Glutamate receptor ionotropic

Overview
NameGlutamate receptor ionotropic
Smed IDSMED30001387
Length (bp)2939
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor ionotropic (SMED30001387) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor ionotropic (SMED30001387) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor ionotropic (SMED30001387) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor ionotropic (SMED30001387) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001387

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001387SMESG000049467.1 SmedASXL_014029SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30001387SMESG000049467.1 dd_Smed_v4_16476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001387SMESG000049467.1 dd_Smed_v4_16476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001387SMESG000049467.1 dd_Smed_v4_16476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001387SMESG000049467.1 dd_Smed_v6_16476_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30001387SMESG000049467.1 OX_Smed_1.0.13391ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Match: GRID1 (glutamate ionotropic receptor delta type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4575])

HSP 1 Score: 170.629 bits (431), Expect = 1.239e-42
Identity = 174/643 (27.06%), Postives = 286/643 (44.48%), Query Frame = 1
Query:  535 VFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSK---DLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSS----------TYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKIL--WTRTNGLGNYNFSL------NVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW 2379
            VF        TEE+ ++   LR + ++L+ +       IN+A+ +N  +   HW  V++   D EI        G   +  +         K    N  +SS              I  +Y Y +  +L  A  +      W  S +  +C   ST       +ML + +K   I G+ G + F     N + +  +   T   +     + L  W    GL   N SL      + L    L+++ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  DG+YG    N ++ GMIGEL +K  D+A+ AITIT ERE VVDFS  Y DY ++ IL+KK     K         F + VWA + A I   G LI  ++R+     Q+  +              T+  ++W V GA+ Q G      S++ R+++   WLF  ++ + YTANL+A LTV+++ +   + Q+L+ Q    Y T  ++++++YF                KG N L+  +++     W+         +     A     + SE I+K  + ++A   +  +++Y   T+ DC +  +G   S + YGI LQ+ SP  +  + RIL LQ    L+ LK KWW
Sbjct:  204 VFTSLFTTMKTEELNRYRDTLRRAILLLSPQG--AHSFINEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCTRNNHRISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWH-SMASLNCIRKSTKPWNGGRSML-DTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGL---NGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDY-SVGILIKK--PEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASA-------TLHSAIWIVYGAFVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMSYGTVRDSAVYEYF--------------RAKGTNPLE--QDSTFAELWR--------TISKNGGADNCVSSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWW 805          
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 167.162 bits (422), Expect = 9.556e-42
Identity = 138/502 (27.49%), Postives = 233/502 (46.41%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGL----GNYNFSLNV---LTQKQLRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L+K     G+ G ITFN T  ++  F   ++S    G+  + +    W   +GL     N + S N+   L  + L +  I E P+V+          N+ FEGY +D++ +L+  + F Y      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R        N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  D+  ++ LG++ +
Sbjct:  360 FMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKIGI----WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQT-ALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDNKEASALGVENI 820          
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 167.162 bits (422), Expect = 1.093e-41
Identity = 138/502 (27.49%), Postives = 233/502 (46.41%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGL----GNYNFSLNV---LTQKQLRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L+K     G+ G ITFN T  ++  F   ++S    G+  + +    W   +GL     N + S N+   L  + L +  I E P+V+          N+ FEGY +D++ +L+  + F Y      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R        N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  D+  ++ LG++ +
Sbjct:  360 FMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKIGI----WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQT-ALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDNKEASALGVENI 820          
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 167.162 bits (422), Expect = 1.141e-41
Identity = 138/502 (27.49%), Postives = 233/502 (46.41%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGL----GNYNFSLNV---LTQKQLRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L+K     G+ G ITFN T  ++  F   ++S    G+  + +    W   +GL     N + S N+   L  + L +  I E P+V+          N+ FEGY +D++ +L+  + F Y      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R        N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  D+  ++ LG++ +
Sbjct:  360 FMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKIGI----WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQT-ALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDNKEASALGVENI 820          
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 163.696 bits (413), Expect = 1.327e-40
Identity = 160/663 (24.13%), Postives = 283/663 (42.68%), Query Frame = 1
Query:  550 VNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNKCKSGSFFLFHKKIDDIP-----------LFDKIKTINSSVSSTYRAIEMVYA---YQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGL-------GNYNFSLNVLTQKQLRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
            ++  ++  +++ +K+ R   II      + + ++ QA+    +   YH+   + DL        +     L   +I ++              ++++    S S     + M  A   Y    ++ V   +A  + + +        W              M  +K     G+ G+I FN T  ++  F   ++S    G   V V    W+  +GL       G      + LT + L +  + E PFV+          N+ FEGY ID++ +LA  + F+Y      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+ +DFS P+     + IL +K    T      FL   + ++W  V+   +G   ++  + R SP+ + +    N   E   +   FT+  S WF +G+  Q G    P+++S R+I    W F  ++++ YTANL+A LTV ++ S   S                 T I    +  +K  A + TF+ +  I+  +K         W +        M ++ +A     N  E I++ +  D+AL +E+  I+Y T R+C L  +G     + YGI     SP  +++ + IL LQ +  L  +K KWW    S CP  ++  ++ LG+  +
Sbjct:  209 IDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYSGVNLTGFRILNVDNPHVSAIVEKWSMERLQAAPRSESGLLDGVMMTDAALLYDAVHIVSVCYQRAPQMTVNSLQCHRHKAWRFG--------GRFMNFIKEAQWEGLTGRIVFNKTSGLRTDFDLDIISLKEDGLEKVGV----WSPADGLNITEVAKGRGPNVTDSLTNRSLIVTTVLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTL-GVSILYRKPNG-TNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENN--FTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIE---YGAVKDGATM-TFFKKSKISTFEK--------MWAF--------MSSKPSA--LVKNNEEGIQRALTADYALLMESTTIEYVTQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLHIMKEKWWRG--SGCPEEENKEASALGIQKI 821          
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 254.603 bits (649), Expect = 2.287e-71
Identity = 176/606 (29.04%), Postives = 306/606 (50.50%), Query Frame = 1
Query:  685 VYHWFVVSKDLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAIEMVYAYQT---------GQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKIL--WTRTNGLGNYNFSLNVLTQKQ--LRILVIPEPPFVIKT--PNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIE--DDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW--NSDKSVCP-TVDSSAGLGLDTL 2442
            V++ +V++KD+  F C+ C+S   F+F  +   +    +I+ ++  +      +E+ Y+              V+G A    +++N        F+C    +  N+      + L       G   +   N+  Q+   +I   +          +K +  W+  + L     +L V  +     R++ + +PPFV +T  P+  +EGY ID++  +   +NF YT YE  DG +G++ DNG + G+IG L + + D+A+  +++ +ERE  VDF++PYYD     ILMKK  A  +     F+K   W VW  ++A  + T  L+   DR SP+SF N   N E  + + + + F++KE +WF + + T  G    P++IS R++    WLF ++++A YTANL+A LTV++L     SL +LA Q    Y     ++   YF RM + E   +  W E  +N    P++ A ++ W YP+ +++TNM+  M       N+  ++ +++   D +A   +   IKY    +C L  VG  FS++PY I +Q+   L ++++  IL+L  +R LE LK KWW  N +K  CP + D S G+ +  +
Sbjct:  173 VFNTYVLTKDITAFKCDSCESA--FMFWLRPFPVGKLMEIRDLDDYLFRNEIGLELDYSINGWDSLNVAFYMNVMGYAFETIRTMNATFDVLPTFTCQTGPSEPNITTTVRDIILNDPAHEYGNYTEAGLNMFFQDVEVRIYKIDRDRDHEDALFNKEVGVWSPISKLSVMYGTLQVDVRNLNIFRVVTLIQPPFVQRTGDPDTPYEGYCIDLINMIQVEVNFTYTIYEVEDGSFGTMDDNGNWNGLIGALVSGSADIALAPLSVMAERENDVDFTVPYYDLVGTTILMKK--ADVEYSLFKFMKVLEWPVWLCIVAAYLFTSILLWIFDRFSPYSFTN---NKERYQNDIEKRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAATWWLFGFIIIASYTANLAAFLTVSRLEQPISSLDDLAKQYKIEYAPIKGSASETYFRRMAEIEETFYNMWKEMSLNESMSPRDRAKLAVWDYPVSDKFTNMWRYMQESKLPVNMDTAVDRVLNSVDGFAFIGDATEIKYAALTNCNLQQVGTEFSRKPYAIAVQSGHILKDKISSAILMLLNERRLETLKEKWWTDNPNKVSCPDSSDESDGISIQNI 771          
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 254.603 bits (649), Expect = 2.776e-71
Identity = 176/606 (29.04%), Postives = 306/606 (50.50%), Query Frame = 1
Query:  685 VYHWFVVSKDLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAIEMVYAYQT---------GQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKIL--WTRTNGLGNYNFSLNVLTQKQ--LRILVIPEPPFVIKT--PNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIE--DDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW--NSDKSVCP-TVDSSAGLGLDTL 2442
            V++ +V++KD+  F C+ C+S   F+F  +   +    +I+ ++  +      +E+ Y+              V+G A    +++N        F+C    +  N+      + L       G   +   N+  Q+   +I   +          +K +  W+  + L     +L V  +     R++ + +PPFV +T  P+  +EGY ID++  +   +NF YT YE  DG +G++ DNG + G+IG L + + D+A+  +++ +ERE  VDF++PYYD     ILMKK  A  +     F+K   W VW  ++A  + T  L+   DR SP+SF N   N E  + + + + F++KE +WF + + T  G    P++IS R++    WLF ++++A YTANL+A LTV++L     SL +LA Q    Y     ++   YF RM + E   +  W E  +N    P++ A ++ W YP+ +++TNM+  M       N+  ++ +++   D +A   +   IKY    +C L  VG  FS++PY I +Q+   L ++++  IL+L  +R LE LK KWW  N +K  CP + D S G+ +  +
Sbjct:  192 VFNTYVLTKDITAFKCDSCESA--FMFWLRPFPVGKLMEIRDLDDYLFRNEIGLELDYSINGWDSLNVAFYMNVMGYAFETIRTMNATFDVLPTFTCQTGPSEPNITTTVRDIILNDPAHEYGNYTEAGLNMFFQDVEVRIYKIDRDRDHEDALFNKEVGVWSPISKLSVMYGTLQVDVRNLNIFRVVTLIQPPFVQRTGDPDTPYEGYCIDLINMIQVEVNFTYTIYEVEDGSFGTMDDNGNWNGLIGALVSGSADIALAPLSVMAERENDVDFTVPYYDLVGTTILMKK--ADVEYSLFKFMKVLEWPVWLCIVAAYLFTSILLWIFDRFSPYSFTN---NKERYQNDIEKRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAATWWLFGFIIIASYTANLAAFLTVSRLEQPISSLDDLAKQYKIEYAPIKGSASETYFRRMAEIEETFYNMWKEMSLNESMSPRDRAKLAVWDYPVSDKFTNMWRYMQESKLPVNMDTAVDRVLNSVDGFAFIGDATEIKYAALTNCNLQQVGTEFSRKPYAIAVQSGHILKDKISSAILMLLNERRLETLKEKWWTDNPNKVSCPDSSDESDGISIQNI 790          
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 247.669 bits (631), Expect = 2.151e-70
Identity = 146/422 (34.60%), Postives = 238/422 (56.40%), Query Frame = 1
Query: 1198 LRILVIPEPPFVIKT--PNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIE--DDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW--NSDKSVCP-TVDSSAGLGLDTL 2442
             R++ + +PPFV +T  P+  +EGY ID++  +   +NF YT YE  DG +G++ DNG + G+IG L + + D+A+  +++ +ERE  VDF++PYYD     ILMKK  A  +     F+K   W VW  ++A  + T  L+   DR SP+SF N   N E  + + + + F++KE +WF + + T  G    P++IS R++    WLF ++++A YTANL+A LTV++L     SL +LA Q    Y     ++   YF RM + E   +  W E  +N    P++ A ++ W YP+ +++TNM+  M       N+  ++ +++   D +A   +   IKY    +C L  VG  FS++PY I +Q+   L ++++  IL+L  +R LE LK KWW  N +K  CP + D S G+ +  +
Sbjct:  160 FRVVTLIQPPFVQRTGDPDTPYEGYCIDLINMIQVEVNFTYTIYEVEDGSFGTMDDNGNWNGLIGALVSGSADIALAPLSVMAERENDVDFTVPYYDLVGTTILMKK--ADVEYSLFKFMKVLEWPVWLCIVAAYLFTSILLWIFDRFSPYSFTN---NKERYQNDIEKRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAATWWLFGFIIIASYTANLAAFLTVSRLEQPISSLDDLAKQYKIEYAPIKGSASETYFRRMAEIEETFYNMWKEMSLNESMSPRDRAKLAVWDYPVSDKFTNMWRYMQESKLPVNMDTAVDRVLNSVDGFAFIGDATEIKYAALTNCNLQQVGTEFSRKPYAIAVQSGHILKDKISSAILMLLNERRLETLKEKWWTDNPNKVSCPDSSDESDGISIQNI 576          
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 176.407 bits (446), Expect = 3.684e-45
Identity = 125/408 (30.64%), Postives = 208/408 (50.98%), Query Frame = 1
Query: 1195 QLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTAST-KGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQN--RLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTV 2409
             LR++V  E PFVIKT  N +EG+ ID++ ++ + + FNYT  E  DG YG   ++G + G+IG L     D+++ A+TIT  R  VVDF++P+  +  I IL+ + +  T KG    FL+  +  VW +++ +     + +  + + SP+ + N  R+   +    +     FT+  S WF +G+  Q G    PR+ + R+I V  W+F  ++++ YTA L+A LTV ++++   S Q+LA QQ   Y    + S  D+F                         +E+      K P+ ER  ++    +   F  +  E I ++    +A  +E+ +++YY  RDC+L ++G     + YGI L   SPL + L+  +L LQ   ILE LK KWW  D+   P+ 
Sbjct:  409 HLRVVVYLEEPFVIKTGENQYEGFCIDLLNEMTQVLKFNYTIIEVQDGTYGIEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFM-HLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFF-------------------------RES------KIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWR-DRREGPSC 783          
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 175.637 bits (444), Expect = 9.829e-45
Identity = 125/408 (30.64%), Postives = 208/408 (50.98%), Query Frame = 1
Query: 1195 QLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTAST-KGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQN--RLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTV 2409
             LR++V  E PFVIKT  N +EG+ ID++ ++ + + FNYT  E  DG YG   ++G + G+IG L     D+++ A+TIT  R  VVDF++P+  +  I IL+ + +  T KG    FL+  +  VW +++ +     + +  + + SP+ + N  R+   +    +     FT+  S WF +G+  Q G    PR+ + R+I V  W+F  ++++ YTA L+A LTV ++++   S Q+LA QQ   Y    + S  D+F                         +E+      K P+ ER  ++    +   F  +  E I ++    +A  +E+ +++YY  RDC+L ++G     + YGI L   SPL + L+  +L LQ   ILE LK KWW  D+   P+ 
Sbjct:  409 HLRVVVYLEEPFVIKTGENQYEGFCIDLLNEMTQVLKFNYTIIEVQDGTYGIEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFM-HLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFF-------------------------RES------KIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWR-DRREGPSC 783          
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Match: Ir25a (gene:FBgn0031634 transcript:FBtr0336960)

HSP 1 Score: 222.246 bits (565), Expect = 7.836e-60
Identity = 135/423 (31.91%), Postives = 235/423 (55.56%), Query Frame = 1
Query: 1201 RILVIPEPPFVIK--TPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKI----IEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPT---VDSSAGLGLDTL 2442
            RI  + + PF+++  T    ++GY ID++ ++A  ++F+YT  E  DG++G++ +NG + G++ +L +K  D+ +G++++ +ERE V+DF++PYYD   I I+M++   S+      FL      VW  ++A    T FL+   DR SP+S+QN   N E  + + + + F +KE +WF + + T  G    P+++S R++    WLF ++++A YTANL+A LTV++L +   SL +LA Q   LY   + +S   YF RM   E   +  W +  +N+     E + ++ W YP+ ++YT M+  M        + E++ ++        +A   +   I+Y    +C L  VGE FS++PY I +Q  S L ++ N  IL L   R LE+LK KWW +D+++       D S G+ +  +
Sbjct:  429 RIFTVVQAPFIMRDETAPKGYKGYCIDLINEIAAIVHFDYTIQEVEDGKFGNMDENGQWNGIVKKLMDKQADIGLGSMSVMAEREIVIDFTVPYYDLVGITIMMQR--PSSPSSLFKFLTVLETNVWLCILAAYFFTSFLMWIFDRWSPYSYQN---NREKYKDDEEKREFNLKECLWFCMTSLTPQGGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDDLAKQYKILYAPLNGSSAMTYFERMSNIEQMFYEIWKDLSLNDSLTAVERSKLAVWDYPVSDKYTKMWQAMQEAKLPATLDEAVARVRNSTAATGFAFLGDATDIRYLQLTNCDLQVVGEEFSRKPYAIAVQQGSHLKDQFNNAILTLLNKRQLEKLKEKWWKNDEALAKCDKPEDQSDGISIQNI 846          
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Match: Ir25a (gene:FBgn0031634 transcript:FBtr0289979)

HSP 1 Score: 222.246 bits (565), Expect = 7.836e-60
Identity = 135/423 (31.91%), Postives = 235/423 (55.56%), Query Frame = 1
Query: 1201 RILVIPEPPFVIK--TPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKI----IEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPT---VDSSAGLGLDTL 2442
            RI  + + PF+++  T    ++GY ID++ ++A  ++F+YT  E  DG++G++ +NG + G++ +L +K  D+ +G++++ +ERE V+DF++PYYD   I I+M++   S+      FL      VW  ++A    T FL+   DR SP+S+QN   N E  + + + + F +KE +WF + + T  G    P+++S R++    WLF ++++A YTANL+A LTV++L +   SL +LA Q   LY   + +S   YF RM   E   +  W +  +N+     E + ++ W YP+ ++YT M+  M        + E++ ++        +A   +   I+Y    +C L  VGE FS++PY I +Q  S L ++ N  IL L   R LE+LK KWW +D+++       D S G+ +  +
Sbjct:  429 RIFTVVQAPFIMRDETAPKGYKGYCIDLINEIAAIVHFDYTIQEVEDGKFGNMDENGQWNGIVKKLMDKQADIGLGSMSVMAEREIVIDFTVPYYDLVGITIMMQR--PSSPSSLFKFLTVLETNVWLCILAAYFFTSFLMWIFDRWSPYSYQN---NREKYKDDEEKREFNLKECLWFCMTSLTPQGGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDDLAKQYKILYAPLNGSSAMTYFERMSNIEQMFYEIWKDLSLNDSLTAVERSKLAVWDYPVSDKYTKMWQAMQEAKLPATLDEAVARVRNSTAATGFAFLGDATDIRYLQLTNCDLQVVGEEFSRKPYAIAVQQGSHLKDQFNNAILTLLNKRQLEKLKEKWWKNDEALAKCDKPEDQSDGISIQNI 846          
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Match: Ir25a (gene:FBgn0031634 transcript:FBtr0336959)

HSP 1 Score: 221.861 bits (564), Expect = 9.046e-60
Identity = 135/423 (31.91%), Postives = 235/423 (55.56%), Query Frame = 1
Query: 1201 RILVIPEPPFVIK--TPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKI----IEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPT---VDSSAGLGLDTL 2442
            RI  + + PF+++  T    ++GY ID++ ++A  ++F+YT  E  DG++G++ +NG + G++ +L +K  D+ +G++++ +ERE V+DF++PYYD   I I+M++   S+      FL      VW  ++A    T FL+   DR SP+S+QN   N E  + + + + F +KE +WF + + T  G    P+++S R++    WLF ++++A YTANL+A LTV++L +   SL +LA Q   LY   + +S   YF RM   E   +  W +  +N+     E + ++ W YP+ ++YT M+  M        + E++ ++        +A   +   I+Y    +C L  VGE FS++PY I +Q  S L ++ N  IL L   R LE+LK KWW +D+++       D S G+ +  +
Sbjct:  424 RIFTVVQAPFIMRDETAPKGYKGYCIDLINEIAAIVHFDYTIQEVEDGKFGNMDENGQWNGIVKKLMDKQADIGLGSMSVMAEREIVIDFTVPYYDLVGITIMMQR--PSSPSSLFKFLTVLETNVWLCILAAYFFTSFLMWIFDRWSPYSYQN---NREKYKDDEEKREFNLKECLWFCMTSLTPQGGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDDLAKQYKILYAPLNGSSAMTYFERMSNIEQMFYEIWKDLSLNDSLTAVERSKLAVWDYPVSDKYTKMWQAMQEAKLPATLDEAVARVRNSTAATGFAFLGDATDIRYLQLTNCDLQVVGEEFSRKPYAIAVQQGSHLKDQFNNAILTLLNKRQLEKLKEKWWKNDEALAKCDKPEDQSDGISIQNI 841          
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Match: Ir25a (gene:FBgn0031634 transcript:FBtr0332480)

HSP 1 Score: 222.246 bits (565), Expect = 9.379e-60
Identity = 135/423 (31.91%), Postives = 235/423 (55.56%), Query Frame = 1
Query: 1201 RILVIPEPPFVIK--TPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKI----IEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPT---VDSSAGLGLDTL 2442
            RI  + + PF+++  T    ++GY ID++ ++A  ++F+YT  E  DG++G++ +NG + G++ +L +K  D+ +G++++ +ERE V+DF++PYYD   I I+M++   S+      FL      VW  ++A    T FL+   DR SP+S+QN   N E  + + + + F +KE +WF + + T  G    P+++S R++    WLF ++++A YTANL+A LTV++L +   SL +LA Q   LY   + +S   YF RM   E   +  W +  +N+     E + ++ W YP+ ++YT M+  M        + E++ ++        +A   +   I+Y    +C L  VGE FS++PY I +Q  S L ++ N  IL L   R LE+LK KWW +D+++       D S G+ +  +
Sbjct:  442 RIFTVVQAPFIMRDETAPKGYKGYCIDLINEIAAIVHFDYTIQEVEDGKFGNMDENGQWNGIVKKLMDKQADIGLGSMSVMAEREIVIDFTVPYYDLVGITIMMQR--PSSPSSLFKFLTVLETNVWLCILAAYFFTSFLMWIFDRWSPYSYQN---NREKYKDDEEKREFNLKECLWFCMTSLTPQGGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDDLAKQYKILYAPLNGSSAMTYFERMSNIEQMFYEIWKDLSLNDSLTAVERSKLAVWDYPVSDKYTKMWQAMQEAKLPATLDEAVARVRNSTAATGFAFLGDATDIRYLQLTNCDLQVVGEEFSRKPYAIAVQQGSHLKDQFNNAILTLLNKRQLEKLKEKWWKNDEALAKCDKPEDQSDGISIQNI 859          
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Match: Ir8a (gene:FBgn0052704 transcript:FBtr0071333)

HSP 1 Score: 206.838 bits (525), Expect = 1.027e-54
Identity = 136/399 (34.09%), Postives = 217/399 (54.39%), Query Frame = 1
Query: 1258 EGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIED---DWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWN-SDKSVCPTVDSSAGLGLDTL 2442
            EGY ID + +L++ +NF +       G  G + + G + G++G+L     D A+ A+ + SERE V+DF  PYY+   I I ++K    T   +  F+     EVW +++A ++GT  +I F+D+ SP+S +N  +       E     FT++ES WF L ++T  G    P++IS R++V   WLF  LM+A +TANL+A LTV ++ +   SL++LA Q    YT   ++  H YF  M  AE  ++  W E  +N     K+      W YPI+E+Y ++   +N+     +  E    +      D+A   ++  IKY   R+C L  VGE F+++PY + +Q  S L +EL+  IL LQ+DR  E+LK K+WN S+   CP  +   G+ L++L
Sbjct:  419 EGYCIDFIIRLSQKLNFEFEIVAPEVGHMGELNELGEWDGVVGDLVRGETDFAIAALKMYSEREEVIDFLPPYYEQTGISIAIRKPVRRTSLFK--FMTVLRLEVWLSIVAALVGTAIMIWFMDKYSPYSSRNNRQAYPYACRE-----FTLRESFWFALTSFTPQGGGEAPKAISGRMLVAAYWLFVVLMLATFTANLAAFLTVERMQTPVQSLEQLARQSRINYTVVKDSDTHQYFVNMKFAEDTLYRMWKELALN---ASKDFKKFRIWDYPIKEQYGHILLAINSSQPVADAKEGFANVDAHENADYAFIHDSAEIKYEITRNCNLTEVGEVFAEQPYAVAVQQGSHLGDELSYAILELQKDRFFEELKAKYWNQSNLPNCPLSEDQEGITLESL 807          
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Match: grid1b (glutamate receptor, ionotropic, delta 1b [Source:ZFIN;Acc:ZDB-GENE-121214-84])

HSP 1 Score: 171.014 bits (432), Expect = 5.951e-43
Identity = 183/667 (27.44%), Postives = 308/667 (46.18%), Query Frame = 1
Query:  517 SGTFIPVFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSK---DLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTI--NSSVS---STYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSS-----------DFSCWNSSTSTNMVRYNM--------LMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKIL-----WTRTNGLGNYNFSL------NVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFT-PNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW 2379
            SG F  +F        TEE+ ++   LR + ++L+       + I+QA+ +N  +   HW  V++   D EI            L H  +  + +  +I  +  +SSVS   +++R   ++   Q G +  + +S     NL+   S            +   W+S  S N +R +         ++E ++   I G+ G + F   ++N  +  +  E+   S   T  K +     W   +GL   N SL      N +    ++++ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  D +YGS   NG++ GMIGEL NK  D+AV AITIT ERE VVDFS  Y DY ++ IL +K     K +       F   VWA + A I   G LI  + R+     QN    +      A     ++  ++W V GA+ Q G      S++ R+++   WLF  ++ + YTANL+A LTV+++ +   + Q+LA Q    Y T  +++++DYF                KG N L+  +++     W+           ++ N   F+  + SE I+K  +  +A   +  +++Y   T+ DC +   G   S + YGI +Q+ SP  + ++ +IL LQ    L+ LK KWW
Sbjct:  202 SGVFSSLFTS----MRTEELNRYRDTLRRAILLLSPRG--AQVFIHQAVETNLASKDSHWVFVNEEISDTEILE----------LAHSSLGRMTVVRQIFPLWRDSSVSCMRNSHRISSLLCDPQEGYLQSLEVS-----NLYLYDSVLMLANAFYRKLEDRKWHSMASLNCIRKSTKPWNGGWSMLETIQKGRITGLTGIMDF---MENGSNSHVQFEILGTSFSETFGKDIKRLATWDSVHGL---NGSLKESRIENGMQGVTVKVVTLLEDPFVMVAENILGQPKRYKGFSIDVLEALAKILGFKYDIYQVADSKYGSQLSNGSWNGMIGELINKRADLAVSAITITPERENVVDFSKRYMDY-SVGILHRK--PEEKINIFSLFAPFDLAVWACIAAAIPVVGVLIFLLTRMQMLRSQNPPGAH-----HASSMSNSLHSAIWIVYGAFVQQGGDSVVGSVALRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNTIRTFQDLARQMDFAYGTVRDSAVYDYF--------------KAKGTNPLE--QDSTYAELWR---------TISKNNGQDFSVSSPSEGIRKAKKGPYAFLWDMAVVEYAALTDDDCTITVSGNSMSSKGYGIAMQHGSPYRDLISQKILELQEKGDLDVLKQKWW 808          
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Match: grid1a (glutamate receptor, ionotropic, delta 1a [Source:ZFIN;Acc:ZDB-GENE-120411-28])

HSP 1 Score: 165.622 bits (418), Expect = 2.924e-41
Identity = 180/669 (26.91%), Postives = 298/669 (44.54%), Query Frame = 1
Query:  535 VFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSK---DLEIFTCNKCKSGSFFLFHKKIDDIPLF-----------DKIKTINSSVSSTY-RAIEM--VYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITF-----NLTIQNQFSKIMVSEVTVGSSPVTVDKIL-WTRTNGLGN---YNFSLNVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYT-QAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW------NSDKSVCPTVDSSA 2421
            VF    +    EE+ ++   LR + ++L+       + I+QA+ +N  +   HW   ++   D EI        G   +  +     PL+            +I ++       Y +++E+  +Y Y +  +L  A  +      W  S +  +C   ST      ++ML  + K   I G+ G + F     N  +Q +      SE T G     V ++  W    GL      N + + +    L+++ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  D +YGS   NG++ GMIGEL  K  D+A+ AITIT ERE VVDFS  Y DY ++ ILM K     + +    L  F   VWA + A I   G ++  + RV     QN    +     +      + + ++W V GA+  Q GESF   S++ R+ +   WLF  ++ + YTANL+A LTV+++ +             T       + I+    R    E+ +F ++  KG N L+  +++     W      R  N     +    +P  +E I+K+  D +A   +  +++Y   T+ DC LV  G   S + YG+ LQ+ SP  +  + +IL LQ    L+ LK KWW      + DK   P  +  A
Sbjct:  204 VFSTLFSTMRMEELNRYRDTLRRAILLLSPR--TAQVFIHQAVETNLASKDSHWVYANEEVSDTEIMELVHSALGRMTVIRQIF---PLWRDTNIRCMRNNHRISSLLCDPQEGYLQSLEVSSLYLYDSVLMLANAFYRKLEDRKWH-SMASLNCMRKSTKPWNGGWSMLDTIQKG-RISGLTGLMDFRSNGANSHVQFEILGTSYSE-TFGKD---VKRLATWDSDRGLNGSLRENRADHGMQGITLKVVTLLEEPFVMVAENILGQPKRYKGFSIDVLDALAKILGFKYEMYQVADAKYGSPQTNGSWNGMIGELIGKRADVAISAITITPERENVVDFSKRYLDY-SVGILMTKT--EERLNIFSLLAPFDLAVWACIAAAIPVVGVMVFLLRRVQSVRSQNPPGPH-----QPASVTTSFQSAIWIVYGAFVQQGGESF-MSSMALRIAMGSWWLFTLIVCSSYTANLAAYLTVSRMDN----------AIRTFQDLSKQSEINYGTVR----ESAVFEYFRVKGTNPLE--QDSTFAELW------RTINKNQGQDNSVTSP--AEGIRKVKRDPYAFLWDMAVLEYAALTDDDCTLVVTGNGMSSKGYGLALQHGSPYRDLFSQKILDLQEKGDLDILKQKWWPRKGRCDLDKHAEPQTEGRA 828          
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Match: grid1a (glutamate receptor, ionotropic, delta 1a [Source:ZFIN;Acc:ZDB-GENE-120411-28])

HSP 1 Score: 164.851 bits (416), Expect = 3.973e-41
Identity = 180/669 (26.91%), Postives = 298/669 (44.54%), Query Frame = 1
Query:  535 VFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSK---DLEIFTCNKCKSGSFFLFHKKIDDIPLF-----------DKIKTINSSVSSTY-RAIEM--VYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITF-----NLTIQNQFSKIMVSEVTVGSSPVTVDKIL-WTRTNGLGN---YNFSLNVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYT-QAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW------NSDKSVCPTVDSSA 2421
            VF    +    EE+ ++   LR + ++L+       + I+QA+ +N  +   HW   ++   D EI        G   +  +     PL+            +I ++       Y +++E+  +Y Y +  +L  A  +      W  S +  +C   ST      ++ML  + K   I G+ G + F     N  +Q +      SE T G     V ++  W    GL      N + + +    L+++ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  D +YGS   NG++ GMIGEL  K  D+A+ AITIT ERE VVDFS  Y DY ++ ILM K     + +    L  F   VWA + A I   G ++  + RV     QN    +     +      + + ++W V GA+  Q GESF   S++ R+ +   WLF  ++ + YTANL+A LTV+++ +             T       + I+    R    E+ +F ++  KG N L+  +++     W      R  N     +    +P  +E I+K+  D +A   +  +++Y   T+ DC LV  G   S + YG+ LQ+ SP  +  + +IL LQ    L+ LK KWW      + DK   P  +  A
Sbjct:  145 VFSTLFSTMRMEELNRYRDTLRRAILLLSPR--TAQVFIHQAVETNLASKDSHWVYANEEVSDTEIMELVHSALGRMTVIRQIF---PLWRDTNIRCMRNNHRISSLLCDPQEGYLQSLEVSSLYLYDSVLMLANAFYRKLEDRKWH-SMASLNCMRKSTKPWNGGWSMLDTIQKG-RISGLTGLMDFRSNGANSHVQFEILGTSYSE-TFGKD---VKRLATWDSDRGLNGSLRENRADHGMQGITLKVVTLLEEPFVMVAENILGQPKRYKGFSIDVLDALAKILGFKYEMYQVADAKYGSPQTNGSWNGMIGELIGKRADVAISAITITPERENVVDFSKRYLDY-SVGILMTKT--EERLNIFSLLAPFDLAVWACIAAAIPVVGVMVFLLRRVQSVRSQNPPGPH-----QPASVTTSFQSAIWIVYGAFVQQGGESF-MSSMALRIAMGSWWLFTLIVCSSYTANLAAYLTVSRMDN----------AIRTFQDLSKQSEINYGTVR----ESAVFEYFRVKGTNPLE--QDSTFAELW------RTINKNQGQDNSVTSP--AEGIRKVKRDPYAFLWDMAVLEYAALTDDDCTLVVTGNGMSSKGYGLALQHGSPYRDLFSQKILDLQEKGDLDILKQKWWPRKGRCDLDKHAEPQTEGRA 769          
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Match: grik5 (glutamate receptor, ionotropic, kainate 5 [Source:ZFIN;Acc:ZDB-GENE-070821-6])

HSP 1 Score: 162.925 bits (411), Expect = 4.023e-41
Identity = 155/565 (27.43%), Postives = 253/565 (44.78%), Query Frame = 1
Query:  790 LFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNV-----LTQKQLRILVIPEPPFVIKT-------PNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVD--SSAGLGLDTL 2442
            LFD +  + S+V    R+          Q +GV     K L+  +P       W   TS        LM  ++ +   G+ G++ FN   Q     + + E   G      +  +W   N L   + SL++     L  K L I  I E P+V++         N  +EG+ +D++ +L++ + F Y      DG YG+   NG++TGM+GEL N+  D+AV A TITSERE+V+DFS P+     I IL  +V    K     FL  F+  VW  ++   +    ++    R+SP+ + N       R    + + +T+  S+WF +G + Q G    PR++S R +    W F  ++++ YTANL+A LTV ++     S  +LA Q    Y T    S   +F                         +       W Y        MY++  +  F  +  E I +++   +A  LE+ + +Y+ + +C L  +G     + YGI +   SP  +EL+L +L LQ +  LE LK +WW   K  CP  +   + GLG++ +
Sbjct:   39 LFDAVHVVVSAVQELNRS----------QEIGV-----KPLSCTSPQ-----IWQHGTS--------LMNYLRMVEYDGLTGRVEFNSKGQRTNYTLHILEKHRGGHK---EIGIWYSNNTLLMNSTSLDINVSETLANKSLIITTILENPYVMRKINYQEFEGNEQYEGFCVDMLRELSDILKFTYRIKLVDDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTL-GISILY-RVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLSARLSPYEWYNPHPCLRERRDLLENQ-YTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESPDDLADQTNIQYGTIHGGSTMTFFM----------------------NSRYQTYQRMWNY--------MYSKQPSV-FVKSTEEGIARVVNSKYAFLLESTMNEYHRSLNCNLTQIGGLLDTKGYGIGMPLGSPFRDELSLAVLQLQENNRLEILKRRWWEGGK--CPKEEDHRAKGLGMENI 536          
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Match: grik1a (glutamate receptor, ionotropic, kainate 1a [Source:ZFIN;Acc:ZDB-GENE-030131-6502])

HSP 1 Score: 163.696 bits (413), Expect = 7.237e-41
Identity = 138/501 (27.54%), Postives = 232/501 (46.31%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLG------NYNFSLNVLTQKQLRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L K     G+ G+I  N T  ++ +F+  ++S    G++ + V    W    GL       N N + + L  + L +  I E P+V+          N+ FEGY +D++ +L+  + F Y      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   T ++W  V+   +G   ++  + R +P+ + N    N   E   +   FT+  S+WF + A  + G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R N      N  + I +++  D+AL +E+  I+Y T R+C L  VG     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG++ +
Sbjct:  342 FMNLFKEAQWDGLTGRIVLNKTDGLRKEFNLDLISLKEDGTAKIGV----WNSYTGLNLTEIKDNKNIT-DSLANRTLIVTTILENPYVMYKKSDKVLYGNDRFEGYCLDLLKELSNILGFTYEVKLVTDGKYGAQNDKGEWNGMVRELIDHIADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLTPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPSSEVVENN--FTLLNSLWFGVAALMRQGSELMPKALSTRILGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDS----------ADDLAKQTRIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRKNT-ALVKNSKDGITRVLTTDYALLMESTSIEYITQRNCNLTQVGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSKEASALGVENI 800          
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 170.244 bits (430), Expect = 9.348e-43
Identity = 143/515 (27.77%), Postives = 239/515 (46.41%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVS------EVTVGSSPVTVDKILWTRTNGLGNYNFSLNV--------------LTQKQLRILVIPEPPFVI----KTP---NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L+K     G+ G+ITFN T  ++  F   ++S      E   G +   ++K+ W +  G+ N N  LN+              L  + L +  I E P+V+      P   N+ FEGY +D++ +L+  + F Y     VDG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R        N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG++ +
Sbjct:  318 FMSLIKEARWDGLTGRITFNRTDGLRRDFDMDIISLKEDGMEKAAGETVNHLNKV-WKKV-GVWNSNTGLNMTDNLKDKSTNITDSLANRTLIVTTILEDPYVMFRKSDKPLYGNDRFEGYCLDLLKELSNILGFTYEVRLVVDGKYGAQNDKGEWNGMVRELIDHKADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQT-ALVKNNDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSKEASALGVENI 793          
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 170.244 bits (430), Expect = 9.637e-43
Identity = 143/515 (27.77%), Postives = 239/515 (46.41%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVS------EVTVGSSPVTVDKILWTRTNGLGNYNFSLNV--------------LTQKQLRILVIPEPPFVI----KTP---NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L+K     G+ G+ITFN T  ++  F   ++S      E   G +   ++K+ W +  G+ N N  LN+              L  + L +  I E P+V+      P   N+ FEGY +D++ +L+  + F Y     VDG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R        N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG++ +
Sbjct:  325 FMSLIKEARWDGLTGRITFNRTDGLRRDFDMDIISLKEDGMEKAAGETVNHLNKV-WKKV-GVWNSNTGLNMTDNLKDKSTNITDSLANRTLIVTTILEDPYVMFRKSDKPLYGNDRFEGYCLDLLKELSNILGFTYEVRLVVDGKYGAQNDKGEWNGMVRELIDHKADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQT-ALVKNNDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSKEASALGVENI 800          
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 169.859 bits (429), Expect = 1.156e-42
Identity = 142/515 (27.57%), Postives = 238/515 (46.21%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVS------EVTVGSSPVTVDKILWTRTNGLGNYNFSLNV--------------LTQKQLRILVIPEPPFVI----KTP---NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L+K     G+ G+ITFN T  ++  F   ++S      E   G +   ++K+ W +  G+ N N  LN+              L  + L +  I E P+V+      P   N+ FEGY +D++ +L+  + F Y     VDG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +    + T             N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG++ +
Sbjct:  318 FMSLIKEARWDGLTGRITFNRTDGLRRDFDMDIISLKEDGMEKAAGETVNHLNKV-WKKV-GVWNSNTGLNMTDNLKDKSTNITDSLANRTLIVTTILEDPYVMFRKSDKPLYGNDRFEGYCLDLLKELSNILGFTYEVRLVVDGKYGAQNDKGEWNGMVRELIDHKADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAFMSSRQQT---------ALVKNNDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSKEASALGVENI 793          
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 169.859 bits (429), Expect = 1.176e-42
Identity = 142/502 (28.29%), Postives = 233/502 (46.41%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGN----YNFSLNV---LTQKQLRILVIPEPPFVI----KTP---NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L+K     G+ G+ITFN T  ++  F   ++S    G   V V    W    GL       + S N+   L  + L +  I E P+V+      P   N+ FEGY +D++ +L+  + F Y     VDG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R        N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG++ +
Sbjct:  350 FMSLIKEARWDGLTGRITFNRTDGLRRDFDMDIISLKEDGMEKVGV----WNSNTGLNMTDNLKDKSTNITDSLANRTLIVTTILEDPYVMFRKSDKPLYGNDRFEGYCLDLLKELSNILGFTYEVRLVVDGKYGAQNDKGEWNGMVRELIDHKADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQT-ALVKNNDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSKEASALGVENI 810          
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 169.474 bits (428), Expect = 1.351e-42
Identity = 142/502 (28.29%), Postives = 233/502 (46.41%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGN----YNFSLNV---LTQKQLRILVIPEPPFVI----KTP---NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L+K     G+ G+ITFN T  ++  F   ++S    G   V V    W    GL       + S N+   L  + L +  I E P+V+      P   N+ FEGY +D++ +L+  + F Y     VDG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R        N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG++ +
Sbjct:  289 FMSLIKEARWDGLTGRITFNRTDGLRRDFDMDIISLKEDGMEKVGV----WNSNTGLNMTDNLKDKSTNITDSLANRTLIVTTILEDPYVMFRKSDKPLYGNDRFEGYCLDLLKELSNILGFTYEVRLVVDGKYGAQNDKGEWNGMVRELIDHKADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQT-ALVKNNDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSKEASALGVENI 749          
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 172.555 bits (436), Expect = 1.617e-43
Identity = 163/670 (24.33%), Postives = 293/670 (43.73%), Query Frame = 1
Query:  562 NTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWF-----VVSKDLEIFTCNKCKSGSFFLFH---------------KKIDDIP-----LFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGL----GNYNFSLNV---LTQKQLRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
            + + +++ +K+ +   +I     +  + ++ Q +    +   YH+F     + + DLE++  +      F L +               +++   P     L D + T  +++   Y A+ MV          +A  +A  L + +        W              M L+K     G+ G+ITFN T  ++  F   ++S    G+  + +    W   +GL    GN + S N+   L  + L +  I E P+V+          N+ FEGY +D++ +L+  + F Y      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R  +     N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG++ +
Sbjct:  211 DAKPLLKEMKKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGVMTTEAAL--MYDAVYMV---------AIASHRASQLTVSSLQCHRHKPWRLGPR--------FMNLIKEARWDGLTGRITFNKTDGLRKDFDLDIISLKEEGTEKIGI----WNSNSGLNMTDGNRDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQS-ALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSKEASALGVENI 820          
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Match: Grid1 (glutamate receptor, ionotropic, delta 1 [Source:MGI Symbol;Acc:MGI:95812])

HSP 1 Score: 172.555 bits (436), Expect = 1.714e-43
Identity = 174/652 (26.69%), Postives = 292/652 (44.79%), Query Frame = 1
Query:  535 VFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSK---DLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSS-----------DFSCWNSSTSTNMVRYNM--------LMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKIL--WTRTNGLGNYNFSL------NVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW 2379
            VF        TEE+ ++   LR + ++L+ +       IN+A+ +N  +   HW  V++   D EI        G   +  +      +F   K     + + +R   ++   Q G +  + IS     NL+   S            +   W+S  S N +R +         +++ +K   I G+ G + F     N + +  +   T   +     + L  W    GL   N SL      + L    L+++ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  DG+YG    N ++ GMIGEL +K  D+A+ AITIT ERE VVDFS  Y DY ++ IL+KK     K         F + VWA + A I   G LI  ++R+     Q+  +              T+  ++W V GA+ Q G      S++ R+++   WLF  ++ + YTANL+A LTV+++ +   + Q+L+ Q    Y T  ++++++YF                KG N L+  +++     W+         +     A     N SE I+K  + ++A   +  +++Y   T+ DC +  +G   S + YGI LQ+ SP  +  + RIL LQ    L+ LK KWW
Sbjct:  204 VFTSLFTTMKTEELNRYRDTLRRAILLLSPQG--AHSFINEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQ------IFPSAKDNQKCMRNNHRISSLLCDPQEGYLQMLQIS-----NLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGL---NGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDY-SVGILIKK--PEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRSQSATQPRPSASA-------TLHSAIWIVYGAFVQQGGESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQLEMSYGTVRDSAVYEYF--------------RAKGTNPLE--QDSTFAELWR--------TISKNGGADNCVSNPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWW 805          
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 171.785 bits (434), Expect = 1.886e-43
Identity = 140/502 (27.89%), Postives = 236/502 (47.01%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGL----GNYNFSLNV---LTQKQLRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L+K     G+ G+ITFN T  ++  F   ++S    G+  + +    W   +GL    GN + S N+   L  + L +  I E P+V+          N+ FEGY +D++ +L+  + F Y      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R  +     N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG++ +
Sbjct:  289 FMNLIKEARWDGLTGRITFNKTDGLRKDFDLDIISLKEEGTEKIGI----WNSNSGLNMTDGNRDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQS-ALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSKEASALGVENI 749          
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 172.17 bits (435), Expect = 1.948e-43
Identity = 163/670 (24.33%), Postives = 293/670 (43.73%), Query Frame = 1
Query:  562 NTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWF-----VVSKDLEIFTCNKCKSGSFFLFH---------------KKIDDIP-----LFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGL----GNYNFSLNV---LTQKQLRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
            + + +++ +K+ +   +I     +  + ++ Q +    +   YH+F     + + DLE++  +      F L +               +++   P     L D + T  +++   Y A+ MV          +A  +A  L + +        W              M L+K     G+ G+ITFN T  ++  F   ++S    G+  + +    W   +GL    GN + S N+   L  + L +  I E P+V+          N+ FEGY +D++ +L+  + F Y      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R  +     N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG++ +
Sbjct:  211 DAKPLLKEMKKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGVMTTEAAL--MYDAVYMV---------AIASHRASQLTVSSLQCHRHKPWRLGPR--------FMNLIKEARWDGLTGRITFNKTDGLRKDFDLDIISLKEEGTEKIGI----WNSNSGLNMTDGNRDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQS-ALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSKEASALGVENI 820          
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 172.17 bits (435), Expect = 2.349e-43
Identity = 140/502 (27.89%), Postives = 236/502 (47.01%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGL----GNYNFSLNV---LTQKQLRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L+K     G+ G+ITFN T  ++  F   ++S    G+  + +    W   +GL    GN + S N+   L  + L +  I E P+V+          N+ FEGY +D++ +L+  + F Y      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R  +     N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG++ +
Sbjct:  360 FMNLIKEARWDGLTGRITFNKTDGLRKDFDLDIISLKEEGTEKIGI----WNSNSGLNMTDGNRDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQS-ALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSKEASALGVENI 820          
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Match: sp|E9NA96|IR25A_DROME (Ionotropic receptor 25a OS=Drosophila melanogaster OX=7227 GN=Ir25a PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 9.401e-59
Identity = 135/423 (31.91%), Postives = 235/423 (55.56%), Query Frame = 1
Query: 1201 RILVIPEPPFVIK--TPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKI----IEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPT---VDSSAGLGLDTL 2442
            RI  + + PF+++  T    ++GY ID++ ++A  ++F+YT  E  DG++G++ +NG + G++ +L +K  D+ +G++++ +ERE V+DF++PYYD   I I+M++   S+      FL      VW  ++A    T FL+   DR SP+S+QN   N E  + + + + F +KE +WF + + T  G    P+++S R++    WLF ++++A YTANL+A LTV++L +   SL +LA Q   LY   + +S   YF RM   E   +  W +  +N+     E + ++ W YP+ ++YT M+  M        + E++ ++        +A   +   I+Y    +C L  VGE FS++PY I +Q  S L ++ N  IL L   R LE+LK KWW +D+++       D S G+ +  +
Sbjct:  442 RIFTVVQAPFIMRDETAPKGYKGYCIDLINEIAAIVHFDYTIQEVEDGKFGNMDENGQWNGIVKKLMDKQADIGLGSMSVMAEREIVIDFTVPYYDLVGITIMMQR--PSSPSSLFKFLTVLETNVWLCILAAYFFTSFLMWIFDRWSPYSYQN---NREKYKDDEEKREFNLKECLWFCMTSLTPQGGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDDLAKQYKILYAPLNGSSAMTYFERMSNIEQMFYEIWKDLSLNDSLTAVERSKLAVWDYPVSDKYTKMWQAMQEAKLPATLDEAVARVRNSTAATGFAFLGDATDIRYLQLTNCDLQVVGEEFSRKPYAIAVQQGSHLKDQFNNAILTLLNKRQLEKLKEKWWKNDEALAKCDKPEDQSDGISIQNI 859          
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Match: sp|Q62640|GRID1_RAT (Glutamate receptor ionotropic, delta-1 OS=Rattus norvegicus OX=10116 GN=Grid1 PE=1 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.058e-43
Identity = 179/666 (26.88%), Postives = 296/666 (44.44%), Query Frame = 1
Query:  535 VFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSK---DLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSS-----------DFSCWNSSTSTNMVRYNM--------LMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKIL--WTRTNGLGNYNFSL------NVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDSSA 2421
            VF        TEE+ ++   LR + ++L+ +       IN+A+ +N  +   HW  V++   D EI        G   +  +      +F   K     + + +R   ++   Q G +  + IS     NL+   S            +   W+S  S N +R +         +++ +K   I G+ G + F     N + +  +   T   +     + L  W    GL   N SL      + L    L+++ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  DG+YG    N ++ GMIGEL +K  D+A+ AITIT ERE VVDFS  Y DY ++ IL+KK     K         F + VWA + A I   G LI  ++R+     Q+  +              T+  ++W V GA+ Q G      S++ R+++   WLF  ++ + YTANL+A LTV+++ S   + Q+L+ Q    Y T  ++++++YF                KG N L+  +++     W+         +     A     N SE I+K  + ++A   +  +++Y   T+ DC +  +G   S + YGI LQ+ SP  +  + RIL LQ    L+ LK KWW        T  SSA
Sbjct:  204 VFTSLFTTMKTEELNRYRDTLRRAILLLSPQG--AHSFINEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQ------IFPSAKDNQKCMRNNHRISSLLCDPQEGYLQMLQIS-----NLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGL---NGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDY-SVGILIKK--PEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRSQSATQPRPSASA-------TLHSAIWIVYGAFVQQGGESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDSPVRTFQDLSKQLEMSYGTVRDSAVYEYF--------------RAKGTNPLE--QDSTFAELWR--------TISKNGGADNCVSNPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWWPHTGRCDLTSHSSA 819          
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Match: sp|Q61627|GRID1_MOUSE (Glutamate receptor ionotropic, delta-1 OS=Mus musculus OX=10090 GN=Grid1 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 1.199e-42
Identity = 174/652 (26.69%), Postives = 292/652 (44.79%), Query Frame = 1
Query:  535 VFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSK---DLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSS-----------DFSCWNSSTSTNMVRYNM--------LMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKIL--WTRTNGLGNYNFSL------NVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW 2379
            VF        TEE+ ++   LR + ++L+ +       IN+A+ +N  +   HW  V++   D EI        G   +  +      +F   K     + + +R   ++   Q G +  + IS     NL+   S            +   W+S  S N +R +         +++ +K   I G+ G + F     N + +  +   T   +     + L  W    GL   N SL      + L    L+++ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  DG+YG    N ++ GMIGEL +K  D+A+ AITIT ERE VVDFS  Y DY ++ IL+KK     K         F + VWA + A I   G LI  ++R+     Q+  +              T+  ++W V GA+ Q G      S++ R+++   WLF  ++ + YTANL+A LTV+++ +   + Q+L+ Q    Y T  ++++++YF                KG N L+  +++     W+         +     A     N SE I+K  + ++A   +  +++Y   T+ DC +  +G   S + YGI LQ+ SP  +  + RIL LQ    L+ LK KWW
Sbjct:  204 VFTSLFTTMKTEELNRYRDTLRRAILLLSPQG--AHSFINEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQ------IFPSAKDNQKCMRNNHRISSLLCDPQEGYLQMLQIS-----NLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGL---NGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDY-SVGILIKK--PEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRSQSATQPRPSASA-------TLHSAIWIVYGAFVQQGGESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQLEMSYGTVRDSAVYEYF--------------RAKGTNPLE--QDSTFAELWR--------TISKNGGADNCVSNPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWW 805          
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Match: sp|Q9ULK0|GRID1_HUMAN (Glutamate receptor ionotropic, delta-1 OS=Homo sapiens OX=9606 GN=GRID1 PE=2 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 5.952e-42
Identity = 174/643 (27.06%), Postives = 286/643 (44.48%), Query Frame = 1
Query:  535 VFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSK---DLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSS----------TYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKIL--WTRTNGLGNYNFSL------NVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW 2379
            VF        TEE+ ++   LR + ++L+ +       IN+A+ +N  +   HW  V++   D EI        G   +  +         K    N  +SS              I  +Y Y +  +L  A  +      W  S +  +C   ST       +ML + +K   I G+ G + F     N + +  +   T   +     + L  W    GL   N SL      + L    L+++ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  DG+YG    N ++ GMIGEL +K  D+A+ AITIT ERE VVDFS  Y DY ++ IL+KK     K         F + VWA + A I   G LI  ++R+     Q+  +              T+  ++W V GA+ Q G      S++ R+++   WLF  ++ + YTANL+A LTV+++ +   + Q+L+ Q    Y T  ++++++YF                KG N L+  +++     W+         +     A     + SE I+K  + ++A   +  +++Y   T+ DC +  +G   S + YGI LQ+ SP  +  + RIL LQ    L+ LK KWW
Sbjct:  204 VFTSLFTTMKTEELNRYRDTLRRAILLLSPQG--AHSFINEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCTRNNHRISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWH-SMASLNCIRKSTKPWNGGRSML-DTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGL---NGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDY-SVGILIKK--PEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASA-------TLHSAIWIVYGAFVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMSYGTVRDSAVYEYF--------------RAKGTNPLE--QDSTFAELWR--------TISKNGGADNCVSSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWW 805          
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Match: sp|P22756|GRIK1_RAT (Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3)

HSP 1 Score: 166.392 bits (420), Expect = 1.118e-40
Identity = 150/561 (26.74%), Postives = 251/561 (44.74%), Query Frame = 1
Query:  847 EMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVT--VDKIL---------WTRTNGL----GNYNFSLNV---LTQKQLRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
            E    Y    ++ +A  +A  L +     S   C          R+   M L+K     G+ G+ITFN T  ++  F   ++S    G+   +  V K L         W   +GL    GN + S N+   L  + L +  I E P+V+          N+ FE Y +D++ +L+  + F Y      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   + ++W  V+   +G   ++  + R +P+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R  +     N  E I++++  D+AL +E+  I+Y T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG++ +
Sbjct:  320 EAALMYDAVYMVAIASHRASQLTV-----SSLQCHRHKPCALGPRF---MNLIKEARWDGLTGRITFNKTDGLRKDFDLDIISLKEEGTEKASGEVSKHLYKVWKKIGIWNSNSGLNMTDGNRDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEAYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNP--DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDS----------ADDLAKQTKIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQQS-ALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSKEASALGVENI 835          
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Match: A0A1S6KMH1 (Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1784.62 bits (4621), Expect = 0.000e+0
Identity = 930/930 (100.00%), Postives = 930/930 (100.00%), Query Frame = 1
Query:   28 MNVVTIHLFLLILINQTLIARSYTIVLMGEITNPFLFDSAIMGFNDNTNQPNSYIRIYNDQDDFLDQICNLNASSLDAIIDLSLNVIGSDDIGSHMDAPVVSMKEWNQYSSSEITNIPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPVFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNVLTQKQLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDSSAGLGLDTLXXXXXXXXXXXXXXXXXXXXEKIVAKIWGTEWAAAAGNDPTVVRPMGMMSTLNVNLGSHVSIRRASQLSGQQTLARRNYPTRSSNANIDENTNRNEKPMAIAKGGVMNSGYDNYDNPPTYSNTHM 2817
            MNVVTIHLFLLILINQTLIARSYTIVLMGEITNPFLFDSAIMGFNDNTNQPNSYIRIYNDQDDFLDQICNLNASSLDAIIDLSLNVIGSDDIGSHMDAPVVSMKEWNQYSSSEITNIPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPVFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNVLTQKQLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSLQELAAQQTTLYTTQSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPLLNELNLRILILQRDRILEQLKVKWWNSDKSVCPTVDSSAGLGLDTLGGAFAFLAVGIGIAGIIFIGEKIVAKIWGTEWAAAAGNDPTVVRPMGMMSTLNVNLGSHVSIRRASQLSGQQTLARRNYPTRSSNANIDENTNRNEKPMAIAKGGVMNSGYDNYDNPPTYSNTHM
Sbjct:    1 MNVVTIHLFLLILINQTLIARSYTIVLMGEITNPFLFDSAIMGFNDNTNQPNSYIRIYNDQDDFLDQICNLNASSLDAIIDLSLNVIGSDDIGSHMDAPVVSMKEWNQYSSSEITNIPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPVFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNVLTQKQLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSLQELAAQQTTLYTTQSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPLLNELNLRILILQRDRILEQLKVKWWNSDKSVCPTVDSSAGLGLDTLGGAFAFLAVGIGIAGIIFIGEKIVAKIWGTEWAAAAGNDPTVVRPMGMMSTLNVNLGSHVSIRRASQLSGQQTLARRNYPTRSSNANIDENTNRNEKPMAIAKGGVMNSGYDNYDNPPTYSNTHM 930          
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Match: Q8MMK3 (DjGluR1 OS=Dugesia japonica OX=6161 GN=DjGluR1 PE=2 SV=1)

HSP 1 Score: 1409.82 bits (3648), Expect = 0.000e+0
Identity = 733/889 (82.45%), Postives = 806/889 (90.66%), Query Frame = 1
Query:  151 MGFNDNTNQPNSYIRIYNDQDDFLDQICNLNASSLDAIIDLSLNVIGSDDIGSHMDAPVVSMKEWNQYSSSEITNIPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPVFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNVLTQKQLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDSSAGLGLDTLXXXXXXXXXXXXXXXXXXXXEKIVAKIWGTEWAAAAGNDPTVVRPMGMMSTLNVNLGSHVSIRRASQLSGQQTLARRNYPTRSSNANIDENTNRNEKPMAIAKGGVMNSGYDNYDNPPTYSNTHM 2817
            MGF D   +  ++  ++NDQD FLD++C L  S++D  IDLSLNVIGSDDI SHMDAPV+SMKEW QYSSSE + IPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPV+MKEVN TNT E+MQFIKQLRVSEIILASEF LV+ V+NQAILSNTLNGVYHW+VVSKDL+ F C  C +G+F LF KKIDDI +++KI  INSS+++TY+AI+MVYAYQ GQ+LG  I  AK    W+ S+S FSCWNS++S N  RYN+ M ++K I I G+LG I FN TI+NQ+S+IMVSEV +G+SPVT+D+I WTRT GLG  N SLN+LTQKQLRILVIPEPPFVIK  N TF GYSIDIVAKL+E+MNFNYTFYEQ+DGQYG+V DNGTF+G+IGE+ANKN+DMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLK NEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSL ELAAQQ+  YTTQSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYN+M++WGFTPNI++SIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPLLNELNLRILILQRDRILEQLKVKWWN+DK+VCPT+DSSAGLGLDTLGGAFAFLAVGIGIAGIIFIGEKIVAKIWGTEWAAAAG DPTVVRPMGMMSTLNVNLGSHVSIRR SQ+SGQQ++ RR YP R+SNAN  ++ N NE+P AI +GG +N GYD+ +NPPTYSNTH+
Sbjct:    1 MGFKDVITEIYTFSDVFNDQDSFLDKVCELTPSTIDGFIDLSLNVIGSDDIASHMDAPVISMKEWTQYSSSETSTIPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPVYMKEVNDTNTLEIMQFIKQLRVSEIILASEFQLVAKVVNQAILSNTLNGVYHWYVVSKDLDKFYCASCTNGNFILFRKKIDDITMYNKIMNINSSLATTYKAIDMVYAYQAGQILGTIIKTAKQNQTWSVSNSKFSCWNSTSSFNNARYNLGMSILKTIKISGVLGDIVFNNTIKNQYSQIMVSEVILGNSPVTIDRIKWTRTTGLGFNNISLNLLTQKQLRILVIPEPPFVIKLDNGTFVGYSIDIVAKLSEFMNFNYTFYEQIDGQYGAVLDNGTFSGLIGEMANKNFDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKTNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSLTELAAQQSMQYTTQSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNKMSSWGFTPNINDSIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPLLNELNLRILILQRDRILEQLKVKWWNTDKAVCPTIDSSAGLGLDTLGGAFAFLAVGIGIAGIIFIGEKIVAKIWGTEWAAAAGTDPTVVRPMGMMSTLNVNLGSHVSIRRGSQISGQQSM-RRQYPQRTSNANAVDHHN-NERPAAITQGGEINPGYDHSENPPTYSNTHI 887          
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Match: A0A267H6T2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026892g1 PE=3 SV=1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 333/792 (42.05%), Postives = 502/792 (63.38%), Query Frame = 1
Query:  211 DDFLDQIC---NLNASSLDAIIDLSLNVIGSDDIGSHMDAPVVSMKEWNQYSSSEITNIPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPVFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNKCKSGS--FFLFHKKIDDIPLFDKIKTINSSVSSTY---RAIEMVYAYQTGQVLGVAISKAKSLNLWTP--SSSDFSCWNSSTSTNMVRYNMLMELMKNI-SIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKIL--WTRTNGLGN--YNFSLNVLTQKQLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDSSAGLGLDTLXXXXXXXXXXXXXXXXXXXXEKIVAKIWGTEWA 2541
            +     +C   N +    DAI+D +      +D+  H+DAPV  M+   + S    T  P+V P+  +Y+ +V S +   N+TRD +++LY   FDA  + P  +   + PV+++++  +N + ++   K LR+++ ++A+     + V+ + I    + G+YHWFV +KDL  F C  C +G   F+      +     + +  +++SV ++    R I+++ AY +   L  A+      N   P  +S+  +C+   +++   R N  +  ++ +    G++G + F  T++N  S   V+++   S+ V     +  WTR  GL     +  L  LT++ L + +I +PPFVIK PN TF GYS++++  +AE MNF+Y   EQ DG YG +  NG++ GM+G L   + DMA+G ITIT++RE+V DFS+P YDY ++QI++KK  AS   DQ FFLKAFTW+VW  +IA +  TGFLI FVD+VSPFSFQNR +N+++R+GEA+GK+FT+KES+W+VLGAYTQAGESFDPRS+SCR I+VG WLF YLMM++YTANL+AQLTV KL   P    EL  Q T  YT   +T+ +++F RMM AE +++ +W   GI N +   E A + TWKYP+ ERYT++++RM  WGF  +  +++KKI +D  A+FL++ ++KYY+ + C L+ VGEPF+ RPYG+ L+  SPLL  LN+ IL L  +R+ + LK  WW+++K  CPT DSS+GL L TLGGAF F  +G+GIA I+FIGEKIVAKI+G EWA
Sbjct:  101 ESLFQSVCTPANEHVLQADAILDFTPRPSCVEDLARHLDAPV--MRAAMELS----TGRPNVHPSPRNYMRAVASLLLRDNATRDGVMVLYDDTFDAGSILPYEDYSWYPPVYLRKIP-SNPDALLAEAKSLRIADFVVAASVTNAANVVARGIALGLMGGIYHWFVTTKDLADFACPSCGAGGQVFYFRQSAANASKAAEVLSAVSASVGASIAKAREIDILLAYDSATALTKALRAQIDANGGAPMNASNVLNCFGDYSASAPARLNDFLARLRVLPKFSGVMGGVNFAGTLRNTDSTFAVTQLQFNSAGVASSAKVGTWTRAGGLAGDVSSVELTYLTKRTLNVRLIHDPPFVIKLPNGTFTGYSVEMLQGIAERMNFDYRLVEQPDGAYGVMLANGSWNGMMGALERGDADMAIGPITITAQREQVADFSVPIYDYVSLQIVLKKAAASN--DQTFFLKAFTWDVWVCIIAIVTVTGFLIFFVDKVSPFSFQNRYRNDQVRDGEAEGKVFTVKESLWYVLGAYTQAGESFDPRSMSCRTIIVGFWLFGYLMMSLYTANLAAQLTVDKLVQPPQGFDELTTQATVKYTVIKDTAAYEHFQRMMNAEKNLYRYWLTSGIGNEETVNEVAALETWKYPVIERYTSVWSRMTRWGFADSTEDALKKIRQDGMAVFLDSALVKYYSAQSCDLMTVGEPFAPRPYGVALRQKSPLLKALNIAILGLNENRVTDSLKQAWWSANKVTCPTSDSSSGLSLQTLGGAFIFFCIGVGIAIIVFIGEKIVAKIYGVEWA 883          
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Match: A0A267G832 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002395g4 PE=3 SV=1)

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 338/809 (41.78%), Postives = 520/809 (64.28%), Query Frame = 1
Query:  253 LDAIIDLSLNVIGSDDIGSHMDAPVVSMKEWNQYSSSEITN-IPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPVFMKEVNYTNTE--EVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNKCKSGSFFLFHKKIDDIP-----LFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNI-SIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNY--NFSLNVLTQKQLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVC-PTVDSSAGLGLDTLXXXXXXXXXXXXXXXXXXXXEKIVAKIWGTEWAAAAGNDPTVVRPMGMMSTLNVNL-GSHVSIRRAS 2640
            +D I+D +      +D+  ++DAP++        +S E+TN +P+V P+  +Y+ +V + +   N+TRD I++LY A+FDA  + P  +   + P++++++  T  E   ++   K LR+++ ++AS     ++V+ QA + + + G+YHWFVV+KDL+ F+C+ C SGS   F ++          +F  +++      +  R +++++AY+  + +G  I        +  +++   C  + + +  VRYN     +K + S   ++G + F  T++N  +   ++++ V   P   +   WT+  GL       SL+ +T + L + +  +PPFVIK  + TFEGYSID++  LA  MNFNYT  EQ DG YG++  +GT+ GM+G LA+   DMA+G IT+T++RE++ DF++P YDY ++QIL+ + T S+KGDQ FFLKAFTW+VW ++IA I  TGFLI FVD+VSPFSFQNR +N++IREGEA+GK+FT+KES+W+VLGAYTQAGESFDPRS+SCR I+VG WLF YLMM++YTANL+AQLTV KL+  P S  EL  Q    YT   +T+ +++F RM  AEA+++ +W   GI   +   + A + TWKYP+ ERYT ++NRM  WGF  +  +++ ++ +++ A+FLE+ ++KYYT + C  + VG+PF+ RPYGI L+N SPLL ++N+ IL L  +R+ E LK  WW+ DK  C  T  +S+GL LDTLGGAF F  +G+GIA I+F+ EKIVAK++G EWA    +   V   M MM     NL  S+ SIR A+
Sbjct:   96 IDGILDFTARPSCVEDLARNLDAPIIR-------ASMELTNDVPNVHPSPRNYMRAVAALLLRDNATRDGIMVLYDASFDAGSILPYEDYSWYPPIYLRKIPTTAVEVATLLDEAKTLRIADFVVASSVSNAAMVVQQAGVKSLMGGIYHWFVVTKDLQDFSCSGCGSGSSLFFFRQTAADATRATAVFTAVQSATGVAVAESRKVDVLFAYEAAETMGRVIKAQTDAGSFGNATNWLVCSGAYSPSTPVRYNDYTAKLKALPSFSSVMGNVAFANTLKNTDTTFKIAQI-VYPGPTVNNIGTWTKAAGLAGSVSTISLSYMTIRNLIVRLTHDPPFVIKKADGTFEGYSIDMLKNLATNMNFNYTLVEQTDGIYGTLQSDGTWNGMMGALASGVADMAIGPITVTAQREQIADFTVPIYDYVSLQILLLQPT-SSKGDQTFFLKAFTWDVWVSIIAIITFTGFLIFFVDKVSPFSFQNRYRNDQIREGEAEGKVFTVKESLWYVLGAYTQAGESFDPRSMSCRTIIVGFWLFGYLMMSLYTANLAAQLTVDKLSQPPQSFDELTTQVAMKYTVIKDTASYEHFMRMKDAEANLYNYWLTSGIGTEETVDQLASLVTWKYPVIERYTTVWNRMTKWGFATSTEQALDRVRKENIAIFLESSLVKYYTAKTCDFMTVGDPFAPRPYGIALRNKSPLLKQMNVAILSLNENRVTETLKQYWWSRDKVTCQATSSASSGLSLDTLGGAFIFFCIGVGIALIMFVAEKIVAKVYGVEWAKNNADAKQVNTLMMMMGPSTANLRASNSSIRPAT 895          
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Match: A0A267DJA0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002395g2 PE=3 SV=1)

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 338/809 (41.78%), Postives = 520/809 (64.28%), Query Frame = 1
Query:  253 LDAIIDLSLNVIGSDDIGSHMDAPVVSMKEWNQYSSSEITN-IPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPVFMKEVNYTNTE--EVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNKCKSGSFFLFHKKIDDIP-----LFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNI-SIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNY--NFSLNVLTQKQLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVC-PTVDSSAGLGLDTLXXXXXXXXXXXXXXXXXXXXEKIVAKIWGTEWAAAAGNDPTVVRPMGMMSTLNVNL-GSHVSIRRAS 2640
            +D I+D +      +D+  ++DAP++        +S E+TN +P+V P+  +Y+ +V + +   N+TRD I++LY A+FDA  + P  +   + P++++++  T  E   ++   K LR+++ ++AS     ++V+ QA + + + G+YHWFVV+KDL+ F+C+ C SGS   F ++          +F  +++      +  R +++++AY+  + +G  I        +  +++   C  + + +  VRYN     +K + S   ++G + F  T++N  +   ++++ V   P   +   WT+  GL       SL+ +T + L + +  +PPFVIK  + TFEGYSID++  LA  MNFNYT  EQ DG YG++  +GT+ GM+G LA+   DMA+G IT+T++RE++ DF++P YDY ++QIL+ + T S+KGDQ FFLKAFTW+VW ++IA I  TGFLI FVD+VSPFSFQNR +N++IREGEA+GK+FT+KES+W+VLGAYTQAGESFDPRS+SCR I+VG WLF YLMM++YTANL+AQLTV KL+  P S  EL  Q    YT   +T+ +++F RM  AEA+++ +W   GI   +   + A + TWKYP+ ERYT ++NRM  WGF  +  +++ ++ +++ A+FLE+ ++KYYT + C  + VG+PF+ RPYGI L+N SPLL ++N+ IL L  +R+ E LK  WW+ DK  C  T  +S+GL LDTLGGAF F  +G+GIA I+F+ EKIVAK++G EWA    +   V   M MM     NL  S+ SIR A+
Sbjct:   96 IDGILDFTARPSCVEDLARNLDAPIIR-------ASMELTNDVPNVHPSPRNYMRAVAALLLRDNATRDGIMVLYDASFDAGSILPYEDYSWYPPIYLRKIPTTAVEVATLLDEAKTLRIADFVVASSVSNAAMVVQQAGVKSLMGGIYHWFVVTKDLQDFSCSGCGSGSSLFFFRQTAADATRATAVFTAVQSATGVAVAESRKVDVLFAYEAAETMGRVIKAQTDAGSFGNATNWLVCSGAYSPSTPVRYNDYTAKLKALPSFSSVMGNVAFANTLRNTDTTFKIAQI-VYPGPTVNNIGTWTKAAGLAGSVSTISLSYMTIRNLIVRLTHDPPFVIKKTDGTFEGYSIDMLKNLATNMNFNYTLVEQTDGIYGTLQSDGTWNGMMGALASGVADMAIGPITVTAQREQIADFTVPIYDYVSLQILLLQPT-SSKGDQTFFLKAFTWDVWVSIIAIITFTGFLIFFVDKVSPFSFQNRYRNDQIREGEAEGKVFTVKESLWYVLGAYTQAGESFDPRSMSCRTIIVGFWLFGYLMMSLYTANLAAQLTVDKLSQPPQSFDELTTQVAMKYTVIKDTASYEHFMRMKDAEANLYNYWLTSGIGTEETVDQLASLVTWKYPVIERYTTVWNRMTKWGFATSTEQALDRVRKENIAIFLESSLVKYYTAKTCDFMTVGDPFAPRPYGIALRNKSPLLKQMNVAILSLNENRVTETLKQYWWSRDKVTCQATSSASSGLSLDTLGGAFIFFCIGVGIALIMFVAEKIVAKVYGVEWAKNNADAKQVNTLMMMMGPSTANLRASNSSIRPAT 895          
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Match: GRID1 (glutamate ionotropic receptor delta type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4575])

HSP 1 Score: 172.555 bits (436), Expect = 1.183e-43
Identity = 186/667 (27.89%), Postives = 307/667 (46.03%), Query Frame = 1
Query:  517 SGTFIPVFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSK---DLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTI--NSSVS---STYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSS-----------DFSCWNSSTSTNMVRYNM--------LMELMKNISIPGILGQITF-----NLTIQNQFSKIMVSEVTVGSSPVTVDKIL-WTRTNGLGNYNFSL------NVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW 2379
            SG F  +F        TEE+ ++   LR + ++L+       + I+QA+ +N  +   HW  V++   D EI            L H  +  + +  +I  +  +SSVS   +++R   ++   Q G +  + +S     NL+   S            +   W+S  S N +R +         ++E ++   I G+ G + F     N  +Q +      SE T G     + ++  W   +GL   N SL      N +    ++++ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  D +YGS   NG++ GMIGEL NK  D+AV AITIT ERE VVDFS  Y DY ++ ILM+K     K +       F   VWA + A I   G LI  + R+     QN    +     ++     T+  ++W V GA+ Q G      S++ R+++   WLF  ++ + YTANL+A LTV+ + +   + Q+LA Q    Y T  +++++DYF                KG N L+  +++     W+  I +     Y+         + SE I+K  +  +A   +  +++Y   T+ DC +   G   S + YGI LQ+ SP  +  + +IL LQ    L+ LK KWW
Sbjct:  120 SGVFSSLFTS----MRTEELNRYRDTLRRAILLLSPRG--AQVFIHQAVETNLASKDSHWVFVNEEISDTEIME----------LAHSALGRMTVIRQIFPLWRDSSVSCMRNSHRISSLLCDPQEGYLQSLEVS-----NLYLYDSVLMLANAFYRKLEDRKWHSMASLNCIRKSTKPWNGGWSMLETIQKGRITGLTGVMDFMDNGSNSHVQFEILGTSFSE-TFGKD---IKRLATWDSVHGL---NGSLKESRIENGMQGVTVKVVTLLEDPFVMVAENILGQPKKYKGFSIDVLDALAKMLGFKYDIYQVADSKYGSQLSNGSWNGMIGELINKRADLAVSAITITPERENVVDFSKRYMDY-SVGILMRK--PEEKINIFSLFAPFDLAVWACIAAAIPVVGVLIFLLTRMQSLRSQNPPGPH-----QSPSMSSTLHSAIWIVYGAFVQQGGDSVVGSVALRIVMGSWWLFTLIVCSSYTANLAAYLTVSHMDNTIRTFQDLARQMDLDYGTVRDSAVYDYF--------------RAKGTNPLE--QDSTYAELWRT-ISKNNGQDYS-------VSSPSEGIRKAKKGPYAFLWDMAVVEYAALTDDDCTITVSGNSMSSKGYGIALQHGSPYRDLFSQKILELQEKGDLDVLKQKWW 726          
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Match: ENSAMXT00000004586.2 (glutamate receptor ionotropic, kainate 2-like [Source:NCBI gene;Acc:103044887])

HSP 1 Score: 164.466 bits (415), Expect = 3.692e-41
Identity = 139/504 (27.58%), Postives = 238/504 (47.22%), Query Frame = 1
Query:  991 LMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKI-LWTRTNGLGNYNFS-------LNVLTQKQLRILVIPEPPFVI----KTP---NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDN-GTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
             M L+K  S  G+ G++ FN T  ++ +F   ++S    G     ++KI  W   NGL              N L+ K LR+  I E P+V+      P   N+ FEGY +D++ +LA  + F Y      DG+YG++ ++ G + GM+ EL +   D+AV  + IT  RE+V+DFS P+     I IL +K   +  G  +F L   + ++W  ++   +G   ++  + R SP+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S  +LA Q    Y    + S                 F+ +  I+  DK         W++    R + M           ++ E I++++  D+A  +E+  I++ T R+C L  +G     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  +S  ++ LG+  +
Sbjct:  361 FMSLIKEASWDGLTGRVLFNKTNGLRTEFDLDVISLKEDG-----LEKIGTWEPVNGLNMTEHHKSKMTNVTNSLSNKSLRVATILEEPYVMFKKSDKPLCGNDRFEGYCVDLLRELASILGFRYEIQLVEDGKYGALEESTGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLG-ISILYRKPNGTNPGVFSF-LNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNP--DSDMVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIPYGVVEDGS--------------TMAFFKKTKISTYDK--------MWEFMNSRRQSVMVK---------SVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEESKEASALGVQNI 822          
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Match: grid1a (glutamate receptor, ionotropic, delta 1a [Source:ZFIN;Acc:ZDB-GENE-120411-28])

HSP 1 Score: 162.925 bits (411), Expect = 7.528e-41
Identity = 125/401 (31.17%), Postives = 202/401 (50.37%), Query Frame = 1
Query: 1198 LRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW 2379
            ++++ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  DG+YGS   NG++ GMIGEL  K  D+A+ AITIT ERE VVDFS  Y DY ++ ILM K  +  K +    L  F   VWA + A I   G +I  + R+     QN    +     +      + + ++W V GA+ Q G      S++ R+ +   WLF  ++ + YTANL+A LTV+++ +   + Q+L+ Q    Y T   +++++YF                KG N L+  +++     W      R  N     +    TP  ++ I+K+  + +A   +  +++Y   T+ DC L   G   S + YG+ LQ+ SP  +  + +IL LQ    L+ LK KWW
Sbjct:  222 VKVVTLLEEPFVMVAENILGQPKRYKGFSIDVLDALAKILGFKYEIYQVADGKYGSQQPNGSWNGMIGELIKKRADLAISAITITPERENVVDFSKRYLDY-SVGILMSK--SVEKLNIFSLLAPFDLAVWACIAAAIPVVGVMIFLLRRIQSVRSQNTPGPH-----QPASVTTSFQSAIWIVYGAFVQQGGESIMSSVALRIAMGSWWLFTLIVCSSYTANLAAYLTVSRMDNAVRTFQDLSKQADLSYGTVKESAVYEYF--------------KVKGTNPLE--QDSTYAELW------RTINKNQGQDNSVSTP--ADGIRKVRRESYAFLWDMAVVEYAALTDDDCTLTVTGNSMSTKGYGLALQHGSPYRDLFSQKILELQEKGDLDILKQKWW 590          
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Match: grik1a (glutamate receptor ionotropic, kainate 1 [Source:NCBI gene;Acc:103038234])

HSP 1 Score: 163.31 bits (412), Expect = 1.068e-40
Identity = 153/577 (26.52%), Postives = 261/577 (45.23%), Query Frame = 1
Query:  802 IKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYN-MLMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKI-----LWTRTNGLGNYNFSLNVLTQKQ-------------LRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
            I  +N++ +  Y A+ MV          VA  +A  + + +        W         RY    M L K     G+ G+I  N T  ++  F   ++S    G++   VD       LWT+  G+ N    LN+  +K+             L +  I E P+V+          N+ FEGY +D++ +L+  + FNY      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   T ++W  V+   +G   ++  + R +P+ + N    N   +   +   FT+  S+WF + A  + G    P+++S R++    W F  ++++ YTANL+A LTV ++ +   S  +LA Q    Y    + S   +F                          + + +ST+    E+ +T M +R N      N  E I +++  D+AL +E+  I+Y + R+C L  VG     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  D+  ++ LG++ +
Sbjct:  314 IGMMNTAAALMYDAVFMV---------AVASQRASQMTVSSLQCHRHKPW---------RYGPRFMNLFKEAQWDGLTGRIILNKTDGLRKDFDLDLISLKEDGTAKRVVDGAARRTKLWTKI-GVWNSYSGLNLTEKKENNKNVTDSLANRTLIVTTILENPYVMYKKSDKVLYGNDRFEGYCLDLLKELSNILGFNYEVKLVTDGKYGAQNDKGEWNGMVRELIDHIADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLTPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNASSDVMENN--FTLLNSLWFGVAALMRQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDAPIDSADDLAKQTRIEYGAVRDGSTMTFF--------------------------KKSKISTY----EKMWTFMSSRKNT-ALVKNTREGITRVLTTDYALLMESTSIEYISQRNCNLTQVGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDNKEASALGVENI 834          
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Match: grik1a (glutamate receptor ionotropic, kainate 1 [Source:NCBI gene;Acc:103038234])

HSP 1 Score: 162.925 bits (411), Expect = 1.143e-40
Identity = 153/577 (26.52%), Postives = 261/577 (45.23%), Query Frame = 1
Query:  802 IKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYN-MLMELMKNISIPGILGQITFNLT--IQNQFSKIMVSEVTVGSSPVTVDKI-----LWTRTNGLGNYNFSLNVLTQKQ-------------LRILVIPEPPFVIKTP-------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
            I  +N++ +  Y A+ MV          VA  +A  + + +        W         RY    M L K     G+ G+I  N T  ++  F   ++S    G++   VD       LWT+  G+ N    LN+  +K+             L +  I E P+V+          N+ FEGY +D++ +L+  + FNY      DG+YG+  D G + GM+ EL +   D+AV  +TIT  RE+V+DFS P+     I IL +K   +  G  + FL   T ++W  V+   +G   ++  + R +P+ + N    N   +   +   FT+  S+WF + A  + G    P+++S R++    W F  ++++ YTANL+A LTV ++ +   S  +LA Q    Y    + S   +F                          + + +ST+    E+ +T M +R N      N  E I +++  D+AL +E+  I+Y + R+C L  VG     + YG+     SP  +++ + IL LQ +  L  +K KWW  +   CP  D+  ++ LG++ +
Sbjct:  314 IGMMNTAAALMYDAVFMV---------AVASQRASQMTVSSLQCHRHKPW---------RYGPRFMNLFKEAQWDGLTGRIILNKTDGLRKDFDLDLISLKEDGTAKRVVDGAARRTKLWTKI-GVWNSYSGLNLTEKKENNKNVTDSLANRTLIVTTILENPYVMYKKSDKVLYGNDRFEGYCLDLLKELSNILGFNYEVKLVTDGKYGAQNDKGEWNGMVRELIDHIADLAVAPLTITYVREKVIDFSKPFMTL-GISILYRKPNGTNPGVFS-FLNPLTPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNASSDVMENN--FTLLNSLWFGVAALMRQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDAPIDSADDLAKQTRIEYGAVRDGSTMTFF--------------------------KKSKISTY----EKMWTFMSSRKNT-ALVKNTREGITRVLTTDYALLMESTSIEYISQRNCNLTQVGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDNKEASALGVENI 834          
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 120.939 bits (302), Expect = 9.423e-29
Identity = 122/430 (28.37%), Postives = 192/430 (44.65%), Query Frame = 1
Query: 1210 VIPEPPFVIKT------PNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVT-DNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKI-------------------------FTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRD-CQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVC 2400
            ++  P F++K        N+ +EGY +D+  ++A +  F Y +    DG YG+   D   + GM+GEL     D+A+  +TI+  RE V+DFS P+     I I++KK   S  G  + FL    +E+W  +I   IG   ++  V R SP+ +Q R  + ++      G                           F I  S+WF LGA+ Q G    PRS+S R++    W F  ++++ YTANL+A LTV ++ S   S  +LA Q    Y T  + S  ++F R                       K       W + +++    ++ R NA G +  + +S  K     +A  LE+   +Y   R  C  + VG     + YGI     S L + +NL +L L    +L++LK KWW  DK  C
Sbjct:   38 ILDAPYFMLKKNHEQFEGNDKYEGYCVDLGQEIAIHEQFEYKWSVVPDGAYGARNPDTKVWNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSL-GISIMIKKPQKSKPGVIS-FLDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPYEWQ-RDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFQR----------------------SKIGVYEKMWLF-MKDAEPKVFVRTNADGVS-RVRKSKGK-----YAYLLESTTNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSALRDAVNLAVLKLNEQGLLDKLKNKWW-YDKGEC 434          
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000621.1 (pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 gene:ENSPMAG00000000562.1 transcript:ENSPMAT00000000621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 6.276e-28
Identity = 75/229 (32.75%), Postives = 119/229 (51.97%), Query Frame = 1
Query: 1219 EPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQA---FFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKL 1881
            E PFV+   N       F+G+S+D++  L++ + F+Y  +   D  YG    +GT++GMIGEL NK  D+A+ A+TIT ERE VVDF+  Y DY+        V A    D A     L       WA +   +   G L+  ++RV+P          E R         ++  S+W V G++ Q G      S+S R+++   WLFA+++++ YTA+L+A LT+ ++
Sbjct:    3 EEPFVMLAENVLGKPKKFQGFSVDVMDALSKSLGFSYEIFMPADLSYGLPQADGTWSGMIGELLNKRADVAISALTITPERESVVDFTKRYMDYSV------GVAARRPADSAGLFALLSPLEPATWACLGLAVGLVGLLVYLLNRVTP--------RREPRHSP------SLPASLWLVYGSFMQQGPELSSSSLSARLVMGVWWLFAFIVVSSYTASLTALLTINRM 211          
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 3.566e-27
Identity = 95/351 (27.07%), Postives = 160/351 (45.58%), Query Frame = 1
Query: 1396 NKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDS--SAGLGLDTL 2442
            N   D+AV  +TI   RE+ +DFS P+     I IL +K   +  G  +F L   + ++W  ++   +G   ++  + R SP+ + N    N   + +     FT+  S WF +GA  Q G    P+++S R++    W F  ++++ YTANL+A LTV ++ S   S                 T I     R    +    TF+ +  I+  +K         W +        M +R  A     N  E I++++  D+A+ +E+  I+Y T R+C L  +G     + YGI     SP  +++ + IL LQ +  L  +K KWW  +   CP  DS  ++ LG+  +
Sbjct:    7 NHKADLAVAPLTINYMREKAIDFSKPFMTLG-ISILYRKPNGTNPGIFSF-LNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNP--DSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISS----------ADDLAKQTRIEYGAVR----DGSTMTFFKKSKISTYEK--------MWAF--------MSSRQTA--LIKNNEEGIQRVLTTDYAMLMESTNIEYVTQRNCNLTQIGGLIDNKGYGIGTPLGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEDSNEASALGVQNI 319          
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010600.1 (pep scaffold:Pmarinus_7.0:GL477914:43885:60233:1 gene:ENSPMAG00000009599.1 transcript:ENSPMAT00000010600.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 3.165e-25
Identity = 83/313 (26.52%), Postives = 141/313 (45.05%), Query Frame = 1
Query:  853 VYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQN---QFSKIMVSEVTVGSSPVTVDKILWTRTNGL-GNYNFSL--NVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAG 1758
            +Y Y +  +L  A  +      W  S +  SC    T      ++ML ++++   + G+ G++ FN    N   QF  +  S    G         LW   NGL G     L  N L    LR++ + +PPFV+ + N       F G+++D++ +L+ ++ F Y  Y+  D  YG     G+++G++GE+ +K  D+ +GA+TIT ERE VVDF+  + D     +L ++       D    L  F   VWA + A +     ++  ++ +       R   + +    AD +  T   S W V G+  Q G
Sbjct:   67 LYIYDSVVLLTTAFHQKLEDRKWH-SMASLSCLKRWTKPWNGGHSML-DVIRQGRVWGLTGELQFNELGVNPNVQFEVLGTSYADGGQEKTVRRLALWDPKNGLNGTLRDRLLENNLKGVTLRVVTVLDPPFVMMSDNVLGQPKRFVGFAVDVLEELSRHLGFTYDLYQAPDNSYGRPGPGGSWSGLLGEILHKRADVGIGAVTITPERESVVDFTKRFMDRGVAIMLREQHHHQRHADLFSCLAPFA-TVWAGLAACVPIVALVVHRLNSIG----AGRPAGSTM---AADARGRTWPGSKWLVYGSLMQQG 369          
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 4.914e-23
Identity = 64/203 (31.53%), Postives = 110/203 (54.19%), Query Frame = 1
Query: 1258 EGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATV-IATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLG-AYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSA 1860
            +G+ IDI+ KL++ + F Y  Y   +G++GS   NG + GMIGE+ N    MAVG++TI  ER  VVDFS+P+ +   I +++ +   +     + FL+ F+ +VW  + I  ++ +G  +   +  SP  +  +L   +    E  G  FTI +S+W +    +  +    +PR  + + +V     FA + +A YTANL+A
Sbjct:  397 KGFCIDILKKLSKTVKFTYDLYLVTNGKHGSKI-NGVWNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVE-TGISVMVPRSNGTVS--PSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPVGYNRQLSAGK----EFGGPAFTIGKSIWLLWAIVFNNSVPVENPRGTTSKFMVSVWAFFAVIFLASYTANLAA 591          
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 145.206 bits (365), Expect = 2.082e-37
Identity = 108/411 (26.28%), Postives = 194/411 (47.20%), Query Frame = 1
Query: 1213 IPEPPFVIKTPN-------NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWG-FTPNISESIKKIIEDDWALFLETPIIKYYTNRD-CQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDSS 2418
            + + PF++  PN       + + G+S D++  L+  +NF Y      +  YGS  + G + G+IGEL  +  D+A+G ITIT+ERE V+DFS P+ D+  I +++++ T       AF L  F  ++W T +  +     ++ F+DR SP  ++ + +    + GE +G  F++  S+WF + +  Q G    PRS S RV+    WLF  ++++ YTANL+A  T        G     +   +       +T  +      ++    +FTF++E  ++                     Y  M+ +M +   F       + K     +A   + P + YY  R  C  + V      + Y + ++ NS   N +++ IL L+ +  +E+ +++WW+ D S CPT  S+
Sbjct:    6 LQDEPFMMIKPNASLLKGNDRYRGFSKDLMELLSRKLNFRYEICISKESSYGSKVE-GQWQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFR-IAMILQQPTGEEVNLFAFLL-PFDEKLWLTTLGVVGLVSLIVWFLDRFSPQGYKTQAE----KSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFT--------GERGIRSKINSLEDLVSQSTVKYG-----VQEGGSLFTFFSESKVDI--------------------YATMFQQMKSQETFVNGTQYGVLKARTQPFAYLTDQPSLDYYNMRKPCNTMLVKNLLDAKSYALAMRRNSEWTNLISVAILELREEGEIEKSRLRWWD-DSSECPTGPST 375          
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 124.79 bits (312), Expect = 4.286e-29
Identity = 146/564 (25.89%), Postives = 239/564 (42.38%), Query Frame = 1
Query:  901 AKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIP-GILGQITFN-----------LTIQNQFSKIMVSEVTV-GSSPVTVDK-ILWTRTNGLGNYNFS-LNVLTQKQLRILVIPEPPFVIKTP------------------------NNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSV-----TDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAG-ESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAK---LASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFL-ETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDSS-AGLGLDTL 2442
             K+L   T S  +   W+S           L   + N+S+P G  G I FN           L  + Q S   V  V +  +  V++++ I+W      GN N +   V     LR++ +   PFV   P                        ++T  G+ +D++ +L E +NF Y+     DG YGS+     +D   + GM+GE+     D+ V A+TI +ER   ++FS P + Y  + IL+KK   S   D   FL+ F   +W  V+ ++     ++  +DR SPF    R K   +   E +     +  +MWF  G    +G     PRS S RV+ +    FA +++A YTANL+A L + +   + S           +  +Y T +N+S+  YF R ++                                     ++MY  M  +       E I+K+   +   F+ ++P++ Y  ++DC L   GE F +  YGI +   SP  N ++L IL      ++E+L+  W   D S C T ++S A LGL  +
Sbjct:  295 GKTLTTPTASCRETQQWSSGQE--------LFNALVNVSLPRGTTGPIAFNSDGDRKNAVYRLMNRRQSSSDAVDVVGLYENGHVSINESIIWP-----GNLNTTPTGVFLSNHLRVVTLVGEPFVYVKPIPTSGRCSDLDTNTAKHVLCTGTVSDTDSGFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKP-FKYQGLTILVKKNEQSNSLDS--FLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPF---GRFK---LARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYFRRQVE------------------------------------LSSMYTFMEGYN-VKTAKEGIEKVKNGELKAFIWDSPVLYYEASKDCTLTTAGELFGRSGYGIGMPKGSPWSNAISLAILNFHESGVMEELETTWI--DASKCNTENTSPATLGLQHM 797          
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 118.242 bits (295), Expect = 4.284e-27
Identity = 99/373 (26.54%), Postives = 173/373 (46.38%), Query Frame = 1
Query:  871 GQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYN-------MLMELMKNISIPGILGQITF-------NLTI------QNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTD-NGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSF--------QNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLAS 1887
            G+V+   +  AK++     +    +  N+    N+ R N        L + ++ +   G +G ++F       N +I      +N+F K+       G    +   ++W  + G G    S NVL  + +R++     PF +   N     + FEG  ID++ +L+E ++FNYT Y   DG+ G      G + G+I EL  +  D+AVG ITITS R +V+DF+ P+   + I ++M   T ++      FL+ F  ++W T+   ++G G +      VSPF F          R+K + +++  +   + +I  S  + LG   Q  +   P S S R  V   W    ++ A YTAN++A LT  ++ +
Sbjct:  254 GRVIDSVLVIAKAIQNAVQAGDQVTSGNAGLFCNLTRRNPPSISGITLNKYIQKVQTAGFMGFLSFSQDGFLANPSIDIINVKENEFDKVGEWNTKDGLMMDSDKTVVWM-SGGPGTPRDSENVLADRTIRVVSFKGSPFTMPVGNVSSSVDRFEGAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMT-SGIGVVMG--TENSPKPYFRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLG---QGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQT 619          
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 115.546 bits (288), Expect = 3.220e-26
Identity = 100/396 (25.25%), Postives = 181/396 (45.71%), Query Frame = 1
Query: 1171 SLNVLTQKQLRILVIPEPPFVI-KTPNN-------TFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGS---VTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEAD----GKIFTIKESMWFVLGAYT-QAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQ---LVAVGEPFSQRPYGIVLQNNSP 2301
            S ++L  + L+++ I E PF+  +T  N         EGY I+++ KL+E + F +  Y   D  +G+   VT    + G++ E+ N   D+AV ++TI+ ER++V+DF+ PY D   + +L+K      K   A  L+ F +++W  +  T+I  GF +      SPF F  R       + E          ++  ++W  +  Y  Q+ +   P S S R+ V   W    ++M+ YTANL+A LT+ +  S   S+ +LA Q+   Y T  N+    +F                      +     + ++ W+Y    RY +         F  N +E I+K++ +++A   ++ ++++  +       L+  G  F +  YG  L  +SP
Sbjct:  437 STHILENRTLKVVTIAEAPFIFAQTQTNGQGETRVIIEGYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKE--WNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDL-GLTVLIKPDPTEEKNPFA-ILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQPQAFF----------------------ESASVPSFVTMWQY---MRYHHT--------FVNNSAEGIEKVMNENYAFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSP 795          
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Match: EDO32623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUK5])

HSP 1 Score: 101.679 bits (252), Expect = 3.279e-24
Identity = 64/223 (28.70%), Postives = 112/223 (50.22%), Query Frame = 1
Query: 1225 PFVIKTPNNT-----FEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAK 1878
            PF+I   + T     + G+SID++  LA    F Y  YE    + G V ++GT+ G+ G++ ++  D+    +TI S R + +DFS P+  + ++ ++ +K     + D   F+  +T  VW   +A  I     +  V+  SP+        + +R+ E DG  F+   S+WF L +  Q G    P+ +S R++   LW    + ++ YTANL+A LT + 
Sbjct:    1 PFIISEKDPTTGAVKYTGHSIDLLDILAGMNGFQYEIYESA--ELGGVKEDGTYYGLFGDIQSEKADLTTLPLTINSARLQYLDFSEPFM-HVSMDLVTRK-PEEKQIDITGFMTPYTIPVWLMTMACWIFVTGCLSLVNYYSPY-------GHRLRDTEGDGDEFSFFNSLWFCLASMLQQGGDATPKMLSGRIVTGTLWFVILVWVSTYTANLAAFLTTSS 212          
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Match: grid1a (glutamate receptor ionotropic, delta-1 [Source:NCBI gene;Acc:101162392])

HSP 1 Score: 177.563 bits (449), Expect = 3.788e-45
Identity = 173/642 (26.95%), Postives = 297/642 (46.26%), Query Frame = 1
Query:  535 VFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNKCKSGSFFLFHKKIDDIPLF-----------DKIKTINSSVSSTY-RAIEM--VYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKIL--WTRTNGLGNYNFSLNVLTQKQ---LRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFT-PNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW 2379
            VF    N   TEE+ ++   LR + ++++       + I+QA+ +N  +   HW   ++++      +   GS           P++            +I ++       Y +++E+  +Y Y +  +L  A  +      W  S +  +C   ST      ++ML  + K   I G+ G + F     N   +  V   +   +     K L  W    GL        + +  Q   L+I+ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  DG+YGS+  NG++ GMIGEL  K  D+A+ AITIT ERE VVDFS  Y DY ++ ILM+K  +  K +    L  F   VWA + A I   G +I  + R+      N           A     +++ ++W V GA+ Q G      S++ R+++   WLF  ++ + YTANL+A LTV+++ +   SLQ+L+ Q   +Y T  ++++++YF                KG N L++    A +  WK         + N+ N + ++  + SE ++K   + +A   +  +++Y   T+ DC L   G   + R YG+ LQ+ SP  +  + +IL +Q    L+ LK KWW
Sbjct:  204 VFTDLFNTMRTEELNRYRDTLRRAVLLMSPRG--AQVFIHQAVETNLASKDSHWVYANEEVSDSDIVELVHGSLGRMTIIRQIFPMWRDTNVRCMRNNHRISSLLCDPQEGYLQSLEVSNLYLYDSVLMLANAFYRKLEDRKWH-SMASLNCMRKSTKPWNGGWSMLDTIQKG-RISGLTGIMDFRAEGSNSHVQFEVLGTSYSETFGKDVKRLATWDSIRGLNGSLRENRIDSSMQGVTLKIVTLLEEPFVMAAENILGQPKRYKGFSIDVLDALAKILGFKYDIYQVGDGKYGSMLPNGSWNGMIGELIGKRADLAISAITITPERESVVDFSKRYLDY-SVGILMRK--SEEKINIFSLLAPFDLAVWACIAAAIPVVGIMIFLLRRIQAVRCHNNAGGQ-----PAPSASTSLQNAIWIVYGAFVQQGTDSLLGSVALRIVMGSWWLFTLIVCSSYTANLAAYLTVSRMDNAVRSLQDLSKQGDVVYGTVRDSAVYEYF--------------RAKGTNPLEQDNTFAEL--WK---------VINKNNGFEYSVSSPSEGLRKAKRESYAFLWDMAVVEYAALTDDDCTLTVGGSSLNTRGYGMALQHGSPYRDLFSQKILEIQEKGDLDILKQKWW 808          
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Match: GRID1 (glutamate receptor ionotropic, delta-1 [Source:NCBI gene;Acc:101174819])

HSP 1 Score: 169.859 bits (429), Expect = 1.079e-42
Identity = 177/651 (27.19%), Postives = 295/651 (45.31%), Query Frame = 1
Query:  535 VFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSK---DLEIFTCNKCKSGSFFLFHKKIDDIPLF-----------DKIKTINSSVSSTYRA---IEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKIL-----WTRTNGLGNYNFSL------NVLTQKQLRILVIPEPPFVIKTPN-----NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADG-KIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKY--YTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWW 2379
            VF        TEE+ ++   LR + ++L+ +       I QA+ +N  +   HW  V++   D EI    +   G   +  +     PL+            +I +I       Y     +  +Y Y +  +L  A  +      W  S +  +C   ST      ++ML E ++  +I G+ G + F     N   +    E+   S   T  K +     W   +GL   N SL      N +    ++++ + E PFV+   N       ++G+SID++  LA+ + F Y  Y+  D +YGS   NG++ GMIG+L NK  D+AV AITIT ERE VVDFS  Y DY  + IL++K     K +       F + VWA + A I   G LI  ++R+      +    +      ++G    T+  ++W V GA+ Q G      S++ R+++   WLF  ++ + YTANL+A LTV+++     S Q+LA Q    Y T  +++++DYF                KG N L+  +++     W      R  +  + ++    +P  SE I+K  +  +A   +  +++Y   T+ DC +   G   S + YGI +Q+ SP  +  + +IL LQ    L+ +K KWW
Sbjct:  156 VFTNLFTTMRTEELNRYRDTLRRAVLLLSPQG--AHTFIQQAVETNLASKDSHWVFVNEEISDAEILELTQGALGRMMVIRQIF---PLWRDSSSRCMRQNHRISSILCDPQEGYLQNLEVSNLYLYDSVLMLANAFYRKLEDRKWH-SMASLNCIRKSTKPWNGGWSML-ETIQKGNITGLTGTMDFKDNGSNSHVQF---EILGSSFSETFGKDIKRLATWDSVHGL---NGSLKESRIENGMQGVMIKVVTLLEDPFVMVAENILGQPKRYKGFSIDVLDALAKILGFKYEIYQVADSKYGSQLPNGSWNGMIGDLINKRADLAVSAITITPERENVVDFSKRYLDY-RVGILVRK--PEEKINIFSLFAPFDFAVWACIAAAIPVVGVLIFLLNRLQALHSSSSSSQSLSHGRRSNGVGSGTLHSAIWIVYGAFVQQGGDGVVGSVALRIVMGSWWLFTLIVCSSYTANLAAYLTVSRMDHAIRSFQDLARQMDVDYGTVRDSAVYDYF--------------RNKGTNPLE--QDSTYAELW------RTMSRNDGLDHSVSSP--SEGIRKAKKSPYAFLWDMAVLEYTALTDDDCTITVSGNSMSSKGYGIAMQHGSPYRDLFSQKILELQEKGDLDIMKQKWW 766          
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Match: grik4 (glutamate ionotropic receptor kainate type subunit 4 [Source:NCBI gene;Acc:101170037])

HSP 1 Score: 167.548 bits (423), Expect = 5.624e-42
Identity = 143/530 (26.98%), Postives = 246/530 (46.42%), Query Frame = 1
Query:  928 SSSDFSC-----WNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKI-LWTRTNGLGNYNFSLNV-----LTQKQLRILVIPEPPFVIKTPN-------NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKI--FTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWG---FTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVD--SSAGLGLDTL 2442
             ++  SC     W   TS        LM  ++ + + G+ G I FN   Q     + + +    +S   + +I LW   +GL      L++     L    L +  I E P+V+  PN       + +EG+ +D++ +LAE + F Y      DG YG    NGT+TGM+GEL ++  D+AV  +TIT+ERE+V+DFS P+     I I M +V    +     FL  F+  VW  ++   +    ++  V R++P+ + N    +   +G+ +  I  +++  S WF +G + Q G +  PR++S R +    W F  ++++ YTANL+A LTV ++                        S+ D       A+     + T  G          + M+ ++    + Y  M+N M++     F  +  E I +++  ++A  LE+ + +YY  R+C L  +G     + YG+ +   S   +E +L IL LQ +  LE LK KWW+  K  CP  +   + GLG++ +
Sbjct:  329 GATQLSCKSSKIWEHGTS--------LMNYLRMVELEGLTGHIEFNSKGQRSNYALRIMQ----NSKEGLRQIGLWHSEDGLSMERMPLSINVTDTLFNTTLTVTTILESPYVMLKPNYQEFEGNDRYEGFCVDMLEELAELLKFKYRIRLVGDGLYGVPGANGTWTGMVGELISRKADLAVAGLTITAEREKVIDFSKPFMTL-GISI-MYRVHLGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYN---PHPCLKGQCNLLINQYSLGNSFWFPVGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRME-------------------VPIESVDDL------ADQTSIEYGTMHG---------GSTMTFFQNSRYQTYQRMWNFMHSKQPSVFVKSTEEGIARVLNSNYAYLLESTMNEYYHQRNCNLTQIGGLLDTKGYGVGMPLGSVYRDEFDLAILKLQEENRLEILKRKWWDGGK--CPKEEDHRAKGLGMENI 805          
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:101174774])

HSP 1 Score: 163.696 bits (413), Expect = 1.016e-40
Identity = 139/529 (26.28%), Postives = 242/529 (45.75%), Query Frame = 1
Query:  892 ISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNV-----LTQKQLRILVIPEPPFVIKTPN-------NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDSSAGLGLDTL 2442
            +++++ + +   S +    W   TS        LM  ++ +   G+ G++ FN   Q     + + E   G      +  +W   N L   + SL++     L  K L +  I E P+V++  N       + +EG+ +D++ +LA+ + F++      DG YG+   NG++TGM+GEL N+  D+AV A TITSERE+V+DFS P+     I IL  +V    K     FL  F+  VW  ++   +    ++    R+SP+ + N       R    + + +T+  S+WF +G + Q G    PR++S R +    W F  ++++ YTANL+A LTV ++ +   S  +LA Q    Y T    S   +F                         +       W Y        MY++  +  F  +  E I +++   +A  +E+ + +Y+   +C L  +G     + YGI +   SP  +E+ L IL LQ +  LE LK +WW   + +      + GLG++ +
Sbjct:  320 LNRSQEIGVKPLSCTSPQIWQHGTS--------LMNYLRMVEYDGLTGRVEFNSKGQRTNYTLRILEKHRGGHK---EIGIWYSNNTLAMNSTSLDINVSETLANKTLIVTTILENPYVMRKDNYQDFQGNDQYEGFCVDMLRELADILKFSFKIKLVDDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTL-GISILY-RVQLGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCMRERRDMLENQ-YTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESPDDLADQTNIEYGTIHGGSTMTFFM----------------------NSRYQTYQRMWNY--------MYSKQPSV-FVKSTEEGIARVLNSKYAFLMESTMNEYHRGLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKRRWWEGSQCLKEEDHRAKGLGMENI 803          
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:101174774])

HSP 1 Score: 162.54 bits (410), Expect = 2.248e-40
Identity = 139/529 (26.28%), Postives = 242/529 (45.75%), Query Frame = 1
Query:  892 ISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNV-----LTQKQLRILVIPEPPFVIKTPN-------NTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDSSAGLGLDTL 2442
            +++++ + +   S +    W   TS        LM  ++ +   G+ G++ FN   Q     + + E   G      +  +W   N L   + SL++     L  K L +  I E P+V++  N       + +EG+ +D++ +LA+ + F++      DG YG+   NG++TGM+GEL N+  D+AV A TITSERE+V+DFS P+     I IL  +V    K     FL  F+  VW  ++   +    ++    R+SP+ + N       R    + + +T+  S+WF +G + Q G    PR++S R +    W F  ++++ YTANL+A LTV ++ +   S  +LA Q    Y T    S   +F                         +       W Y        MY++  +  F  +  E I +++   +A  +E+ + +Y+   +C L  +G     + YGI +   SP  +E+ L IL LQ +  LE LK +WW   + +      + GLG++ +
Sbjct:  330 LNRSQEIGVKPLSCTSPQIWQHGTS--------LMNYLRMVEYDGLTGRVEFNSKGQRTNYTLRILEKHRGGHK---EIGIWYSNNTLAMNSTSLDINVSETLANKTLIVTTILENPYVMRKDNYQDFQGNDQYEGFCVDMLRELADILKFSFKIKLVDDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTL-GISILY-RVQLGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCMRERRDMLENQ-YTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESPDDLADQTNIEYGTIHGGSTMTFFM----------------------NSRYQTYQRMWNY--------MYSKQPSV-FVKSTEEGIARVLNSKYAFLMESTMNEYHRGLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKRRWWEGSQCLKEEDHRAKGLGMENI 813          
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Match: SMESG000049467.1 (SMESG000049467.1)

HSP 1 Score: 1777.68 bits (4603), Expect = 0.000e+0
Identity = 927/930 (99.68%), Postives = 928/930 (99.78%), Query Frame = 1
Query:   28 MNVVTIHLFLLILINQTLIARSYTIVLMGEITNPFLFDSAIMGFNDNTNQPNSYIRIYNDQDDFLDQICNLNASSLDAIIDLSLNVIGSDDIGSHMDAPVVSMKEWNQYSSSEITNIPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPVFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNKCKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNVLTQKQLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPXXXXXXXXXXXXXXXXXXXXXKVKWWNSDKSVCPTVDSSAGLGLDTLXXXXXXXXXXXXXXXXXXXXEKIVAKIWGTEWAAAAGNDPTVVRPMGMMSTLNVNLGSHVSIRRASQLSGQQTLARRNYPTRSSNANIDENTNRNEKPMAIAKGGVMNSGYDNYDNPPTYSNTHM 2817
            MNVVTIHLFLLILINQTLIARSYTIVLMGEITNPFLFDSAIMGFNDNTNQPNSYIRIYNDQDDFLDQICNLNASSLDAIIDLSLNVIGSDDIGSHMDAPVVSMKEWNQYSSSEITNIPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPVFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCN CKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAI+MVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNVLTQKQLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSLQELAAQQTTLYTTQSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPLLNELNLRILILQRDRILEQLKVKWWNSDKSVCPTVDSSAGLGLDTLGGAFAFLAVGIGIAGIIFIGEKIVAKIWGTEWAAAAGNDPTVVRPMGMMSTLNVNLGSHVSIRRASQLSGQQTLARRNYPTRSSNANIDEN NRNEKPMAIAKGGVMNSGYDNYDNPPTYSNTHM
Sbjct:    1 MNVVTIHLFLLILINQTLIARSYTIVLMGEITNPFLFDSAIMGFNDNTNQPNSYIRIYNDQDDFLDQICNLNASSLDAIIDLSLNVIGSDDIGSHMDAPVVSMKEWNQYSSSEITNIPSVRPTSSDYIESVVSFINSLNSTRDSILILYSANFDASLLFPSLNSGTFIPVFMKEVNYTNTEEVMQFIKQLRVSEIILASEFDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNMCKSGSFFLFHKKIDDIPLFDKIKTINSSVSSTYRAIDMVYAYQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNVLTQKQLRILVIPEPPFVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSLQELAAQQTTLYTTQSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNSPLLNELNLRILILQRDRILEQLKVKWWNSDKSVCPTVDSSAGLGLDTLGGAFAFLAVGIGIAGIIFIGEKIVAKIWGTEWAAAAGNDPTVVRPMGMMSTLNVNLGSHVSIRRASQLSGQQTLARRNYPTRSSNANIDENPNRNEKPMAIAKGGVMNSGYDNYDNPPTYSNTHM 930          
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Match: SMESG000073692.1 (SMESG000073692.1)

HSP 1 Score: 156.762 bits (395), Expect = 7.943e-39
Identity = 127/442 (28.73%), Postives = 221/442 (50.00%), Query Frame = 1
Query: 1024 GILGQITFNLT-IQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGL------GNYNFSLNVLTQKQLRILV-IPEPPFVIKTPNNT-------FEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAF-FLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNR-LKNNEIREGEAD-GKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWGFTPNISESIKKII--EDDWALFLETPIIKYYTNRD-CQLVAVGEPF-SQRPYGIV 2283
            G+ G ++FN T  +++F+ + + E  V  + + +    WT+  GL        ++ S   L + + RI+  I  PPF+ K  ++        +EG+ +D++ ++A  +NF++   E  DG YGS+  NGT+ GMIGEL +K  D+AV  +TITS RERVVDFS P+ ++    + ++   A  K  + F F+K  + ++W  +    +G   ++  V R +P  + ++ +  N+ +E + +    F+I  S WF L A+ Q G    PRS+S R++    W F  ++++ YTANL+A LTV +++S   S ++LA Q    Y    + S  ++F   + ++ +IF                      W          ++   N   F  NIS  I K+I  + ++A  LE+ +  YY  ++ C+   VG    S + YGI 
Sbjct:  382 GLTGNVSFNSTGFRHKFT-LNIQESRVKQNLMKIGN--WTQEYGLHRIDISAEHSISGQPLRRNKTRIVTGILVPPFLSKVKDSNGKPIPGKYEGFCVDLITEIARDVNFSFIIREVEDGAYGSLV-NGTWNGMIGELISKKADLAVAPLTITSSRERVVDFSTPFMEFGLSVMFLQ---AQQKPPEIFGFMKPLSRDIWMCIAYAYLGVSVVLFMVSRFNPHEWSDKNMDTNDNKERKINTSNEFSIFNSFWFSLSAFMQQGGDLSPRSLSGRIVGGVWWFFTLIIVSSYTANLAAYLTVERMSSPIKSYEDLAKQNKIKYGVVDSGSSKEFF---LNSKIEIFK-------------------KMW----------LFMESNPEVFVKNISMGINKVINSQREYAFILESSMNDYYNLQEPCETTKVGSNLDSGKGYGIA 784          
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Match: SMESG000062485.1 (SMESG000062485.1)

HSP 1 Score: 154.836 bits (390), Expect = 1.203e-38
Identity = 130/457 (28.45%), Postives = 206/457 (45.08%), Query Frame = 1
Query: 1063 NQFSKIMVSEVTVGSSPVTVDKI-----------------------LWTRTNGLGNYNFS-----LNVLTQKQ-LRILVIPEPPFVI-----------KTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDN---GTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKLASRPGSXXXXXXXXXXXXXXXSNTSIHDYFFRMMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAWG--FTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYGIVLQNNS 2298
            N    I +  +T  S+P+TVD+                         W +TN +G          LN+   KQ LR+  I +PPFVI           K+P+  + G+ I I+ K+AE   FN+T  E  D +YG +        +TG++G L +   D+AV ++TIT +RERV+DF+ P+ +   I I+ KK  A  + +   FL   +  VW  VIA+ I   F++  + R++P+ + N       +  E     F I  SMWF +G + Q G    P++ S R+I    W F  ++++ YTANL+A LTVA++     + ++L+ Q    Y      + + +F      ++D+ T                             Y  MY  MN     F  +  E I+++   ++A  LE+   +YYT RDC L+ VG     + YGI L   S
Sbjct:   73 NSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPD-AWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLG-ISIIYKK-PAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQ--KNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFF-----EKSDLAT-----------------------------YKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGS 490          
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Match: SMESG000073268.1 (SMESG000073268.1)

HSP 1 Score: 152.14 bits (383), Expect = 1.991e-37
Identity = 147/535 (27.48%), Postives = 249/535 (46.54%), Query Frame = 1
Query:  415 SVVSFINSLNSTRDSILILYSAN---FDASLLFPSLNSGTF-IPVFMKEVNYTNTEEVMQFI--KQLRVSE--IILASEFDLVSIVINQAILSNTLNGV-YHWFVVSKDL-EIFTCNKCKSGSFFLFHKKID-DIPLFDKI-----------KTINSSVSSTYRAIEMVYA----YQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGN----------YNFSLNVLTQKQLRILVIPEPPFVIKTPNNT------FEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAF-FLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKI---FTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKL 1881
            +VV FI+S N  R  IL LY +N   F   ++F   NS    +    ++ +++ ++ V+Q+I  K  R S+  IIL  + +     I Q +     + V YH+ V   D  EI +      G  F     +D + P+ ++            K+   S +++ R  ++ Y         ++L  A+  A     +  +S D  C  S  +      + L   +  I   G+ G + FN +      KI + E  V  S  T+    W+ ++GL +           NFS N    + LR+  I  PPF+++  +        FEG+  D+V ++A+ +NF YT ++  D Q+G++  N ++ GMIGEL     D+ V  +TITS RERVVDFS P+ ++    + +K      +  +AF F+K  + ++W  +    +G   ++  V R +P+ +            E D K+   FTI  S WF L A+ Q G    PRS++ R++    W F  ++++ YTANL+A LTV ++
Sbjct:  156 AVVDFIHSENWQR--ILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVC--SPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGN--WSTSHGLTSIPRNKSDLTLVNFSKN----RTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALV-NDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLK---PDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERM 670          
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Match: SMESG000073268.1 (SMESG000073268.1)

HSP 1 Score: 152.14 bits (383), Expect = 2.550e-37
Identity = 147/535 (27.48%), Postives = 249/535 (46.54%), Query Frame = 1
Query:  415 SVVSFINSLNSTRDSILILYSAN---FDASLLFPSLNSGTF-IPVFMKEVNYTNTEEVMQFI--KQLRVSE--IILASEFDLVSIVINQAILSNTLNGV-YHWFVVSKDL-EIFTCNKCKSGSFFLFHKKID-DIPLFDKI-----------KTINSSVSSTYRAIEMVYA----YQTGQVLGVAISKAKSLNLWTPSSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSKIMVSEVTVGSSPVTVDKILWTRTNGLGN----------YNFSLNVLTQKQLRILVIPEPPFVIKTPNNT------FEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTGMIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTASTKGDQAF-FLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEIREGEADGKI---FTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYLMMAMYTANLSAQLTVAKL 1881
            +VV FI+S N  R  IL LY +N   F   ++F   NS    +    ++ +++ ++ V+Q+I  K  R S+  IIL  + +     I Q +     + V YH+ V   D  EI +      G  F     +D + P+ ++            K+   S +++ R  ++ Y         ++L  A+  A     +  +S D  C  S  +      + L   +  I   G+ G + FN +      KI + E  V  S  T+    W+ ++GL +           NFS N    + LR+  I  PPF+++  +        FEG+  D+V ++A+ +NF YT ++  D Q+G++  N ++ GMIGEL     D+ V  +TITS RERVVDFS P+ ++    + +K      +  +AF F+K  + ++W  +    +G   ++  V R +P+ +            E D K+   FTI  S WF L A+ Q G    PRS++ R++    W F  ++++ YTANL+A LTV ++
Sbjct:  156 AVVDFIHSENWQR--ILYLYDSNEALFRLRMIFEHTNSRRIDLSADARQYSFSQSDGVLQYINRKSKRNSQKHIILDLKGEESKNRIIQQMDELKKDRVDYHYLVTEMDAREIKSSFIINGGMNFTIFSPLDYNNPVLNEFIKSQWLTESSRKSYQPSSTNSQRLQKLPYEAALIVDGLELLKRALKVAVKSTRFHTNSGDQVC--SPVTNPKYCADELKPAITRIKFMGLTGNVQFNESGFRHNYKIDIIEARVKESLKTIGN--WSTSHGLTSIPRNKSDLTLVNFSKN----RTLRVSSILVPPFLMRVKDKNGKDTGEFEGFCKDLVNEIAKMLNFTYTIHQVKDDQFGALV-NDSWNGMIGELMRNEADLVVAPLTITSSRERVVDFSTPFMEFGLSVMFLK---PDDREPEAFGFMKPLSKDIWMCITFAYLGVSVVLFLVSRFNPYEW------GVDTPVEVDSKVSNEFTIFNSFWFSLSAFMQQGGDISPRSLAGRIVGGVWWFFTLIIVSSYTANLAAYLTVERM 670          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRID11.239e-4227.06glutamate ionotropic receptor delta type subunit 1... [more]
GRIK19.556e-4227.49glutamate ionotropic receptor kainate type subunit... [more]
GRIK11.093e-4127.49glutamate ionotropic receptor kainate type subunit... [more]
GRIK11.141e-4127.49glutamate ionotropic receptor kainate type subunit... [more]
GRIK31.327e-4024.13glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-72.287e-7129.04GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-72.776e-7129.04GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-72.151e-7034.60GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-43.684e-4530.64GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-49.829e-4530.64GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ir25a7.836e-6031.91gene:FBgn0031634 transcript:FBtr0336960[more]
Ir25a7.836e-6031.91gene:FBgn0031634 transcript:FBtr0289979[more]
Ir25a9.046e-6031.91gene:FBgn0031634 transcript:FBtr0336959[more]
Ir25a9.379e-6031.91gene:FBgn0031634 transcript:FBtr0332480[more]
Ir8a1.027e-5434.09gene:FBgn0052704 transcript:FBtr0071333[more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grid1b5.951e-4327.44glutamate receptor, ionotropic, delta 1b [Source:Z... [more]
grid1a2.924e-4126.91glutamate receptor, ionotropic, delta 1a [Source:Z... [more]
grid1a3.973e-4126.91glutamate receptor, ionotropic, delta 1a [Source:Z... [more]
grik54.023e-4127.43glutamate receptor, ionotropic, kainate 5 [Source:... [more]
grik1a7.237e-4127.54glutamate receptor, ionotropic, kainate 1a [Source... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK19.348e-4327.77glutamate receptor, ionotropic, kainate 1 [Source:... [more]
GRIK19.637e-4327.77glutamate receptor, ionotropic, kainate 1 [Source:... [more]
GRIK11.156e-4227.57glutamate receptor, ionotropic, kainate 1 [Source:... [more]
GRIK11.176e-4228.29glutamate receptor, ionotropic, kainate 1 [Source:... [more]
GRIK11.351e-4228.29glutamate receptor, ionotropic, kainate 1 [Source:... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grik11.617e-4324.33glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grid11.714e-4326.69glutamate receptor, ionotropic, delta 1 [Source:MG... [more]
Grik11.886e-4327.89glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik11.948e-4324.33glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik12.349e-4327.89glutamate receptor, ionotropic, kainate 1 [Source:... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E9NA96|IR25A_DROME9.401e-5931.91Ionotropic receptor 25a OS=Drosophila melanogaster... [more]
sp|Q62640|GRID1_RAT2.058e-4326.88Glutamate receptor ionotropic, delta-1 OS=Rattus n... [more]
sp|Q61627|GRID1_MOUSE1.199e-4226.69Glutamate receptor ionotropic, delta-1 OS=Mus musc... [more]
sp|Q9ULK0|GRID1_HUMAN5.952e-4227.06Glutamate receptor ionotropic, delta-1 OS=Homo sap... [more]
sp|P22756|GRIK1_RAT1.118e-4026.74Glutamate receptor ionotropic, kainate 1 OS=Rattus... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMH10.000e+0100.00Uncharacterized protein OS=Schmidtea mediterranea ... [more]
Q8MMK30.000e+082.45DjGluR1 OS=Dugesia japonica OX=6161 GN=DjGluR1 PE=... [more]
A0A267H6T20.000e+042.05Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267G8320.000e+041.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DJA00.000e+041.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRID11.183e-4327.89glutamate ionotropic receptor delta type subunit 1... [more]
ENSAMXT00000004586.23.692e-4127.58glutamate receptor ionotropic, kainate 2-like [Sou... [more]
grid1a7.528e-4131.17glutamate receptor, ionotropic, delta 1a [Source:Z... [more]
grik1a1.068e-4026.52glutamate receptor ionotropic, kainate 1 [Source:N... [more]
grik1a1.143e-4026.52glutamate receptor ionotropic, kainate 1 [Source:N... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria1b9.423e-2928.37glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000000621.16.276e-2832.75pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 ... [more]
ENSPMAT00000005084.13.566e-2727.07pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000010600.13.165e-2526.52pep scaffold:Pmarinus_7.0:GL477914:43885:60233:1 g... [more]
ENSPMAT00000010716.14.914e-2331.53pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412912.082e-3726.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355454.286e-2925.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466334.284e-2726.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302033.220e-2625.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326233.279e-2428.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grid1a3.788e-4526.95glutamate receptor ionotropic, delta-1 [Source:NCB... [more]
GRID11.079e-4227.19glutamate receptor ionotropic, delta-1 [Source:NCB... [more]
grik45.624e-4226.98glutamate ionotropic receptor kainate type subunit... [more]
grik51.016e-4026.28glutamate ionotropic receptor kainate type subunit... [more]
grik52.248e-4026.28glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049467.10.000e+099.68SMESG000049467.1[more]
SMESG000073692.17.943e-3928.73SMESG000073692.1[more]
SMESG000062485.11.203e-3828.45SMESG000062485.1[more]
SMESG000073268.11.991e-3727.48SMESG000073268.1[more]
SMESG000073268.12.550e-3727.48SMESG000073268.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001387 ID=SMED30001387|Name=Glutamate receptor ionotropic|organism=Schmidtea mediterranea sexual|type=transcript|length=2939bp
TAAAGAAAATTGAGATTGTTTCAAATCATGAATGTGGTTACAATACACCT
GTTTCTCTTGATCCTGATCAACCAAACTCTGATTGCTAGAAGTTATACTA
TAGTGCTCATGGGGGAGATTACAAATCCTTTCCTATTCGATTCCGCAATA
ATGGGATTCAATGACAATACAAATCAACCGAACTCCTACATTCGGATATA
CAACGACCAAGATGATTTCCTGGATCAAATTTGTAACTTAAACGCTTCGT
CCCTTGATGCAATAATTGACCTCAGTCTCAATGTTATCGGAAGCGACGAC
ATTGGCAGTCACATGGATGCTCCGGTCGTGTCTATGAAGGAATGGAATCA
GTATTCGAGTTCAGAAATCACAAATATCCCTTCCGTGAGACCAACCTCGA
GTGACTACATTGAGTCTGTTGTCAGTTTTATCAACAGCCTAAATTCAACA
AGAGACTCTATCCTTATTCTTTACTCTGCAAATTTTGACGCTAGCCTATT
GTTTCCATCATTGAATTCCGGGACCTTCATTCCGGTATTTATGAAAGAAG
TGAATTACACCAATACTGAAGAAGTTATGCAATTTATTAAGCAACTTCGA
GTTTCCGAGATTATTTTGGCCTCAGAATTTGATCTCGTTAGCATAGTTAT
AAATCAGGCCATATTATCAAACACCCTCAACGGGGTATATCACTGGTTTG
TGGTCAGCAAGGATCTTGAAATCTTTACCTGTAATAAGTGCAAATCTGGA
AGTTTCTTTCTCTTTCATAAAAAGATTGATGATATTCCACTTTTTGACAA
GATCAAGACCATCAACAGCTCGGTGTCATCCACTTATAGAGCAATTGAAA
TGGTTTATGCGTACCAAACTGGTCAGGTTCTTGGAGTAGCCATTTCGAAA
GCAAAATCGCTAAACCTATGGACACCTTCCTCATCCGATTTCAGTTGTTG
GAATAGTTCAACATCTACGAACATGGTCAGATACAATATGTTGATGGAGT
TAATGAAAAACATTTCAATTCCAGGAATTCTTGGACAAATTACTTTTAAT
CTCACTATCCAAAATCAGTTTTCAAAGATAATGGTATCCGAAGTGACTGT
TGGTTCAAGCCCGGTGACCGTCGACAAGATTTTGTGGACGAGGACAAACG
GATTGGGAAACTACAATTTTTCACTGAACGTTCTCACTCAAAAACAATTA
CGAATTTTGGTCATTCCAGAACCTCCATTTGTAATTAAAACACCGAACAA
TACTTTTGAAGGTTACAGCATTGATATTGTTGCAAAGTTGGCGGAATATA
TGAATTTCAACTATACGTTCTATGAACAAGTGGATGGACAATATGGATCA
GTGACAGACAATGGGACCTTTACGGGAATGATAGGAGAACTCGCCAATAA
GAACTACGATATGGCCGTTGGAGCGATTACTATAACGTCAGAAAGAGAAA
GAGTTGTGGATTTCAGTATTCCTTACTACGATTATGCAGCCATTCAAATA
TTAATGAAAAAGGTTACAGCTAGTACGAAAGGAGATCAAGCGTTCTTTTT
GAAAGCATTTACTTGGGAAGTATGGGCAACAGTGATAGCGACCATAATAG
GAACTGGATTTTTAATATGTTTCGTAGACAGAGTCAGCCCGTTCAGTTTC
CAAAACAGATTAAAAAACAATGAGATTCGAGAAGGAGAAGCCGATGGTAA
GATATTTACAATTAAAGAATCAATGTGGTTCGTTCTCGGAGCTTATACTC
AAGCAGGAGAGAGTTTTGATCCTCGTTCAATCTCATGTCGTGTAATTGTA
GTTGGGCTATGGTTGTTTGCGTACCTAATGATGGCCATGTACACTGCTAA
CTTATCCGCTCAATTGACTGTCGCAAAACTAGCAAGTAGACCAGGATCAT
TACAAGAACTAGCTGCCCAGCAAACTACGCTATACACCACTCAGAGCAAC
ACTTCAATTCACGACTATTTCTTCAGAATGATGAAAGCAGAAGCAGATAT
CTTCACTTTCTGGACGGAAAAGGGTATAAATAACCTCGATAAACCGAAAG
AAGCTGCTCTGATGTCAACATGGAAATATCCGATTGAAGAAAGATATACA
AATATGTACAATCGAATGAATGCTTGGGGATTCACTCCAAATATTTCTGA
AAGTATCAAAAAGATAATTGAGGATGATTGGGCATTATTCCTTGAAACTC
CAATCATCAAGTACTACACAAACCGTGATTGCCAACTCGTTGCAGTCGGG
GAACCCTTTAGCCAGCGTCCGTACGGAATAGTCCTTCAGAATAATTCTCC
ACTTCTCAATGAATTGAATTTAAGGATACTCATACTGCAGCGGGACCGAA
TACTCGAACAGTTGAAAGTCAAATGGTGGAACAGCGATAAATCCGTATGT
CCCACAGTAGATTCTAGCGCCGGACTCGGCTTGGATACTCTCGGTGGAGC
CTTTGCATTCTTAGCTGTTGGTATTGGAATAGCTGGAATTATATTCATTG
GCGAGAAAATCGTCGCAAAAATTTGGGGCACCGAATGGGCAGCAGCAGCG
GGAAATGATCCAACTGTTGTCCGCCCAATGGGGATGATGTCAACATTGAA
TGTAAATCTTGGGAGCCATGTTTCTATTCGGAGAGCAAGTCAGCTATCGG
GACAGCAGACATTGGCAAGAAGAAATTATCCAACTCGTTCATCAAATGCT
AACATCGATGAAAATACGAATAGAAATGAAAAGCCCATGGCAATTGCCAA
GGGAGGGGTAATGAATTCCGGATATGATAATTATGACAACCCACCAACAT
ATAGCAATACTCACATGTGAAAAATAGCTTAATATTAAACTGTTTGCACA
ACGATTTTTGTAAAATGCACTTTTTCATGATGAAAAACTTTGTTTCCCAT
AATTTACTTTTTCTGAATGAATAGTGTTATAGAAATAGT
back to top

protein sequence of SMED30001387-orf-1

>SMED30001387-orf-1 ID=SMED30001387-orf-1|Name=SMED30001387-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=931bp
MNVVTIHLFLLILINQTLIARSYTIVLMGEITNPFLFDSAIMGFNDNTNQ
PNSYIRIYNDQDDFLDQICNLNASSLDAIIDLSLNVIGSDDIGSHMDAPV
VSMKEWNQYSSSEITNIPSVRPTSSDYIESVVSFINSLNSTRDSILILYS
ANFDASLLFPSLNSGTFIPVFMKEVNYTNTEEVMQFIKQLRVSEIILASE
FDLVSIVINQAILSNTLNGVYHWFVVSKDLEIFTCNKCKSGSFFLFHKKI
DDIPLFDKIKTINSSVSSTYRAIEMVYAYQTGQVLGVAISKAKSLNLWTP
SSSDFSCWNSSTSTNMVRYNMLMELMKNISIPGILGQITFNLTIQNQFSK
IMVSEVTVGSSPVTVDKILWTRTNGLGNYNFSLNVLTQKQLRILVIPEPP
FVIKTPNNTFEGYSIDIVAKLAEYMNFNYTFYEQVDGQYGSVTDNGTFTG
MIGELANKNYDMAVGAITITSERERVVDFSIPYYDYAAIQILMKKVTAST
KGDQAFFLKAFTWEVWATVIATIIGTGFLICFVDRVSPFSFQNRLKNNEI
REGEADGKIFTIKESMWFVLGAYTQAGESFDPRSISCRVIVVGLWLFAYL
MMAMYTANLSAQLTVAKLASRPGSLQELAAQQTTLYTTQSNTSIHDYFFR
MMKAEADIFTFWTEKGINNLDKPKEAALMSTWKYPIEERYTNMYNRMNAW
GFTPNISESIKKIIEDDWALFLETPIIKYYTNRDCQLVAVGEPFSQRPYG
IVLQNNSPLLNELNLRILILQRDRILEQLKVKWWNSDKSVCPTVDSSAGL
GLDTLGGAFAFLAVGIGIAGIIFIGEKIVAKIWGTEWAAAAGNDPTVVRP
MGMMSTLNVNLGSHVSIRRASQLSGQQTLARRNYPTRSSNANIDENTNRN
EKPMAIAKGGVMNSGYDNYDNPPTYSNTHM*
back to top
Aliases
The feature 'Glutamate receptor ionotropic' has the following synonyms
Synonym
Dj-GluR1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001320Iontro_rcpt
IPR019594Glu/Gly-bd
IPR028082Peripla_BP_I
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0098794postsynapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 400..457
e-value: 1.4E-20
score: 84.3
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 390..495
e-value: 3.9E-30
score: 104.4
IPR001320Ionotropic glutamate receptorSMARTSM00079GluR_14coord: 390..786
e-value: 3.2E-42
score: 156.3
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 512..816
e-value: 1.2E-29
score: 103.1
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 506..658
e-value: 8.2E-31
score: 108.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 123..354
e-value: 7.4E-9
score: 37.3
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 687..746
e-value: 9.0E-22
score: 79.6
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 388..505
e-value: 1.8E-38
score: 133.5
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 747..785
e-value: 9.0E-22
score: 79.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 91..349
e-value: 7.4E-9
score: 37.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 872..897
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 872..900
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 73..823
NoneNo IPR availablePANTHERPTHR18966:SF411IONOTROPIC RECEPTOR 25Acoord: 73..823
NoneNo IPR availableCDDcd13717PBP2_iGluR_putativecoord: 388..785
e-value: 1.39275E-177
score: 516.466
NoneNo IPR availableCDDcd06351PBP1_iGluR_N_LIVBP_likecoord: 51..286
e-value: 7.15413E-7
score: 50.1997
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.741
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 389..787
NoneNo IPR availableTMHMMTMhelixcoord: 589..611
NoneNo IPR availableTMHMMTMhelixcoord: 806..825
NoneNo IPR availableTMHMMTMhelixcoord: 511..533
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 94..341