Serine/threonine kinase

Overview
NameSerine/threonine kinase
Smed IDSMED30001388
Length (bp)1665
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine kinase (SMED30001388) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30001388) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine kinase (SMED30001388) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30001388) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001388

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30001388SMESG000004364.1 dd_Smed_v4_3411_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001388SMESG000004364.1 dd_Smed_v4_3411_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: BRSK2 (BR serine/threonine kinase 2 [Source:HGNC Symbol;Acc:HGNC:11405])

HSP 1 Score: 105.916 bits (263), Expect = 5.447e-26
Identity = 47/111 (42.34%), Postives = 73/111 (65.77%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            S+ ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:   23 SLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 133          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: BRSK2 (BR serine/threonine kinase 2 [Source:HGNC Symbol;Acc:HGNC:11405])

HSP 1 Score: 104.375 bits (259), Expect = 3.855e-25
Identity = 47/111 (42.34%), Postives = 73/111 (65.77%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            S+ ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:   66 SLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 176          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: BRSK2 (BR serine/threonine kinase 2 [Source:HGNC Symbol;Acc:HGNC:11405])

HSP 1 Score: 102.449 bits (254), Expect = 3.214e-22
Identity = 47/111 (42.34%), Postives = 73/111 (65.77%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            S+ ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  549 SLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 659          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: BRSK2 (BR serine/threonine kinase 2 [Source:HGNC Symbol;Acc:HGNC:11405])

HSP 1 Score: 102.449 bits (254), Expect = 3.527e-22
Identity = 47/111 (42.34%), Postives = 73/111 (65.77%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            S+ ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  527 SLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 637          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: BRSK2 (BR serine/threonine kinase 2 [Source:HGNC Symbol;Acc:HGNC:11405])

HSP 1 Score: 102.449 bits (254), Expect = 3.527e-22
Identity = 47/111 (42.34%), Postives = 73/111 (65.77%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            S+ ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  527 SLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 637          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: sad-1 (Serine/threonine kinase SAD-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19469])

HSP 1 Score: 77.411 bits (189), Expect = 1.223e-14
Identity = 45/126 (35.71%), Postives = 71/126 (56.35%), Query Frame = 1
Query:  535 VNSSVIGLLPSS--VNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRR--PAGSSILTRPVKIQVDLVRASPP----SSDREVYAVNFQLLSGPTRRFKRLCENLQTALLN 888
            V  S  G L SS  V  D+++   ++ + +N +KA+L+++ L    + H+V+    FR EY+R    G S+ +R +K+ VD++  SP     + +   Y V F LL+GP RRFKRL E+L   L N
Sbjct:  633 VKKSWFGSLASSMSVERDDTHCVPVQGKTLNSIKAELIRAFLQIHELSHSVVGQNCFRVEYKRGPTVGGSVFSRGIKMNVDII-PSPQQVVIAGETPTYVVQFVLLAGPVRRFKRLVEHLSAILQN 757          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: sad-1 (Serine/threonine kinase SAD-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19469])

HSP 1 Score: 77.411 bits (189), Expect = 1.448e-14
Identity = 45/126 (35.71%), Postives = 71/126 (56.35%), Query Frame = 1
Query:  535 VNSSVIGLLPSS--VNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRR--PAGSSILTRPVKIQVDLVRASPP----SSDREVYAVNFQLLSGPTRRFKRLCENLQTALLN 888
            V  S  G L SS  V  D+++   ++ + +N +KA+L+++ L    + H+V+    FR EY+R    G S+ +R +K+ VD++  SP     + +   Y V F LL+GP RRFKRL E+L   L N
Sbjct:  633 VKKSWFGSLASSMSVERDDTHCVPVQGKTLNSIKAELIRAFLQIHELSHSVVGQNCFRVEYKRGPTVGGSVFSRGIKMNVDII-PSPQQVVIAGETPTYVVQFVLLAGPVRRFKRLVEHLSAILQN 757          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: sff (gene:FBgn0036544 transcript:FBtr0334070)

HSP 1 Score: 80.4925 bits (197), Expect = 1.791e-15
Identity = 39/107 (36.45%), Postives = 66/107 (61.68%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPA-GSSILTRPVKIQVDLVRASPPSSDREV-YAVNFQLLSGPTRRFKRLCENLQTAL 882
            +  +D ++  ++K +PI  +KA L+ + LS   + H+V+SPT+FR EY+R   G  +  R VK QVD+          ++ +A+ F LLSG  RRF+R+CE++Q+ +
Sbjct:  627 TTEKDETFTILVKGKPIATVKAHLIHAFLSMAELSHSVVSPTSFRVEYKRNGNGPVMFQRHVKFQVDISAICKQGDIADMLFALTFTLLSGNIRRFRRICEHIQSQV 733          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: sff (gene:FBgn0036544 transcript:FBtr0334071)

HSP 1 Score: 80.4925 bits (197), Expect = 1.814e-15
Identity = 39/107 (36.45%), Postives = 66/107 (61.68%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPA-GSSILTRPVKIQVDLVRASPPSSDREV-YAVNFQLLSGPTRRFKRLCENLQTAL 882
            +  +D ++  ++K +PI  +KA L+ + LS   + H+V+SPT+FR EY+R   G  +  R VK QVD+          ++ +A+ F LLSG  RRF+R+CE++Q+ +
Sbjct:  633 TTEKDETFTILVKGKPIATVKAHLIHAFLSMAELSHSVVSPTSFRVEYKRNGNGPVMFQRHVKFQVDISAICKQGDIADMLFALTFTLLSGNIRRFRRICEHIQSQV 739          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: sff (gene:FBgn0036544 transcript:FBtr0089527)

HSP 1 Score: 80.4925 bits (197), Expect = 1.907e-15
Identity = 39/107 (36.45%), Postives = 66/107 (61.68%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPA-GSSILTRPVKIQVDLVRASPPSSDREV-YAVNFQLLSGPTRRFKRLCENLQTAL 882
            +  +D ++  ++K +PI  +KA L+ + LS   + H+V+SPT+FR EY+R   G  +  R VK QVD+          ++ +A+ F LLSG  RRF+R+CE++Q+ +
Sbjct:  643 TTEKDETFTILVKGKPIATVKAHLIHAFLSMAELSHSVVSPTSFRVEYKRNGNGPVMFQRHVKFQVDISAICKQGDIADMLFALTFTLLSGNIRRFRRICEHIQSQV 749          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: si:dkey-16p21.7 (si:dkey-16p21.7 [Source:ZFIN;Acc:ZDB-GENE-131122-54])

HSP 1 Score: 106.686 bits (265), Expect = 2.673e-26
Identity = 64/196 (32.65%), Postives = 93/196 (47.45%), Query Frame = 1
Query:  340 TLDMESKVCVD*YFPLKMVFLLYLLSVKALFMTLTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLV-----RASPPSSDRE--------VYAVNFQLLSGPTRRFKRLCENLQTALLN 888
            T+ +   +CV  Y     V LL  + +   F  L  KSWF  F+                                S+  +     +I+D+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G S+  +PVK QVD+      R      DRE        +Y+V F LLSGP+RRFKR+ E +Q  LL+
Sbjct:   11 TITIIHTICVYEYLINVYVCLLAYICICVHFFRLAKKSWFGNFI--------------------------------SLEREEQIFVVIRDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSSGGPSVFQKPVKFQVDIAFSEGERERERDKDREREGRRETGIYSVTFTLLSGPSRRFKRVVETIQAQLLS 174          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: si:ch211-255p10.4 (si:ch211-255p10.4 [Source:ZFIN;Acc:ZDB-GENE-121214-354])

HSP 1 Score: 101.293 bits (251), Expect = 1.869e-24
Identity = 45/111 (40.54%), Postives = 71/111 (63.96%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDL--VRASPPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            S+ ++     +I+D+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G S+  +PVK QVD+          D  +Y+V F L+SGP+RRF+R+ E +Q  LL+  
Sbjct:   23 SLEKEEQIFVVIRDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKTSGGPSVFQKPVKFQVDISFSEGEDGQKDFGIYSVTFSLISGPSRRFRRVVETIQAQLLSAH 133          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: FQ311928.1 (BR serine/threonine kinase 2a [Source:NCBI gene;Acc:100334759])

HSP 1 Score: 104.76 bits (260), Expect = 4.153e-23
Identity = 54/154 (35.06%), Postives = 83/154 (53.90%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                + ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+  AG ++  +PVK QVD+      ++++E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  540 LAKKSWFGNFIN--------------------------------LEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSTAGPTVFQKPVKFQVDITYTESTAANKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 661          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: FQ311928.1 (BR serine/threonine kinase 2a [Source:NCBI gene;Acc:100334759])

HSP 1 Score: 104.375 bits (259), Expect = 4.311e-23
Identity = 54/154 (35.06%), Postives = 83/154 (53.90%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                + ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+  AG ++  +PVK QVD+      ++++E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  540 LAKKSWFGNFIN--------------------------------LEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSTAGPTVFQKPVKFQVDITYTESTAANKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 661          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: brsk2b (BR serine/threonine kinase 2b [Source:ZFIN;Acc:ZDB-GENE-100422-3])

HSP 1 Score: 101.293 bits (251), Expect = 4.978e-22
Identity = 52/154 (33.77%), Postives = 82/154 (53.25%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                + ++     +I+D+P++ +KAD+V + LS P + H+V+S T+FRAEY+  AG ++  +PVK QVD+      ++ +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  540 LAKKSWFGNFIN--------------------------------LEKEEQIFVVIRDKPLSSIKADIVHAFLSIPSLSHSVVSQTSFRAEYKSTAGPTVFQKPVKFQVDITYTESMAATKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 661          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: fbxl7 (F-box and leucine-rich repeat protein 7 [Source:Xenbase;Acc:XB-GENE-964543])

HSP 1 Score: 106.301 bits (264), Expect = 1.662e-23
Identity = 55/158 (34.81%), Postives = 84/158 (53.16%), Query Frame = 1
Query:  427 LFMTLTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            LF  L  KSWF  F+N                                ++++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G S+  +PVK QVD+  +    + +E  +Y+V F L+SGP+RRFKR+ E +Q  LL+  
Sbjct:  510 LFHRLAKKSWFGNFIN--------------------------------LDKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSSGGPSVFQKPVKFQVDISYSEGAEAQKENGIYSVTFTLISGPSRRFKRVVETIQAQLLSTH 635          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: fbxl7 (F-box and leucine-rich repeat protein 7 [Source:Xenbase;Acc:XB-GENE-964543])

HSP 1 Score: 105.916 bits (263), Expect = 2.342e-23
Identity = 55/156 (35.26%), Postives = 84/156 (53.85%), Query Frame = 1
Query:  427 LFMTLTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLN 888
            LF  L  KSWF  F+N                                ++++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G S+  +PVK QVD+  +    + +E  +Y+V F L+SGP+RRFKR+ E +Q  LL+
Sbjct:  532 LFHRLAKKSWFGNFIN--------------------------------LDKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSSGGPSVFQKPVKFQVDISYSEGAEAQKENGIYSVTFTLISGPSRRFKRVVETIQAQLLS 655          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: fbxl7 (F-box and leucine-rich repeat protein 7 [Source:Xenbase;Acc:XB-GENE-964543])

HSP 1 Score: 105.916 bits (263), Expect = 2.347e-23
Identity = 55/158 (34.81%), Postives = 84/158 (53.16%), Query Frame = 1
Query:  427 LFMTLTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            LF  L  KSWF  F+N                                ++++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G S+  +PVK QVD+  +    + +E  +Y+V F L+SGP+RRFKR+ E +Q  LL+  
Sbjct:  578 LFHRLAKKSWFGNFIN--------------------------------LDKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSSGGPSVFQKPVKFQVDISYSEGAEAQKENGIYSVTFTLISGPSRRFKRVVETIQAQLLSTH 703          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: fbxl7 (F-box and leucine-rich repeat protein 7 [Source:Xenbase;Acc:XB-GENE-964543])

HSP 1 Score: 105.916 bits (263), Expect = 2.514e-23
Identity = 55/156 (35.26%), Postives = 84/156 (53.85%), Query Frame = 1
Query:  427 LFMTLTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLN 888
            LF  L  KSWF  F+N                                ++++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G S+  +PVK QVD+  +    + +E  +Y+V F L+SGP+RRFKR+ E +Q  LL+
Sbjct:  519 LFHRLAKKSWFGNFIN--------------------------------LDKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSSGGPSVFQKPVKFQVDISYSEGAEAQKENGIYSVTFTLISGPSRRFKRVVETIQAQLLS 642          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: fbxl7 (F-box and leucine-rich repeat protein 7 [Source:Xenbase;Acc:XB-GENE-964543])

HSP 1 Score: 105.531 bits (262), Expect = 2.708e-23
Identity = 55/158 (34.81%), Postives = 84/158 (53.16%), Query Frame = 1
Query:  427 LFMTLTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            LF  L  KSWF  F+N                                ++++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G S+  +PVK QVD+  +    + +E  +Y+V F L+SGP+RRFKR+ E +Q  LL+  
Sbjct:  508 LFHRLAKKSWFGNFIN--------------------------------LDKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSSGGPSVFQKPVKFQVDISYSEGAEAQKENGIYSVTFTLISGPSRRFKRVVETIQAQLLSTH 633          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Brsk2 (BR serine/threonine kinase 2 [Source:MGI Symbol;Acc:MGI:1923020])

HSP 1 Score: 103.605 bits (257), Expect = 5.781e-25
Identity = 53/154 (34.42%), Postives = 80/154 (51.95%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                + ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:   55 LAKKSWFGNFIN--------------------------------LEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 176          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Brsk2 (BR serine/threonine kinase 2 [Source:MGI Symbol;Acc:MGI:1923020])

HSP 1 Score: 104.375 bits (259), Expect = 6.536e-25
Identity = 53/154 (34.42%), Postives = 80/154 (51.95%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                + ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:   73 LAKKSWFGNFIN--------------------------------LEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 194          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Brsk2 (BR serine/threonine kinase 2 [Source:MGI Symbol;Acc:MGI:1923020])

HSP 1 Score: 101.293 bits (251), Expect = 2.574e-22
Identity = 53/154 (34.42%), Postives = 80/154 (51.95%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                + ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  328 LAKKSWFGNFIN--------------------------------LEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 449          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Brsk2 (BR serine/threonine kinase 2 [Source:MGI Symbol;Acc:MGI:1923020])

HSP 1 Score: 101.293 bits (251), Expect = 2.979e-22
Identity = 53/154 (34.42%), Postives = 80/154 (51.95%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                + ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  346 LAKKSWFGNFIN--------------------------------LEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 467          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Brsk2 (BR serine/threonine kinase 2 [Source:MGI Symbol;Acc:MGI:1923020])

HSP 1 Score: 102.064 bits (253), Expect = 2.989e-22
Identity = 53/154 (34.42%), Postives = 80/154 (51.95%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                + ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  539 LAKKSWFGNFIN--------------------------------LEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 660          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q8IWQ3|BRSK2_HUMAN (Serine/threonine-protein kinase BRSK2 OS=Homo sapiens OX=9606 GN=BRSK2 PE=1 SV=3)

HSP 1 Score: 102.064 bits (253), Expect = 2.088e-21
Identity = 47/111 (42.34%), Postives = 73/111 (65.77%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            S+ ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  527 SLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 637          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q69Z98|BRSK2_MOUSE (Serine/threonine-protein kinase BRSK2 OS=Mus musculus OX=10090 GN=Brsk2 PE=1 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 2.404e-21
Identity = 53/154 (34.42%), Postives = 80/154 (51.95%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                + ++     +IKD+P++ +KAD+V + LS P + H+VIS T+FRAEY+   G ++  +PVK QVD+       + +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  517 LAKKSWFGNFIN--------------------------------LEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTH 638          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q5RJI5|BRSK1_MOUSE (Serine/threonine-protein kinase BRSK1 OS=Mus musculus OX=10090 GN=Brsk1 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.190e-19
Identity = 46/117 (39.32%), Postives = 75/117 (64.10%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPP--------SSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            S++++     ++KD+P++ +KAD+V + LS P + H+V+S T+FRAEY+   G S+  +PV+ QVD+  +  P        SS   +Y+V F L+SGP+RRFKR+ E +Q  LL+  
Sbjct:  601 SLDKEEQIFLVLKDKPLSSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSSEGPEPSPRRDGSSGGGIYSVTFTLISGPSRRFKRVVETIQAQLLSTH 717          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|B2DD29|BRSK1_RAT (Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus OX=10116 GN=Brsk1 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.233e-19
Identity = 46/117 (39.32%), Postives = 75/117 (64.10%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPP--------SSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            S++++     ++KD+P++ +KAD+V + LS P + H+V+S T+FRAEY+   G S+  +PV+ QVD+  +  P        SS   +Y+V F L+SGP+RRFKR+ E +Q  LL+  
Sbjct:  601 SLDKEEQIFLVLKDKPLSSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSSEGPEPSPRRDGSSGGGIYSVTFTLISGPSRRFKRVVETIQAQLLSTH 717          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q8TDC3|BRSK1_HUMAN (Serine/threonine-protein kinase BRSK1 OS=Homo sapiens OX=9606 GN=BRSK1 PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 2.453e-19
Identity = 45/117 (38.46%), Postives = 74/117 (63.25%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPP--------SSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            S++++     ++KD+P++ +KAD+V + LS P + H+V+S T+FRAEY+   G S+  +PV+ QVD+  +  P        S    +Y+V F L+SGP+RRFKR+ E +Q  LL+  
Sbjct:  601 SLDKEEQIFLVLKDKPLSSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSSEGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQAQLLSTH 717          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A3P8FM00 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS10759 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.448e-37
Identity = 79/126 (62.70%), Postives = 94/126 (74.60%), Query Frame = 1
Query:  562 PSSVN---EDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPA-GSSILTRPVKIQVDLVRASPP--------------SSDREVYAVNFQLLSGPTRRFKRLCENLQTALL 885
            P  VN   E+ ++V M+K R +NRLKA+LVQ  L++PGVVHTVISPT+FRAEYRR   GSS+L RPVK+QVD+VRA+                SS+REVYAVNFQLLSGPTRRFKRLC+ LQTALL
Sbjct:  202 PGGVNAPPEETNHVVMVKGRALNRLKAELVQVFLATPGVVHTVISPTSFRAEYRRAGSGSSLLARPVKLQVDMVRATGGISTGSGHQNNINSISSEREVYAVNFQLLSGPTRRFKRLCDQLQTALL 327          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A183P8S3 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.665e-37
Identity = 79/126 (62.70%), Postives = 94/126 (74.60%), Query Frame = 1
Query:  562 PSSVN---EDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPA-GSSILTRPVKIQVDLVRASPP--------------SSDREVYAVNFQLLSGPTRRFKRLCENLQTALL 885
            P  VN   E+ ++V M+K R +NRLKA+LVQ  L++PGVVHTVISPT+FRAEYRR   GSS+L RPVK+QVD+VRA+                SS+REVYAVNFQLLSGPTRRFKRLC+ LQTALL
Sbjct:  202 PGGVNAPPEETNHVVMVKGRALNRLKAELVQVFLATPGVVHTVISPTSFRAEYRRAGSGSSLLARPVKLQVDMVRATGGISTGSGHQNNINSISSEREVYAVNFQLLSGPTRRFKRLCDQLQTALL 327          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A183W116 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 2.575e-36
Identity = 76/118 (64.41%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  577 EDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPA-GSSILTRPVKIQVDLVRASPP--------------SSDREVYAVNFQLLSGPTRRFKRLCENLQTALL 885
            E+ ++V M+K R +NRLKA+LVQ  L++PGVVHTVISPT+FRAEYRR   GSS+L RPVK+QVD+VRA+                SS+REVYAVNFQLLSGPTRRFKRLC+ LQTALL
Sbjct:  443 EETNHVVMVKGRALNRLKAELVQVFLATPGVVHTVISPTSFRAEYRRAGSGSSLLARPVKLQVDMVRATGGISTGSGHQNNINSISSEREVYAVNFQLLSGPTRRFKRLCDQLQTALL 560          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A3P8I5Y1 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS6422 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 2.676e-36
Identity = 76/118 (64.41%), Postives = 91/118 (77.12%), Query Frame = 1
Query:  577 EDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPA-GSSILTRPVKIQVDLVRASPP--------------SSDREVYAVNFQLLSGPTRRFKRLCENLQTALL 885
            E+ ++V M+K R +NRLKA+LVQ  L++PGVVHTVISPT+FRAEYRR   GSS+L RPVK+QVD+VRA+                SS+REVYAVNFQLLSGPTRRFKRLC+ LQTALL
Sbjct:  443 EETNHVVMVKGRALNRLKAELVQVFLATPGVVHTVISPTSFRAEYRRAGSGSSLLARPVKLQVDMVRATGGISTGSGHQNNINSISSEREVYAVNFQLLSGPTRRFKRLCDQLQTALL 560          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A504Y605 (BRSK1 (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_00739 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.893e-35
Identity = 78/123 (63.41%), Postives = 92/123 (74.80%), Query Frame = 1
Query:  565 SSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPA-GSSILTRPVKIQVDLVRAS---------------PPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALL 885
            S+  E+ S+V MIK R +NRLKA+LVQ  L++PGVVHTVISPT+FRAEYRR   GSS+L RPVK+QVD+VRA+               P  S+REVYAVNFQLLSGPTRRFKRLC+ LQ ALL
Sbjct: 1028 STFPEETSHVIMIKGRALNRLKAELVQVFLATPGVVHTVISPTSFRAEYRRAGSGSSLLARPVKLQVDMVRATGGISTGGVNAANLNNPIPSEREVYAVNFQLLSGPTRRFKRLCDQLQNALL 1150          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: ENSAMXT00000047696.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:10602995:10613882:1 gene:ENSAMXG00000036441.1 transcript:ENSAMXT00000047696.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 1.377e-26
Identity = 54/148 (36.49%), Postives = 81/148 (54.73%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQT 876
            L  KSWF  F+N                                + ++     +IKD+P++ +KAD+VQ+ LS P + H+VIS T+FRAEY+  AG ++  +PVK QVD+      ++ +E  +Y+V F LLSGP+RRFKR+ E +QT
Sbjct:   12 LAKKSWFGNFIN--------------------------------LEKEEQIFVVIKDKPLSSIKADIVQAFLSIPSLSHSVISQTSFRAEYKSTAGPTVFQKPVKFQVDITYTESSTATKENGIYSVTFTLLSGPSRRFKRVVETIQT 127          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: brsk2b (BR serine/threonine kinase 2b [Source:ZFIN;Acc:ZDB-GENE-100422-3])

HSP 1 Score: 105.531 bits (262), Expect = 3.471e-26
Identity = 46/108 (42.59%), Postives = 74/108 (68.52%), Query Frame = 1
Query:  571 VNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLN 888
            + ++     +I+D+P++ +KAD+V + LS P + H+V+S T+FRAEY+  AG ++  +PVK QVD+      S+ +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+
Sbjct:   24 LEKEEQIFIVIQDKPLSSIKADIVHAFLSIPSLSHSVVSQTSFRAEYKSTAGPTVFQKPVKFQVDITYTESTSATKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLS 131          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: si:dkey-16p21.7 (si:dkey-16p21.7 [Source:ZFIN;Acc:ZDB-GENE-131122-54])

HSP 1 Score: 99.3673 bits (246), Expect = 1.607e-23
Identity = 46/120 (38.33%), Postives = 72/120 (60.00%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE-----------VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            S+ ++     +I+D+P++ +KAD+V + LS P + H+VIS T+FRAEY+   GSS+  +PVK QVD+  +                   +Y+V F L+SGP+RRFKR+ E +Q  LL+  
Sbjct:   23 SLEKEEQIFVVIRDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSSGGSSVFQKPVKFQVDIAFSEGAREREREREREGKRESGIYSVTFTLISGPSRRFKRVVETIQAQLLSTH 142          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: brsk2b (BR serine/threonine kinase 2b [Source:ZFIN;Acc:ZDB-GENE-100422-3])

HSP 1 Score: 101.293 bits (251), Expect = 1.234e-22
Identity = 53/154 (34.42%), Postives = 82/154 (53.25%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                + ++     +I+D+P++ +KAD+V + LS P + H+V+S T+FRAEY+  AG ++  +PVK QVD+      S+ +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+  
Sbjct:  277 LAKKSWFGNFIN--------------------------------LEKEEQIFIVIQDKPLSSIKADIVHAFLSIPSLSHSVVSQTSFRAEYKSTAGPTVFQKPVKFQVDITYTESTSATKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSSH 398          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: brsk2b (BR serine/threonine kinase 2b [Source:ZFIN;Acc:ZDB-GENE-100422-3])

HSP 1 Score: 101.679 bits (252), Expect = 3.293e-22
Identity = 53/152 (34.87%), Postives = 82/152 (53.95%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLN 888
            L  KSWF  F+N                                + ++     +I+D+P++ +KAD+V + LS P + H+V+S T+FRAEY+  AG ++  +PVK QVD+      S+ +E  +Y+V F LLSGP+RRFKR+ E +Q  LL+
Sbjct:  498 LAKKSWFGNFIN--------------------------------LEKEEQIFIVIQDKPLSSIKADIVHAFLSIPSLSHSVVSQTSFRAEYKSTAGPTVFQKPVKFQVDITYTESTSATKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLS 617          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006846.1 (pep scaffold:Pmarinus_7.0:GL486840:4409:8039:-1 gene:ENSPMAG00000006185.1 transcript:ENSPMAT00000006846.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 5.562e-28
Identity = 46/110 (41.82%), Postives = 77/110 (70.00%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSS--DREVYAVNFQLLSGPTRRFKRLCENLQTALLNC 891
            S+++      M++++PI+ +KAD+V + LS P + H+V+SPT+FRAEY+ P+G S+  +PV+ QVD+  +  P S  D  V+++ F LLSGP+RRFKR+ E +Q  +++ 
Sbjct:   12 SLDKGEQIFLMVENKPISTIKADVVHAFLSIPSLSHSVVSPTSFRAEYKAPSGPSVFQKPVRFQVDIGSSEGPDSAGDGAVFSLTFTLLSGPSRRFKRVVETIQAQVMSS 121          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005863.1 (pep scaffold:Pmarinus_7.0:GL476540:352761:396238:1 gene:ENSPMAG00000005296.1 transcript:ENSPMAT00000005863.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 3.988e-21
Identity = 50/154 (32.47%), Postives = 77/154 (50.00%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLV--RASPPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                  ++     +IKD+PI+ +KAD+V + LS P + H+V+S T+FRAEY+      +  +PVK QVD+     +P   +  +Y+V F L+SGP+RRFK++ E +Q  L+N  
Sbjct:  275 LAKKSWFGNFIN--------------------------------AEKEEQIFVVIKDKPISSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKSAGSPVVFQKPVKFQVDITYSEGNPGLKETGIYSVTFTLMSGPSRRFKKVVEIIQAQLVNSH 396          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005858.1 (pep scaffold:Pmarinus_7.0:GL476540:315720:395230:1 gene:ENSPMAG00000005296.1 transcript:ENSPMAT00000005858.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 6.545e-21
Identity = 50/154 (32.47%), Postives = 77/154 (50.00%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLV--RASPPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQ 894
            L  KSWF  F+N                                  ++     +IKD+PI+ +KAD+V + LS P + H+V+S T+FRAEY+      +  +PVK QVD+     +P   +  +Y+V F L+SGP+RRFK++ E +Q  L+N  
Sbjct:  316 LAKKSWFGNFIN--------------------------------AEKEEQIFVVIKDKPISSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKSAGSPVVFQKPVKFQVDITYSEGNPGLKETGIYSVTFTLMSGPSRRFKKVVEIIQAQLVNSH 437          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: BRSK2 (serine/threonine-protein kinase BRSK2 [Source:NCBI gene;Acc:101159565])

HSP 1 Score: 101.679 bits (252), Expect = 2.678e-22
Identity = 54/152 (35.53%), Postives = 81/152 (53.29%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSS--DREVYAVNFQLLSGPTRRFKRLCENLQTALLN 888
            L  KSWF  F+N                                + ++     +I+D+P++ +KAD+V + LS P + H+VIS T+FRAEY+  AG ++  +PVK QVD+      S+  D  +Y+V F LLSGP+RRFKR+ E +Q  LL+
Sbjct:  537 LAKKSWFGNFIN--------------------------------LEKEEQIFIVIRDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSTAGPTVFQKPVKFQVDITYTESTSTTKDNGIYSVTFTLLSGPSRRFKRVVETIQAQLLS 656          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: BRSK2 (serine/threonine-protein kinase BRSK2 [Source:NCBI gene;Acc:101159565])

HSP 1 Score: 101.679 bits (252), Expect = 3.369e-22
Identity = 53/152 (34.87%), Postives = 82/152 (53.95%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDL--VRASPPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALLN 888
            L  KSWF  F+N                                + ++     +I+D+P++ +KAD+V + LS P + H+VIS T+FRAEY+  AG ++  +PVK QVD+    ++  + D  +Y+V F LLSGP+RRFKR+ E +Q  LL+
Sbjct:  537 LAKKSWFGNFIN--------------------------------LEKEEQIFIVIRDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSTAGPTVFQKPVKFQVDITYTESTSTTKDNGIYSVTFTLLSGPSRRFKRVVETIQAQLLS 656          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: BRSK2 (serine/threonine-protein kinase BRSK2 [Source:NCBI gene;Acc:101159565])

HSP 1 Score: 101.293 bits (251), Expect = 3.816e-22
Identity = 54/152 (35.53%), Postives = 81/152 (53.29%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSS--DREVYAVNFQLLSGPTRRFKRLCENLQTALLN 888
            L  KSWF  F+N                                + ++     +I+D+P++ +KAD+V + LS P + H+VIS T+FRAEY+  AG ++  +PVK QVD+      S+  D  +Y+V F LLSGP+RRFKR+ E +Q  LL+
Sbjct:  517 LAKKSWFGNFIN--------------------------------LEKEEQIFIVIRDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSTAGPTVFQKPVKFQVDITYTESTSTTKDNGIYSVTFTLLSGPSRRFKRVVETIQAQLLS 636          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: ENSORLT00000031125.1 (serine/threonine-protein kinase BRSK2-like [Source:NCBI gene;Acc:105357421])

HSP 1 Score: 100.138 bits (248), Expect = 9.570e-22
Identity = 55/170 (32.35%), Postives = 92/170 (54.12%), Query Frame = 1
Query:  568 SVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDRE--VYAVNFQLLSGPTRRFKRLCENLQTALLNCQXXXXXXXXXXXXXXISSSLVANNGCVVDDNNSQLSYLSKDCVFKYPSHQTSNTSLISAG 1071
            S+ ++     +I+D+P++ +KAD+VQ+ LS P + H+VIS T+FRAEY+  A  ++  +PVK QVD+      ++ +E  VY+V+F LLSGP+RRFKR+ E +Q  LL+                           + D+ N Q+S+ +     + P    ++    +AG
Sbjct:  524 SLEKEEQIFIVIRDKPLSSIKADVVQAFLSIPSLSHSVISQTSFRAEYKSTASPTVFQKPVKFQVDISYTGGSAAAKENAVYSVSFTLLSGPSRRFKRVVETIQNQLLSTHDQPGVQQ------------------LTDEKNGQVSHAASPAHIRRPGSGQNDAKFRAAG 675          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: BRSK2 (serine/threonine-protein kinase BRSK2 [Source:NCBI gene;Acc:101159565])

HSP 1 Score: 100.523 bits (249), Expect = 9.855e-22
Identity = 53/152 (34.87%), Postives = 82/152 (53.95%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDL--VRASPPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALLN 888
            L  KSWF  F+N                                + ++     +I+D+P++ +KAD+V + LS P + H+VIS T+FRAEY+  AG ++  +PVK QVD+    ++  + D  +Y+V F LLSGP+RRFKR+ E +Q  LL+
Sbjct:  667 LAKKSWFGNFIN--------------------------------LEKEEQIFIVIRDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKSTAGPTVFQKPVKFQVDITYTESTSTTKDNGIYSVTFTLLSGPSRRFKRVVETIQAQLLS 786          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000004364.1 (SMESG000004364.1)

HSP 1 Score: 412.535 bits (1059), Expect = 1.472e-133
Identity = 262/265 (98.87%), Postives = 262/265 (98.87%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQXXXXXXXXXXXXXXISSSLVANNGCVVDDNNSQLSYLSKDCVFKYPSHQTSNTSLISAGXXXXXXXXXXXXXXXXXXRDNSAGVPLTDISSGQNAKNKRLSVTSINAAHSCNR 1233
            LTNKSWFETFLNPISNHSTTSTITTLNQQTETVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQ   SSCIKSNPSDIISSSLVANNGCVVDDNNSQLSYLSKDCVFKYPSHQTSNTSLISAGSKSVDSQTSSKPSSTPPKRDNSAGVPLTDISSGQNAKNKRLSVTSINAAHSCNR
Sbjct:  652 LTNKSWFETFLNPISNHSTTSTITTLNQQTETVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQ-SISSCIKSNPSDIISSSLVANNGCVVDDNNSQLSYLSKDCVFKYPSHQTSNTSLISAGSKSVDSQTSSKPSSTPPKRDNSAGVPLTDISSGQNAKNKRLSVTSINAAHSCNR 915          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000004364.1 (SMESG000004364.1)

HSP 1 Score: 412.535 bits (1059), Expect = 2.420e-133
Identity = 262/265 (98.87%), Postives = 262/265 (98.87%), Query Frame = 1
Query:  439 LTNKSWFETFLNPXXXXXXXXXXXXXXXXXXXVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQXXXXXXXXXXXXXXISSSLVANNGCVVDDNNSQLSYLSKDCVFKYPSHQTSNTSLISAGXXXXXXXXXXXXXXXXXXRDNSAGVPLTDISSGQNAKNKRLSVTSINAAHSCNR 1233
            LTNKSWFETFLNPISNHSTTSTITTLNQQTETVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQ   SSCIKSNPSDIISSSLVANNGCVVDDNNSQLSYLSKDCVFKYPSHQTSNTSLISAGSKSVDSQTSSKPSSTPPKRDNSAGVPLTDISSGQNAKNKRLSVTSINAAHSCNR
Sbjct:  682 LTNKSWFETFLNPISNHSTTSTITTLNQQTETVNSSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISPTTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDREVYAVNFQLLSGPTRRFKRLCENLQTALLNCQ-SISSCIKSNPSDIISSSLVANNGCVVDDNNSQLSYLSKDCVFKYPSHQTSNTSLISAGSKSVDSQTSSKPSSTPPKRDNSAGVPLTDISSGQNAKNKRLSVTSINAAHSCNR 945          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000033847.1 (SMESG000033847.1)

HSP 1 Score: 73.559 bits (179), Expect = 6.697e-17
Identity = 31/47 (65.96%), Postives = 38/47 (80.85%), Query Frame = -1
Query:  142 ITENMIYLGKSNLLPVNLCPDLLDRMWYCFKALADRNFSMFNAKQGM 282
            I  +MI LGKS+LLP ++CPDLLDRMW+C KALADRNF++  A Q M
Sbjct:  610 IIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSM 656          

HSP 2 Score: 33.113 bits (74), Expect = 6.697e-17
Identity = 17/34 (50.00%), Postives = 21/34 (61.76%), Query Frame = -2
Query:  270 STHTLDSMSSVALKVEIIKVFCQLFDTLWESPKT 371
            S  T D M  V L V ++KVFC+L D L ES K+
Sbjct:  559 SLFTPDFMPGVTLSVALVKVFCRLSDALRESGKS 592          
The following BLAST results are available for this feature:
BLAST of Serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BRSK25.447e-2642.34BR serine/threonine kinase 2 [Source:HGNC Symbol;A... [more]
BRSK23.855e-2542.34BR serine/threonine kinase 2 [Source:HGNC Symbol;A... [more]
BRSK23.214e-2242.34BR serine/threonine kinase 2 [Source:HGNC Symbol;A... [more]
BRSK23.527e-2242.34BR serine/threonine kinase 2 [Source:HGNC Symbol;A... [more]
BRSK23.527e-2242.34BR serine/threonine kinase 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sad-11.223e-1435.71Serine/threonine kinase SAD-1 [Source:UniProtKB/S... [more]
sad-11.448e-1435.71Serine/threonine kinase SAD-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sff1.791e-1536.45gene:FBgn0036544 transcript:FBtr0334070[more]
sff1.814e-1536.45gene:FBgn0036544 transcript:FBtr0334071[more]
sff1.907e-1536.45gene:FBgn0036544 transcript:FBtr0089527[more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-16p21.72.673e-2632.65si:dkey-16p21.7 [Source:ZFIN;Acc:ZDB-GENE-131122-5... [more]
si:ch211-255p10.41.869e-2440.54si:ch211-255p10.4 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
FQ311928.14.153e-2335.06BR serine/threonine kinase 2a [Source:NCBI gene;Ac... [more]
FQ311928.14.311e-2335.06BR serine/threonine kinase 2a [Source:NCBI gene;Ac... [more]
brsk2b4.978e-2233.77BR serine/threonine kinase 2b [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxl71.662e-2334.81F-box and leucine-rich repeat protein 7 [Source:Xe... [more]
fbxl72.342e-2335.26F-box and leucine-rich repeat protein 7 [Source:Xe... [more]
fbxl72.347e-2334.81F-box and leucine-rich repeat protein 7 [Source:Xe... [more]
fbxl72.514e-2335.26F-box and leucine-rich repeat protein 7 [Source:Xe... [more]
fbxl72.708e-2334.81F-box and leucine-rich repeat protein 7 [Source:Xe... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Brsk25.781e-2534.42BR serine/threonine kinase 2 [Source:MGI Symbol;Ac... [more]
Brsk26.536e-2534.42BR serine/threonine kinase 2 [Source:MGI Symbol;Ac... [more]
Brsk22.574e-2234.42BR serine/threonine kinase 2 [Source:MGI Symbol;Ac... [more]
Brsk22.979e-2234.42BR serine/threonine kinase 2 [Source:MGI Symbol;Ac... [more]
Brsk22.989e-2234.42BR serine/threonine kinase 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IWQ3|BRSK2_HUMAN2.088e-2142.34Serine/threonine-protein kinase BRSK2 OS=Homo sapi... [more]
sp|Q69Z98|BRSK2_MOUSE2.404e-2134.42Serine/threonine-protein kinase BRSK2 OS=Mus muscu... [more]
sp|Q5RJI5|BRSK1_MOUSE1.190e-1939.32Serine/threonine-protein kinase BRSK1 OS=Mus muscu... [more]
sp|B2DD29|BRSK1_RAT1.233e-1939.32Serine/threonine-protein kinase BRSK1 OS=Rattus no... [more]
sp|Q8TDC3|BRSK1_HUMAN2.453e-1938.46Serine/threonine-protein kinase BRSK1 OS=Homo sapi... [more]
back to top
BLAST of Serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8FM001.448e-3762.70Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A183P8S31.665e-3762.70Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A183W1162.575e-3664.41Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A3P8I5Y12.676e-3664.41Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A504Y6052.893e-3563.41BRSK1 (Fragment) OS=Fasciola gigantica OX=46835 GN... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000047696.11.377e-2636.49pep primary_assembly:Astyanax_mexicanus-2.0:8:1060... [more]
brsk2b3.471e-2642.59BR serine/threonine kinase 2b [Source:ZFIN;Acc:ZDB... [more]
si:dkey-16p21.71.607e-2338.33si:dkey-16p21.7 [Source:ZFIN;Acc:ZDB-GENE-131122-5... [more]
brsk2b1.234e-2234.42BR serine/threonine kinase 2b [Source:ZFIN;Acc:ZDB... [more]
brsk2b3.293e-2234.87BR serine/threonine kinase 2b [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000006846.15.562e-2841.82pep scaffold:Pmarinus_7.0:GL486840:4409:8039:-1 ge... [more]
ENSPMAT00000005863.13.988e-2132.47pep scaffold:Pmarinus_7.0:GL476540:352761:396238:1... [more]
ENSPMAT00000005858.16.545e-2132.47pep scaffold:Pmarinus_7.0:GL476540:315720:395230:1... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BRSK22.678e-2235.53serine/threonine-protein kinase BRSK2 [Source:NCBI... [more]
BRSK23.369e-2234.87serine/threonine-protein kinase BRSK2 [Source:NCBI... [more]
BRSK23.816e-2235.53serine/threonine-protein kinase BRSK2 [Source:NCBI... [more]
ENSORLT00000031125.19.570e-2232.35serine/threonine-protein kinase BRSK2-like [Source... [more]
BRSK29.855e-2234.87serine/threonine-protein kinase BRSK2 [Source:NCBI... [more]
back to top
BLAST of Serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000004364.11.472e-13398.87SMESG000004364.1[more]
SMESG000004364.12.420e-13398.87SMESG000004364.1[more]
SMESG000033847.16.697e-1765.96SMESG000033847.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001388 ID=SMED30001388|Name=Serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1665bp
CCGATCTTGAAAATAATGAAAATTCTACCTCCAACACGATTTCCTCTACC
ACAGCAACAAATACCTCCAATCACACTACAACAGTTTTCAGTGTCACAGG
TCCAGGAAGAATAACAGCAGAATCCTCTCCCGAATCATCCCCATTCCCTG
CTTTGCATTAAACATGCTGAAATTGCGGTCAGCGAGAGCCTTGAAACAGT
ACCACATTCTATCTAGGAGATCTGGACAAAGATTAACAGGCAGCAGATTT
GATTTTCCAAGATAAATCATGTTTTCGGTGATTCCCAGAGCGTGTCAAAC
AATTGACAAAACACCTTTATTATTTCTACCTTCAGAGCAACACTGGACAT
GGAATCCAAAGTGTGTGTCGATTGATATTTTCCTTTGAAGATGGTCTTCT
TACTCTACTTACTTAGCGTTAAAGCACTTTTTATGACGCTGACAAATAAA
TCATGGTTCGAAACTTTTCTTAATCCAATTTCCAATCATTCTACTACTTC
TACTATTACCACTTTAAATCAGCAAACAGAAACTGTAAATTCCTCAGTTA
TTGGATTGTTACCATCTTCAGTCAATGAAGATAACAGTTATGTAACTATG
ATTAAAGACCGTCCAATTAATCGGTTAAAGGCTGATTTAGTCCAAAGCTT
ATTATCTAGTCCTGGAGTTGTTCATACTGTGATATCACCAACTACTTTTA
GGGCTGAGTATAGGCGTCCAGCAGGATCTAGTATTTTGACTAGACCGGTA
AAAATACAAGTTGATCTCGTTAGGGCATCACCACCATCATCAGATAGAGA
AGTTTATGCTGTGAATTTTCAGTTATTATCAGGACCCACCAGAAGATTTA
AACGACTATGTGAAAATCTCCAAACTGCCTTACTTAATTGTCAATCTATA
TCATCTTCTTGCATTAAATCTAATCCCAGTGACATAATTTCCTCAAGCTT
AGTTGCAAATAATGGATGCGTTGTTGATGATAATAATAGTCAATTAAGTT
ATTTATCAAAAGACTGCGTTTTTAAGTATCCATCACACCAGACTTCTAAT
ACAAGTTTAATTAGTGCCGGTAGTAAATCAGTGGATTCTCAAACATCCAG
CAAACCATCGTCTACACCTCCAAAAAGAGATAATTCAGCCGGTGTTCCAC
TTACAGATATTAGCTCAGGACAAAATGCTAAAAATAAAAGATTGTCTGTA
ACATCAATCAATGCCGCTCACTCTTGTAATAGAAGCAATTCCATAGAGAA
AAGTAGTTTCAGTTCTTCAAATTCTTCATCTTCACTAGCTCTGCTCAATA
ATGAAGAAGAGGTAAAAATATTTTGTATTAATCAGTTAATTTTAATTCCT
TAAATTAAAATTTGAAATGTATACTAGAATTGCTTTCACCATTAAAAATT
AATCCCGGCAGGTATGTGATTCATATATTTTAATTTAATCGCGTCACATT
TAACCAGTCAGCCGAAATATATTATTCATTTATAGAATGATGTTTTATTT
ATTTCGAATTTGTTTAAATGTTATCTACAAACAGTTTTTCATTAATTAGA
TCGAATCGTTTCTGTCTGTTATCTTCGATAAAGAAACACTGTGTAATTGT
AGGTACAATAAATGTATATTTATATTTTATTTTTTTCCTTAAATTTGAAT
TTGACGGTGTCGGGG
back to top

protein sequence of SMED30001388-orf-1

>SMED30001388-orf-1 ID=SMED30001388-orf-1|Name=SMED30001388-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=321bp
MVFLLYLLSVKALFMTLTNKSWFETFLNPISNHSTTSTITTLNQQTETVN
SSVIGLLPSSVNEDNSYVTMIKDRPINRLKADLVQSLLSSPGVVHTVISP
TTFRAEYRRPAGSSILTRPVKIQVDLVRASPPSSDREVYAVNFQLLSGPT
RRFKRLCENLQTALLNCQSISSSCIKSNPSDIISSSLVANNGCVVDDNNS
QLSYLSKDCVFKYPSHQTSNTSLISAGSKSVDSQTSSKPSSTPPKRDNSA
GVPLTDISSGQNAKNKRLSVTSINAAHSCNRSNSIEKSSFSSSNSSSSLA
LLNNEEEVKIFCINQLILIP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0035556intracellular signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 208..250
NoneNo IPR availablePANTHERPTHR24346:SF36coord: 27..155
NoneNo IPR availablePANTHERPTHR24346MAP/MICROTUBULE AFFINITY-REGULATING KINASEcoord: 27..155