Y+L T
Sbjct:   72 FQTTLDASCPYKGWSLYF-TEGFIQSSPSVEKIKVFEKYFTS-RIHLFDKDEIERQGSVLVDYADLTGDRSVSQALPDVVTALKEQPEVMLSCLGLAIHQVLTTDLEKQAAELHDEELPVSTPIINIPHISARLYNYEPLTPLRTLRASVFGRLVCVKGTVVRVSNIRPLCTRMAFRCQTCTSA--MSLPLQHGKYATPTKCIQPGCRSRSFAPLRSSALTLTVDWQIIKVQEL--------------MGGEQRETGRIPRTVECHLTSDLCDSCVPGDTVIVTGIVRV----NNDGSSRGNKDQCMFLLYIDATSVSNTKGQLSKSVGEESSGSLEDRSGGEEFSLKELYAVQEIQSQPDLLRLLVHSLCPAIYGHSLVKAALALALFGGRQKHMG-KNSVPVRGDPHILIVGDPGLGKSQMLQAVCNVAPRGIYVCGNSTSTTGLTVSLSRDAGTGDYALEAGALVLADQGLCCIDEFDKLGNQQQA-LLEAMEQQSVSLAKAGIVSSLPARTSVVAAANPVGGHYNRGKTVSENLKMGSALLSRFDVVFLLLDIPDESHDRCLSEHVMANRAGKGRSSGAVVTRANGESETSILLQHSDMPLSERLQVPAGQTLDLIPACLLRKYISYARQYVHPTLSPEAAQTLQDFYLSLRSQASSADSTPITTRQLESLIRLTEARAKLELREMATRGDAEDVVEIMKHSLADTYSDGLGNLDFERSQLGSGMSQRSAAKRLVNALHSHAQRTGQKQFDLQTLRSMADKLNIKVGDFQGLLSSLNEQGFLLKKGPKLYQLQT 845          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Medaka
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:NCBI gene;Acc:101154800])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 334/791 (42.23%), Postives = 485/791 (61.31%), Query Frame = 1
Query:  160 LKTSLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNL---EMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLV---FANNISSISNSDLP------NI-YINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDY-KFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLT 2487
             +T+L ++CPY GW +YF  E ++++S +V +I+ F  YF+  +++L   + IE +   ++DY DL     +++ + +     +   + ++  + LA+H ++        + + + +LP      NI +I+ R+ N+ P+     L+A+  G  + +KG VV+V+ ++P+C R+ FRC TC +   + LP  + K+A PT+C+   C+S+SF PL+ S  T+T+D+Q+I++QE               +  ++   GRIP+T+ C L  DL D+CVPGD VIVTGIV   +         G+   C+F L +   ++   KG V                      + +     +F  L    C       LVKA+L LALFGG  K    KN V +RG+ HILIVGDPGLGKSQMLQ+ C +APR +Y+CG S +T GLTVS S+D  +G  ALEAGALV++D G CCIDEFDK+  QQ A LLEAMEQQS+S+AKAG+V +L ARTSV+AAANP  GHYN+ KTV+ENLKM + LLSRFD+V+++LD P+E  D  LS HV++    +  +  +   R         + +       ERL     ++ D IP  LLRKYI+YA++YVHP LS EAA  LQ+FYLSLR +    D TPITTRQLES++RLTEA+A+ ELRE+A   DA+DV E+M  S+   YSD LG L+F RSQ GSGMS+ SA+K+L++ L +H++R+G   F+   ++ +A   NIK+ D + ++++LNEQGFLLKKGP  Y+L T
Sbjct:   56 FQTTLDASCPYKGWSLYF-TEGFIQSSPSVEKIKVFEKYFTS-RIHLFDKDEIERQGSVLVDYADLTGDRSVSQALPDVVTALKEQPEVMLSCLGLAIHQVLTTDLEKQAAELHDEELPVSTPIINIPHISARLYNYEPLTPLRTLRASVFGRLVCVKGTVVRVSNIRPLCTRMAFRCQTCTSA--MSLPLQHGKYATPTKCIQPGCRSRSFAPLRSSALTLTVDWQIIKVQEL--------------MGGEQRETGRIPRTVECHLTSDLCDSCVPGDTVIVTGIVRVNN--------DGNKDQCMFLLYIDATSVSNTKGIV---------------------CQMLMQTQWVFTFL--PFC------SLVKAALALALFGGRQKH-MGKNSVPVRGDPHILIVGDPGLGKSQMLQAVCNVAPRGIYVCGNSTSTTGLTVSLSRDAGTGDYALEAGALVLADQGLCCIDEFDKLGNQQQA-LLEAMEQQSVSLAKAGIVSSLPARTSVVAAANPVGGHYNRGKTVSENLKMGSALLSRFDVVFLLLDIPDESHDRCLSEHVMANRAGKGRSSGAVVTRANGESETSILLQHSDMPLSERLQVPAGQTLDLIPACLLRKYISYARQYVHPTLSPEAAQTLQDFYLSLRSQASSADSTPITTRQLESLIRLTEARAKLELREMATRGDAEDVVEIMKHSLADTYSDGLGNLDFERSQLGSGMSQRSAAKRLVNALHSHAQRTGQKQFDLQTLRSMADKLNIKVGDFQGLLSSLNEQGFLLKKGPKLYQLQT 789          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Medaka
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:101173930])

HSP 1 Score: 294.664 bits (753), Expect = 1.304e-85
Identity = 216/641 (33.70%), Postives = 319/641 (49.77%), Query Frame = 1
Query:  310 EIKKHAIIDYNDLCSSEYI-TKVIHEFKNEFQFNCQRIILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKS-FEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNC--LFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMM 2217
            E K+  +++Y DL + E++    + E   E          E+ LA++          I++       I+VR++N   + +   L+   +   I   G V     V P    VK+ C  C            +   P  C    C+S+  FE   E  ETV  +YQ I +QE+                  K   GR+P++ + IL+ DLVD+C PGDE+ +TGI        N +  S + +N   +F  V+  N+I R    V +         AE + +D+ AI A+  +  + + + AS+ PSIYGHE +K +L L+LFGG  K    K++V  RG+ ++L+ GDPG  KSQ L+    +A R+V+  G   +  GLT    +   S    LEAGALV++D G C IDEFDKM+     S+ EAMEQQSISI+KAG+V +L AR +V+AAANP  G Y+ + T AEN+ ++ P++SRFD++ ++ D  + V D  L+R V+  H                 +  H  TKE G    E +   +      IP  LLRKYI YAK+ VHPKL+    + +   Y  LRK        PIT R +ESM+R+ EA A+  LR+   E D      +MLES +
Sbjct:  213 ENKESLVVNYEDLAAREHVLAYFLPEAPAEMLKVFDEAAKEVVLAMYP-----KYDRIAHE------IHVRVSNLPLVEEIRALRQLHLNQLIRTSGVVSCCTGVLPQLSMVKYNCSKCSFVLGPFFQSQNQEVKPGSCPE--CQSQGPFEVNME--ETVYQNYQRITIQESPG----------------KVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYH------NNYDGSLNMANGFPVFATVILANHISRRDEGVAV---------AELTDEDVKAIVALSKDECIGERIFASVAPSIYGHEDIKRALALSLFGGEPKNPGGKHKV--RGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFAENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSH-----------------IKHHPSTKEGGVALEE-MVLPNTTDVSPIPQDLLRKYIIYAKERVHPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHAKMHLRDYVLEDDVNMAIRVMLESFI 787          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 292.352 bits (747), Expect = 2.609e-85
Identity = 210/615 (34.15%), Postives = 296/615 (48.13%), Query Frame = 1
Query:  412 QRIILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVK----MDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRK---RRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSD 2232
            Q +I    +A++ L F     S+         I VR  N        NL    I   I+L G V++ +Q+ P      F+C  C     V + D  + A P  C N  C +     L   + +V  D Q+I++QE+  D P                 G+ P T       DLVD   PGD V +TGI        +  QS     N       H++ I   K D K    +D D E     E  V+ L  + A   +P++++ L ++L PSIY HE +K  +LL LFGG  K  +   R   R   +IL+ GDPG  KSQ+LQ    + PR  Y  G   +  GLT    KD ++    L+ GALV+SDNG CCIDEFDKMS    + L E MEQQ++SIAKAG++C L+ART+VLAAANP    +N  KT  EN+++   LLSRFDL+++MLD  +E  D +L+ H++SL+ +        S  QM+   F  M                          +L+ YIAYA+ Y+ P+LS EA+  L E Y+ +RK    R  +   P   RQLES++RL EA A+    E     D ++ K L  E++    +D
Sbjct:  226 QEVIPTFDMAVNELFFERFPDSVLE-----YQIQVRPYNALKTKNMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVCAFSARVEV-DRGRIAEPAVCRN--CNNTHSMTLVH-NRSVFSDKQMIKIQESPEDMPA----------------GQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQS-----NVRSVYKTHIDAIHFRKTDEKRLHGLDQDGEQKLFTEDRVQTLKELAA---KPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQ--------SEEQMEE-EFLDMA-------------------------VLKDYIAYARTYISPRLSEEASQALIEAYVDMRKIGSGRGMVSAYP---RQLESLIRLAEAHAKVRFSEKVETIDVEEAKRLHREALKQSATD 770          
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 292.352 bits (747), Expect = 2.710e-85
Identity = 210/615 (34.15%), Postives = 296/615 (48.13%), Query Frame = 1
Query:  412 QRIILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVK----MDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRK---RRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSD 2232
            Q +I    +A++ L F     S+         I VR  N        NL    I   I+L G V++ +Q+ P      F+C  C     V + D  + A P  C N  C +     L   + +V  D Q+I++QE+  D P                 G+ P T       DLVD   PGD V +TGI        +  QS     N       H++ I   K D K    +D D E     E  V+ L  + A   +P++++ L ++L PSIY HE +K  +LL LFGG  K  +   R   R   +IL+ GDPG  KSQ+LQ    + PR  Y  G   +  GLT    KD ++    L+ GALV+SDNG CCIDEFDKMS    + L E MEQQ++SIAKAG++C L+ART+VLAAANP    +N  KT  EN+++   LLSRFDL+++MLD  +E  D +L+ H++SL+ +        S  QM+   F  M                          +L+ YIAYA+ Y+ P+LS EA+  L E Y+ +RK    R  +   P   RQLES++RL EA A+    E     D ++ K L  E++    +D
Sbjct:  190 QEVIPTFDMAVNELFFERFPDSVLE-----YQIQVRPYNALKTKNMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVCAFSARVEV-DRGRIAEPAVCRN--CNNTHSMTLVH-NRSVFSDKQMIKIQESPEDMPA----------------GQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQS-----NVRSVYKTHIDAIHFRKTDEKRLHGLDQDGEQKLFTEDRVQTLKELAA---KPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQ--------SEEQMEE-EFLDMA-------------------------VLKDYIAYARTYISPRLSEEASQALIEAYVDMRKIGSGRGMVSAYP---RQLESLIRLAEAHAKVRFSEKVETIDVEEAKRLHREALKQSATD 734          
BLAST of DNA replication licensing factor MCM8 vs. Planmine SMEST
Match: SMESG000004906.1 (SMESG000004906.1)

HSP 1 Score: 1503.42 bits (3891), Expect = 0.000e+0
Identity = 752/756 (99.47%), Postives = 754/756 (99.74%), Query Frame = 1
Query:  229 METSQTVMRIEAFSSYFSCLKLNLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFXXXXXXXXXXXXXXXXXXXXXXQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLTAGF 2496
            METSQTVMRIEAFS YFSCLKLNLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFIS+KGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKD+DSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGST HERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFSRSQSGSGMSKSSASKKLISLLQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLTAGF
Sbjct:    1 METSQTVMRIEAFSGYFSCLKLNLEMIEIKKHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFANNISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISVKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDSDSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTLHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFSRSQSGSGMSKSSASKKLISLLQAHSERSGSSHFNYPDIKQIAINANIKLSDIENIVNTLNEQGFLLKKGPYSYKLLTAGF 756          
BLAST of DNA replication licensing factor MCM8 vs. Planmine SMEST
Match: SMESG000060238.1 (SMESG000060238.1)

HSP 1 Score: 307.375 bits (786), Expect = 2.200e-91
Identity = 196/568 (34.51%), Postives = 297/568 (52.29%), Query Frame = 1
Query:  553 NLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGG----VTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGTA-LEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGT-PITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDEL 2238
            NL    +   +++ G V++++++ P  I+  F+C  C N  +  +P +    +     N+ C++K  + +   +    ID Q+++LQE+  D P                 G  P T+     +DLVD   PGD V VTGI    S   N  Q        +F   L V +  + K  +   +D E   +A+ S + +  I A+  +P+L++ L  ++ P+IYG+E +K  LL+ LFGG      K G  +N   +R N H+L+ GDPG  KSQ+LQ    + PR  Y  G   +  GLT   +KD ++G++ L++GAL +SDNG CCIDEFDKM+    + L E MEQQS+SIAKAG++C L ARTSVLAAANP    ++  KT+ EN+++   LLSRFDL++++LD  +E  D+KL+RH++ L+                    H+ T EPG+                +   +LR YIAYAK+ +HP LS EA N + E Y+ +RK  +   G      RQLES++RL EA AR  L +     D  + + L  E++     D L
Sbjct:  186 NLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNN--VTKVPCERGRIIDPEFCNQ-CQAKHTQQIVH-NCCEFIDKQMVKLQESPEDMP----------------AGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRV---IKAVFKTYLDVLHFQKSKNRL---IDEE---EAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGEN---MRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCG------------------HNKTTEPGT----------------VDTAMLRDYIAYAKENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPL 687          
BLAST of DNA replication licensing factor MCM8 vs. Planmine SMEST
Match: SMESG000038798.1 (SMESG000038798.1)

HSP 1 Score: 273.092 bits (697), Expect = 9.241e-79
Identity = 180/611 (29.46%), Postives = 303/611 (49.59%), Query Frame = 1
Query:  526 NFSPICKSLNLQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSK-SFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMT---------------ESASTNFHQSSGSGSNCLFNL---------------VLHVNNICRLKGDVKMDVDSENSYDA---EFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHF---MDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGI 2244
            +F  +    NL+   +G  +  +G V++ + V P  +   F+C  C    +  +   + F  PT C N  C ++  FE + E  + V  D+Q +R+QET ++ P                 G IP+ ++ IL  + V+N  PGD+   TG ++                E+      +   SG   L  L               V  VNN      D  M+ + E +YD+   + + +++  +  ++ +PNL K +   L P+ YG++ VK  LLL LFGGV K   +  +  +RG+ +I IVGDP   KSQ L+     +PR+VY  G + + AGLT +  +D +SG   +EAGAL++++NG CCIDEFDKM  +   ++ EAMEQQ+IS+ KAG+   L+A+TSVLAAANP  G Y++++++ +N+ +SAP++SRFDL ++++D   E +D ++++ +          +S + I   D                                  +++YI +A+ +  P+++ EA  ++   Y  +R+R           IT RQLES+VRL+EA AR    +   E D  +   L+ +S++ V   ++ +
Sbjct:  112 DFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGT-VVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYV--DFQKVRVQETQNELP----------------RGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTED--MNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTK--LRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDD---------------------------------IQRYITFARCF-EPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINL 665          
BLAST of DNA replication licensing factor MCM8 vs. Planmine SMEST
Match: SMESG000023015.1 (SMESG000023015.1)

HSP 1 Score: 260.381 bits (664), Expect = 3.027e-74
Identity = 192/598 (32.11%), Postives = 296/598 (49.50%), Query Frame = 1
Query:  463 NNISSISNSDLPNIYINVRIANFSPICKSLNL----QANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPD-DYKFAV--PTRCVNRV--CKSKSFEPLKESDETVTI--DYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFK-LLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGTALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMG 2220
            N++      ++PN    VRI +  P C  ++     ++  +G F+S+   VV+   ++ +  + ++ C  CK   I    + D  F +  P  C N    C S +F+ ++ S  +     + Q I +QE                     + G +P+T+  IL  DLVD   PGD+VI+ G V+    +   +        C+  LV+  N I      V   + +  S  +E  +      E  H +    + LL++ +CP IYG   +K +L L L G    F N    + +RG SH+LIVGDPG  KSQ L+ A  + PRSV   G   T AGLTV+  K++  G +LEAGALV++D G CCIDEF  +      ++ EAMEQQSIS+AKAG+VC L  R SV+AA NP  G+Y+  +++  N  +++PLLSRFDL++++LD  NE  DS +S  +L+  T +S                                   KES +    + L+ Y AY +   HPK++ EA+ IL+++Y  +RK         IT R LES++RL+++ AR  +RE   E+DA     +M  ++ G
Sbjct:   91 NDMGVTLGKEIPNC--QVRITSL-PFCDEISRTSIPKSVDVGKFLSVAATVVRAGSIQVLEFQREYICKKCKFSVICEFSESDASFTINPPKFCSNYSSGCVSSAFDIVESSKLSPKFCRNRQEINVQE----------------QIKYLSFGCMPRTIKVILDDDLVDLVKPGDDVIINGTVIRRWNNLRVNDE------CVIQLVILANEI----QIVNHTISNNYSIKSEMKLDFQLFWEKYHGKSFTARNLLISQMCPLIYGMYFLKLALALVLCGSENCFFNG---MKVRGESHMLIVGDPGTAKSQFLKFAHKLTPRSVLTTGIGSTNAGLTVTAVKES-GGWSLEAGALVLADGGICCIDEFTSIRECDKVAIHEAMEQQSISVAKAGIVCKLKTRCSVIAATNPK-GNYDITQSITANTAIASPLLSRFDLIFLLLDNCNESWDSCVSDFILNHQTFES----------------------------------SKESFN---LEKLKSYFAYIRSTFHPKMTPEASVILEKYYTWMRKSEITNSLDRITMRFLESLIRLSQSHARFMMREFVKEEDAVMAVAVMESTVYG 617          
BLAST of DNA replication licensing factor MCM8 vs. Planmine SMEST
Match: SMESG000005389.1 (SMESG000005389.1)

HSP 1 Score: 242.276 bits (617), Expect = 4.056e-68
Identity = 181/608 (29.77%), Postives = 300/608 (49.34%), Query Frame = 1
Query:  460 ANNIS--SISNSDLPNIYINVRIANFSPICKSLN-LQANQIGSFISLKGNVVKVNQVKPVCIRVKFRCLTCKN--EQIVVLPDDYKFAVPTRC----------VNRVCKSKSFEPLK-ESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIV-MTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVK-MDV-DSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGT-ALEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLLRKYIAYAKKYVHPKLSSEAANILQEFYLSLR-------KRRHFMDGTPITTRQLESMVRLTEAKARSELREIANEQDAKDVKELM 2202
            AN+++   + N +LP+I I +++ +     KSL  +++NQI   I + G VV  + +K     +  RC  C+     + V P    + +P +C          V +  +S   +P   E D+    D+Q+++LQE   + P                 G +P+     + R L +  VPG+ V V GI  + +  S N  +  G   + +  L + + N    +  +  + V D E     EFS+K           P + +++  S+ P IYG+  +K ++   LFGG  K       V +RG+ +++++GDPG  KSQ+L+     AP +VY  G   + AGLT S  +D+ + +  +E GA+V++D G  CIDEFDKM      ++ EAMEQQ+ISIAKAG+   L++R SVLAAAN   GH+++ K   EN+     ++SRFD+++++ D  +E  D ++  HV+S+H        ++ + +   +S  S+T E G                 +P   L+KYIA+ +    P+L+ EA  I+   Y+S+R       K        PIT RQLE++VR+ E+ A+  L     E DA++   L 
Sbjct:  100 ANDVTYPRLENENLPSIQIMLKLDSHP---KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVP----------------HGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKD-GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLK-----------PGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRK--KMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDG---QAADVNE--NISLDSLTAETGI----------------MPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLF 652          
The following BLAST results are available for this feature:
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCM80.000e+047.07minichromosome maintenance 8 homologous recombinat... [more]
MCM80.000e+047.07minichromosome maintenance 8 homologous recombinat... [more]
MCM80.000e+046.58minichromosome maintenance 8 homologous recombinat... [more]
AL035461.40.000e+046.44novel protein[more]
MCM80.000e+044.60minichromosome maintenance 8 homologous recombinat... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm-27.158e-8734.49DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
mcm-27.158e-8734.49DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
mcm-48.654e-8333.10DNA replication licensing factor mcm-4 [Source:Un... [more]
mcm-48.654e-8333.10DNA replication licensing factor mcm-4 [Source:Un... [more]
mcm-67.407e-7429.61DNA replication licensing factor mcm-6 [Source:Un... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm62.413e-8733.05gene:FBgn0025815 transcript:FBtr0070952[more]
Mcm22.134e-8532.39gene:FBgn0014861 transcript:FBtr0081827[more]
dpa5.380e-7732.35gene:FBgn0015929 transcript:FBtr0345797[more]
dpa5.380e-7732.35gene:FBgn0015929 transcript:FBtr0088982[more]
rec7.580e-7427.84gene:FBgn0003227 transcript:FBtr0334595[more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm80.000e+046.39minichromosome maintenance 8 homologous recombinat... [more]
mcm27.373e-8534.84minichromosome maintenance complex component 2 [So... [more]
mcm42.808e-8434.27minichromosome maintenance complex component 4 [So... [more]
mcm6l3.005e-8132.31MCM6 minichromosome maintenance deficient 6, like ... [more]
mcm6l3.634e-8132.31MCM6 minichromosome maintenance deficient 6, like ... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde10a0.000e+045.64phosphodiesterase 10A [Source:Xenbase;Acc:XB-GENE-... [more]
pde10a0.000e+045.64phosphodiesterase 10A [Source:Xenbase;Acc:XB-GENE-... [more]
pde10a0.000e+045.53phosphodiesterase 10A [Source:Xenbase;Acc:XB-GENE-... [more]
pde10a0.000e+045.81phosphodiesterase 10A [Source:Xenbase;Acc:XB-GENE-... [more]
pde10a0.000e+044.64phosphodiesterase 10A [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm80.000e+046.50minichromosome maintenance 8 homologous recombinat... [more]
Mcm80.000e+046.73minichromosome maintenance 8 homologous recombinat... [more]
Mcm26.766e-8432.71minichromosome maintenance complex component 2 [So... [more]
Mcm69.312e-8431.12minichromosome maintenance complex component 6 [So... [more]
Mcm61.505e-8332.09minichromosome maintenance complex component 6 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D3ZVK1|MCM8_RAT0.000e+046.38DNA helicase MCM8 OS=Rattus norvegicus OX=10116 GN... [more]
sp|Q9CWV1|MCM8_MOUSE0.000e+046.50DNA helicase MCM8 OS=Mus musculus OX=10090 GN=Mcm8... [more]
sp|Q9UJA3|MCM8_HUMAN0.000e+047.07DNA helicase MCM8 OS=Homo sapiens OX=9606 GN=MCM8 ... [more]
sp|I0IUP3|MCM8_CHICK0.000e+046.04DNA helicase MCM8 OS=Gallus gallus OX=9031 GN=MCM8... [more]
sp|E1BPX4|MCM8_BOVIN0.000e+047.05DNA helicase MCM8 OS=Bos taurus OX=9913 GN=MCM8 PE... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JYB50.000e+049.75DNA helicase MCM8 OS=Lingula unguis OX=7574 GN=LOC... [more]
A0A0L8GIE40.000e+048.08MCM domain-containing protein OS=Octopus bimaculoi... [more]
A0A3B3T3T50.000e+047.47Minichromosome maintenance 8 homologous recombinat... [more]
G3GSC80.000e+047.01DNA replication licensing factor MCM8 OS=Cricetulu... [more]
A0A1U7QLN40.000e+046.77DNA helicase MCM8 isoform X1 OS=Mesocricetus aurat... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm80.000e+045.21minichromosome maintenance 8 homologous recombinat... [more]
mcm80.000e+045.10minichromosome maintenance 8 homologous recombinat... [more]
mcm28.131e-8734.84minichromosome maintenance complex component 2 [So... [more]
mcm29.054e-8734.84minichromosome maintenance complex component 2 [So... [more]
mcm21.311e-8634.84minichromosome maintenance complex component 2 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm80.000e+044.65minichromosome maintenance 8 homologous recombinat... [more]
ENSPMAT00000008164.12.169e-5931.71pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:... [more]
mcm53.878e-5630.61minichromosome maintenance complex component 5 [So... [more]
ENSPMAT00000006035.11.127e-5129.53pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
ENSPMAT00000006014.15.713e-4628.96pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MCM23.746e-8332.94Protein involved in DNA replication; component of ... [more]
MCM45.868e-8233.12Essential helicase component of heterohexameric MC... [more]
MCM62.217e-8031.89Protein involved in DNA replication; component of ... [more]
MCM53.819e-6631.26Component of the Mcm2-7 hexameric helicase complex... [more]
MCM31.025e-6230.32Protein involved in DNA replication; component of ... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO350601.195e-8733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339713.318e-8330.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424464.865e-7633.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344254.588e-7133.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379463.855e-6932.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm80.000e+044.74minichromosome maintenance 8 homologous recombinat... [more]
mcm80.000e+042.23minichromosome maintenance 8 homologous recombinat... [more]
mcm21.304e-8533.70minichromosome maintenance complex component 2 [So... [more]
mcm42.609e-8534.15minichromosome maintenance complex component 4 [So... [more]
mcm42.710e-8534.15minichromosome maintenance complex component 4 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004906.10.000e+099.47SMESG000004906.1[more]
SMESG000060238.12.200e-9134.51SMESG000060238.1[more]
SMESG000038798.19.241e-7929.46SMESG000038798.1[more]
SMESG000023015.13.027e-7432.11SMESG000023015.1[more]
SMESG000005389.14.056e-6829.77SMESG000005389.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001391 ID=SMED30001391|Name=DNA replication licensing factor MCM8|organism=Schmidtea mediterranea sexual|type=transcript|length=2777bp
CGTTTTATATAAAATTGAATGAATTCCAACCGCCAAAACTTTAATAGTCG
ACGTGGTCGTGGATATTTCGGCAGAAGATTTAAAAAGTCTACAAATTATA
TACCAAAGTCTGAAGGAGATATTTCATTAGATATATCTAGCACGAAAAAG
GTTAACATTTTAAAAACTTCACTTGTATCCAATTGTCCTTATCATGGCTG
GTTAATTTATTTTCCATTGGAAGAGTATATGGAAACTTCTCAAACCGTTA
TGCGAATCGAAGCTTTCTCAAGTTATTTTAGTTGTCTGAAGCTCAATCTA
GAAATGATCGAAATTAAAAAGCATGCAATTATTGATTACAATGACTTGTG
TTCATCGGAATATATAACTAAAGTAATTCATGAATTTAAAAATGAATTCC
AATTTAATTGCCAAAGAATTATTTTGGAAATGTGTCTTGCTTTGCATACT
CTGGTATTTGCAAATAATATTTCATCAATTTCTAATTCAGATTTACCAAA
CATTTATATCAATGTTCGAATAGCGAATTTTTCACCAATATGTAAATCAT
TAAATTTACAAGCAAATCAAATTGGAAGTTTTATTTCCTTGAAAGGAAAT
GTTGTCAAAGTTAATCAGGTTAAACCAGTTTGTATAAGAGTAAAATTTCG
CTGTTTAACATGTAAAAATGAGCAAATTGTTGTATTACCCGATGATTACA
AGTTTGCAGTGCCTACAAGATGTGTAAATAGAGTTTGCAAATCAAAAAGT
TTTGAACCTTTAAAAGAATCGGATGAAACTGTCACGATTGATTATCAGGT
GATTCGGTTACAAGAGACGGGCTCCGATTGTCCTCTACCGTTTTCATCGA
ATTCCGAGTCCATTCATCATGACAAGACAAATGAAGGACGAATACCAAAA
ACTTTAAATTGCATTTTAATAAGGGATTTAGTTGATAACTGTGTCCCTGG
GGATGAAGTTATAGTTACTGGTATTGTTATGACAGAGTCGGCATCTACTA
ACTTTCATCAATCCTCTGGATCGGGATCAAATTGCCTGTTTAATCTAGTG
CTTCACGTTAACAATATTTGCCGACTCAAAGGTGATGTTAAAATGGATGT
GGATAGTGAAAATTCGTACGATGCAGAATTTTCGGTTAAAGATCTTTATG
CAATCGAAGCTATTCATTCTGAACCAAATTTATTCAAACTATTAGTTGCA
AGCCTTTGTCCAAGCATATATGGTCATGAATTAGTCAAAGCAAGTTTGTT
GTTGGCTTTGTTTGGTGGGGTTACAAAATTCGGAAATGATAAAAATCGAG
TAGCGATTCGCGGGAATTCCCATATATTAATAGTTGGCGATCCAGGTCTT
GGTAAAAGTCAAATGTTACAATCTGCATGTGCAATTGCACCGAGGTCTGT
ATACATTTGTGGCGGTAGTGTGACTACTGCTGGATTGACAGTTTCATTTT
CTAAAGATAACGATTCTGGAACTGCTTTAGAAGCAGGAGCTTTAGTGATA
TCAGACAACGGTTGTTGTTGTATTGATGAATTTGATAAAATGAGTGCGCA
GCAGCACGCGTCATTATTGGAGGCGATGGAACAACAGAGCATTAGTATTG
CGAAAGCAGGAATGGTTTGTAATCTATCAGCAAGAACATCTGTTCTAGCC
GCTGCAAATCCTAATACTGGGCATTATAATAAGGCTAAAACAGTTGCAGA
GAATCTAAAAATGTCTGCACCTCTTTTATCCAGATTTGATCTGGTGTATA
TAATGCTTGATAGACCGAATGAAGTGTTGGATTCTAAATTGTCAAGACAT
GTTTTATCACTACACACTGAACAGTCTTTGAACAGATCATCTTCGAGTAT
TAGACAAATGGATACCATGTCGTTTCATTCGATGACAAAAGAACCTGGAT
CAACTTTTCATGAAAGATTGAGTTACGGACATAAGGAATCTTGTGATAAC
ATTCCTCCTCAACTGCTTAGAAAGTATATTGCTTATGCAAAAAAATATGT
CCATCCCAAGTTAAGCAGCGAAGCGGCTAATATTCTTCAAGAATTTTATC
TTTCATTGAGAAAACGCAGGCATTTTATGGATGGAACACCGATCACAACT
AGGCAGTTAGAATCGATGGTAAGATTAACTGAGGCTAAAGCCCGATCAGA
ATTAAGAGAAATTGCTAATGAACAAGATGCTAAAGATGTAAAGGAGCTAA
TGTTAGAAAGTATGATGGGAGTTTATAGTGATGAGCTTGGAATCTTGAAT
TTTTCACGATCACAATCTGGATCTGGCATGAGCAAATCTTCTGCTTCTAA
GAAGTTGATATCATTATTACAAGCACATAGCGAGAGATCGGGCTCTTCAC
ATTTTAATTATCCCGATATAAAACAAATTGCAATAAATGCAAACATAAAA
TTATCAGACATTGAGAATATCGTCAATACTCTCAATGAGCAAGGCTTTCT
TTTAAAAAAAGGTCCTTATTCATATAAGTTATTGACCGCTGGATTTTAGA
AATTAAGGACAAATTGTATTATAAAATAAACGTTTGTATTCCATTACTAG
TTTTAGTTTTATTTGGGATTTTTATTGTCTTAAAAGTAAATCGTAGAGCC
CAGTCGAATCTCCAGTAAAGATTTCGAACGGGATGGGATGGATAACATAA
AAATGAGAAATTAATATTTTACAATTATAATGCTACAATCAATTTTTAAT
GTATAAGAATTATTCATCAAGTGTGAATTGTACGGGAAACTTTCATCATT
TTTCGGTTAAAAATAAATCTTTTTTTC
back to top

protein sequence of SMED30001391-orf-1

>SMED30001391-orf-1 ID=SMED30001391-orf-1|Name=SMED30001391-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=827bp
MNSNRQNFNSRRGRGYFGRRFKKSTNYIPKSEGDISLDISSTKKVNILKT
SLVSNCPYHGWLIYFPLEEYMETSQTVMRIEAFSSYFSCLKLNLEMIEIK
KHAIIDYNDLCSSEYITKVIHEFKNEFQFNCQRIILEMCLALHTLVFANN
ISSISNSDLPNIYINVRIANFSPICKSLNLQANQIGSFISLKGNVVKVNQ
VKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKE
SDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCIL
IRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNI
CRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSI
YGHELVKASLLLALFGGVTKFGNDKNRVAIRGNSHILIVGDPGLGKSQML
QSACAIAPRSVYICGGSVTTAGLTVSFSKDNDSGTALEAGALVISDNGCC
CIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNT
GHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHT
EQSLNRSSSSIRQMDTMSFHSMTKEPGSTFHERLSYGHKESCDNIPPQLL
RKYIAYAKKYVHPKLSSEAANILQEFYLSLRKRRHFMDGTPITTRQLESM
VRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDELGILNFSRSQS
GSGMSKSSASKKLISLLQAHSERSGSSHFNYPDIKQIAINANIKLSDIEN
IVNTLNEQGFLLKKGPYSYKLLTAGF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006270DNA replication initiation
GO:0006260DNA replication
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR041562MCM_lid
IPR033762MCM_OB
IPR001208MCM_dom
IPR003593AAA+_ATPase
IPR031327MCM
IPR012340NA-bd_OB-fold
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005524ATP binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001208MCM domainPRINTSPR01657MCMFAMILYcoord: 489..503
score: 67.31
coord: 568..576
score: 68.1
coord: 517..530
score: 81.18
coord: 541..553
score: 62.37
coord: 430..445
score: 53.23
IPR001208MCM domainPFAMPF00493MCMcoord: 377..598
e-value: 2.5E-86
score: 288.4
IPR001208MCM domainPROSITEPS50051MCM_2coord: 387..594
score: 71.034
IPR031327Mini-chromosome maintenance proteinSMARTSM00350mcmcoord: 173..732
e-value: 2.1E-140
score: 482.5
IPR031327Mini-chromosome maintenance proteinPANTHERPTHR11630DNA REPLICATION LICENSING FACTORcoord: 34..822
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 431..583
e-value: 3.9E-4
score: 29.7
NoneNo IPR availableGENE3DG3DSA:2.20.28.10coord: 206..252
e-value: 3.0E-29
score: 103.5
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 178..342
e-value: 3.0E-29
score: 103.5
NoneNo IPR availablePANTHERPTHR11630:SF99coord: 34..822
NoneNo IPR availableCDDcd17759MCM8coord: 390..730
e-value: 5.72913E-145
score: 426.564
IPR041562MCM, AAA-lid domainPFAMPF17855MCM_lidcoord: 648..731
e-value: 6.4E-25
score: 87.4
IPR033762MCM OB domainPFAMPF17207MCM_OBcoord: 178..321
e-value: 4.7E-21
score: 74.9
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 96..346
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 397..734