Zinc finger FYVE domain-containing protein

Overview
NameZinc finger FYVE domain-containing protein
Smed IDSMED30001380
Length (bp)2006
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger FYVE domain-containing protein (SMED30001380) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger FYVE domain-containing protein (SMED30001380) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger FYVE domain-containing protein (SMED30001380) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger FYVE domain-containing protein (SMED30001380) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001380

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001380SMESG000046936.1 Contig4600GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001380SMESG000014968.1 Contig4600GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30001380SMESG000014968.1 dd_Smed_v4_4344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001380SMESG000014968.1 dd_Smed_v4_4344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30001380SMESG000014968.1 dd_Smed_v4_4344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001380SMESG000014968.1 dd_Smed_v4_4344_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Human
Match: FGD2 (FYVE, RhoGEF and PH domain containing 2 [Source:HGNC Symbol;Acc:HGNC:3664])

HSP 1 Score: 97.4413 bits (241), Expect = 2.132e-20
Identity = 91/345 (26.38%), Postives = 144/345 (41.74%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVN----TLFSNSKPPAI-----------LGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKD-----LNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRS 1891
            S   + +  V K S + N  + R L LF++ L   +P     G   +VR  + +  M+V     ++ P    + GK+       TLE+      E I    SWM+  + AI  +     T  + ++ P             LG   P W +D     C    C   F   + RRHHCRA G + C  CS YR +LK+  +  +RVC  CY  LT N   + + K+D     L         + +  S+L++   K  K+    +C + ++DP  L +Y   +D      I LLG ++  G      P   P  F ++   +   Y FKA   E    WV+ ++R+
Sbjct:  317 SNTLLREGPVLKISFRRNDPMERYLFLFNNMLLYCVPRVIQVGAQFQVRTRIDVAGMKVRELMDAEFPHSFLVSGKQ------RTLELQARSQEEMI----SWMQAFQAAIDQIEKRNETFKAAAQGPEGDIQEQELQSEELGLRAPQWVRDKMVTMC--MRCQEPFNALTRRRHHCRACGYVVCARCSDYRAELKYDDNRPNRVCLHCYAFLTGNV--LPEAKEDKRRGILEKGSSATPDQSLMCSFLQLIGDKWGKSGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVTVG------PQGDPRVFQLQQSGQL--YTFKAETEELKGRWVKAMERA 639          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Human
Match: FGD4 (FYVE, RhoGEF and PH domain containing 4 [Source:HGNC Symbol;Acc:HGNC:19125])

HSP 1 Score: 85.8853 bits (211), Expect = 1.002e-16
Identity = 76/299 (25.42%), Postives = 131/299 (43.81%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELI----------KKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRK-TRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPN 1780
            S   I +  + K ++++ +   R L LF++ L   +P  +  G    VR  + +  M++      + P    + GKE       TLE+  +   +    +K+  E I          + AI   N + S     A LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS Y+ +L++     S+VC  CY+I++  +D   + +K +  +   + +   V  S+L+   M+  K + + +C + K+DP  L +Y   +D      I LLG  +     S   P+
Sbjct:  327 SNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKFTVRTRVGIDGMKIVETQNEEYPHTFQVSGKE------RTLELQASSAQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDIHSEVST-AELGKRAPRWIRDNEVTMC--MKCKEPFNALTRRRHHCRACGYVVCWKCSDYKAQLEYDGGKLSKVCKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQY--MEKSKPWQKAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDEMPRSADLPH 614          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Human
Match: FGD4 (FYVE, RhoGEF and PH domain containing 4 [Source:HGNC Symbol;Acc:HGNC:19125])

HSP 1 Score: 85.5001 bits (210), Expect = 1.344e-16
Identity = 76/299 (25.42%), Postives = 131/299 (43.81%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELI----------KKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRK-TRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPN 1780
            S   I +  + K ++++ +   R L LF++ L   +P  +  G    VR  + +  M++      + P    + GKE       TLE+  +   +    +K+  E I          + AI   N + S     A LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS Y+ +L++     S+VC  CY+I++  +D   + +K +  +   + +   V  S+L+   M+  K + + +C + K+DP  L +Y   +D      I LLG  +     S   P+
Sbjct:  420 SNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKFTVRTRVGIDGMKIVETQNEEYPHTFQVSGKE------RTLELQASSAQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDIHSEVST-AELGKRAPRWIRDNEVTMC--MKCKEPFNALTRRRHHCRACGYVVCWKCSDYKAQLEYDGGKLSKVCKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQY--MEKSKPWQKAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDEMPRSADLPH 707          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Human
Match: FGD4 (FYVE, RhoGEF and PH domain containing 4 [Source:HGNC Symbol;Acc:HGNC:19125])

HSP 1 Score: 85.1149 bits (209), Expect = 1.924e-16
Identity = 76/299 (25.42%), Postives = 131/299 (43.81%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELI----------KKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRK-TRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPN 1780
            S   I +  + K ++++ +   R L LF++ L   +P  +  G    VR  + +  M++      + P    + GKE       TLE+  +   +    +K+  E I          + AI   N + S     A LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS Y+ +L++     S+VC  CY+I++  +D   + +K +  +   + +   V  S+L+   M+  K + + +C + K+DP  L +Y   +D      I LLG  +     S   P+
Sbjct:  532 SNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKFTVRTRVGIDGMKIVETQNEEYPHTFQVSGKE------RTLELQASSAQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDIHSEVST-AELGKRAPRWIRDNEVTMC--MKCKEPFNALTRRRHHCRACGYVVCWKCSDYKAQLEYDGGKLSKVCKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQY--MEKSKPWQKAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDEMPRSADLPH 819          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Human
Match: FGD4 (FYVE, RhoGEF and PH domain containing 4 [Source:HGNC Symbol;Acc:HGNC:19125])

HSP 1 Score: 84.7297 bits (208), Expect = 2.400e-16
Identity = 76/299 (25.42%), Postives = 131/299 (43.81%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELI----------KKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRK-TRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPN 1780
            S   I +  + K ++++ +   R L LF++ L   +P  +  G    VR  + +  M++      + P    + GKE       TLE+  +   +    +K+  E I          + AI   N + S     A LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS Y+ +L++     S+VC  CY+I++  +D   + +K +  +   + +   V  S+L+   M+  K + + +C + K+DP  L +Y   +D      I LLG  +     S   P+
Sbjct:  505 SNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKFTVRTRVGIDGMKIVETQNEEYPHTFQVSGKE------RTLELQASSAQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDIHSEVST-AELGKRAPRWIRDNEVTMC--MKCKEPFNALTRRRHHCRACGYVVCWKCSDYKAQLEYDGGKLSKVCKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQY--MEKSKPWQKAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDEMPRSADLPH 792          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Celegans
Match: hgrs-1 (Hepatocyte Growth factor-Regulated TK Substrate (HRS) family [Source:UniProtKB/TrEMBL;Acc:Q17796])

HSP 1 Score: 59.6918 bits (143), Expect = 4.847e-9
Identity = 34/97 (35.05%), Postives = 53/97 (54.64%), Query Frame = 2
Query: 1301 LGESEPVWQKDNATGYCNG---FNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKL-KFGKSNTSRVCDLCY-KILTENSDQVAQYKKDLNSVFDRK 1576
            L E++ ++    A  + +G   + C S F+   R+HHCRA G I+C+ CSS  + L +FG     RVC+ CY K + E  ++    KK L++   RK
Sbjct:  142 LKEADAMFMAQVAPEWADGPECYRCRSVFSVFTRKHHCRACGQIFCDKCSSRELALPQFGIEKEVRVCETCYEKKVAEVKERYPAVKKQLDAAHGRK 238          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Celegans
Match: hgrs-1 (Hepatocyte Growth factor-Regulated TK Substrate (HRS) family [Source:UniProtKB/TrEMBL;Acc:Q17796])

HSP 1 Score: 59.6918 bits (143), Expect = 4.847e-9
Identity = 34/97 (35.05%), Postives = 53/97 (54.64%), Query Frame = 2
Query: 1301 LGESEPVWQKDNATGYCNG---FNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKL-KFGKSNTSRVCDLCY-KILTENSDQVAQYKKDLNSVFDRK 1576
            L E++ ++    A  + +G   + C S F+   R+HHCRA G I+C+ CSS  + L +FG     RVC+ CY K + E  ++    KK L++   RK
Sbjct:  142 LKEADAMFMAQVAPEWADGPECYRCRSVFSVFTRKHHCRACGQIFCDKCSSRELALPQFGIEKEVRVCETCYEKKVAEVKERYPAVKKQLDAAHGRK 238          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Celegans
Match: tag-77 (pep chromosome:WBcel235:IV:8503493:8509398:-1 gene:WBGene00006450.1 transcript:C28C12.10e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-77)

HSP 1 Score: 53.1434 bits (126), Expect = 6.937e-7
Identity = 31/87 (35.63%), Postives = 40/87 (45.98%), Query Frame = 2
Query: 1250 AIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRI--KLKFGKSNTSRVCDLCY 1504
              G V    S  KPP+ +   +PVW  DN +  C    C ++F   NRRHHCR  G + C+ C       K  F K N   VC  C+
Sbjct:  593 GFGEVTRNGSGKKPPSEM--IKPVWLPDNISNECLMEGCSTEFNIINRRHHCRDCGWLICKFCKGQAPLSKYDFTKQN---VCSECF 674          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Celegans
Match: tag-77 (pep chromosome:WBcel235:IV:8503493:8509398:-1 gene:WBGene00006450.1 transcript:C28C12.10f.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-77)

HSP 1 Score: 53.1434 bits (126), Expect = 6.992e-7
Identity = 31/87 (35.63%), Postives = 40/87 (45.98%), Query Frame = 2
Query: 1250 AIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRI--KLKFGKSNTSRVCDLCY 1504
              G V    S  KPP+ +   +PVW  DN +  C    C ++F   NRRHHCR  G + C+ C       K  F K N   VC  C+
Sbjct:  593 GFGEVTRNGSGKKPPSEM--IKPVWLPDNISNECLMEGCSTEFNIINRRHHCRDCGWLICKFCKGQAPLSKYDFTKQN---VCSECF 674          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Celegans
Match: tag-77 (pep chromosome:WBcel235:IV:8503493:8508553:-1 gene:WBGene00006450.1 transcript:C28C12.10c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-77)

HSP 1 Score: 52.7582 bits (125), Expect = 8.269e-7
Identity = 31/87 (35.63%), Postives = 40/87 (45.98%), Query Frame = 2
Query: 1250 AIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRI--KLKFGKSNTSRVCDLCY 1504
              G V    S  KPP+ +   +PVW  DN +  C    C ++F   NRRHHCR  G + C+ C       K  F K N   VC  C+
Sbjct:  659 GFGEVTRNGSGKKPPSEM--IKPVWLPDNISNECLMEGCSTEFNIINRRHHCRDCGWLICKFCKGQAPLSKYDFTKQN---VCSECF 740          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Fly
Match: Sara (gene:FBgn0026369 transcript:FBtr0071641)

HSP 1 Score: 80.1073 bits (196), Expect = 4.441e-15
Identity = 37/79 (46.84%), Postives = 44/79 (55.70%), Query Frame = 2
Query: 1283 SKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTE 1519
            S P A LG+  P+W  DN  G C    C  +FT   RRHHCRA G + C  C S R +L+F     SRVC  CY IL+E
Sbjct:  515 SDPHANLGKVPPIWVPDNMAGQC--MQCQQKFTMIKRRHHCRACGKVLCSVCCSQRFRLEFATEPESRVCVQCYMILSE 591          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Fly
Match: Hrs (gene:FBgn0031450 transcript:FBtr0089749)

HSP 1 Score: 59.3066 bits (142), Expect = 8.306e-9
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 2
Query: 1301 LGESEPVWQKDNATGYCNG---FNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKL-KFGKSNTSRVCDLCYKIL 1513
            L E++ ++  D A  + +G     C  +FTF+NR+HHCR  G ++C  C++ +  L K+G     RVCD C+  L
Sbjct:   30 LREADAMFTADTAPNWADGRVCHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAAL 104          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Fly
Match: Hrs (gene:FBgn0031450 transcript:FBtr0089750)

HSP 1 Score: 59.3066 bits (142), Expect = 8.467e-9
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 2
Query: 1301 LGESEPVWQKDNATGYCNG---FNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKL-KFGKSNTSRVCDLCYKIL 1513
            L E++ ++  D A  + +G     C  +FTF+NR+HHCR  G ++C  C++ +  L K+G     RVCD C+  L
Sbjct:  143 LREADAMFTADTAPNWADGRVCHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAAL 217          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Fly
Match: Hrs (gene:FBgn0031450 transcript:FBtr0089751)

HSP 1 Score: 59.3066 bits (142), Expect = 8.467e-9
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 2
Query: 1301 LGESEPVWQKDNATGYCNG---FNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKL-KFGKSNTSRVCDLCYKIL 1513
            L E++ ++  D A  + +G     C  +FTF+NR+HHCR  G ++C  C++ +  L K+G     RVCD C+  L
Sbjct:  143 LREADAMFTADTAPNWADGRVCHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAAL 217          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Fly
Match: rush (gene:FBgn0025381 transcript:FBtr0070259)

HSP 1 Score: 55.4546 bits (132), Expect = 6.381e-8
Identity = 34/98 (34.69%), Postives = 46/98 (46.94%), Query Frame = 2
Query: 1223 KSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCL-SQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKIL 1513
            + WM  I K +  +  L  + K P  +     VW  D     C   +C  +QFTF  RRHHCR  G + C  CS+ +  L    +   RVCD CY+ L
Sbjct:  120 QEWMAHINKCVEDL--LRKSGKKP--VENHAAVWVPDTDASVC--MHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKALRVCDACYERL 211          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Zebrafish
Match: fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:ZFIN;Acc:ZDB-GENE-041210-200])

HSP 1 Score: 91.2781 bits (225), Expect = 2.135e-18
Identity = 98/359 (27.30%), Postives = 154/359 (42.90%), Query Frame = 2
Query:  893 HHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVN----TLFSN--------SKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQ----VAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCEL-DKEDPFLKLYRNFEDKV-----RSFDIILLGMKIATG---KNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSL 1894
            HHE+ +  GR         F+ + T+ K S K      R+  LF+D L    P  + Q   +V   LSL  M+VSK P + + + +    LNI ++E +             W+E I  AI        + FS+        S     LG   P+W  D  T  C    C  +FT + RRHHCRA G + C++CSS +  L++ K+  +RVCD CY  L    DQ     +   +     F RK +K +  +  +V+      + S Y       + P+ +L+   ++KV      S D+  L  +   G   +  K  P  K  +F + H +    Y+F+A D      W+E  Q ++
Sbjct:  978 HHEI-VQPGRV--------FLKEGTLMKLSRK--VMQPRMFFLFNDILLYTTPVQSGQ--YKVNSMLSLAGMKVSK-PSQEAYQNE----LNIESVERSFILSANSATERDEWLEAIATAIDDYTRKKISFFSSRSQELEGISDDGLPLGSKAPIWIPDLRTTMC--MICTCEFTLTWRRHHCRACGKVVCQACSSNKFYLEYLKNQLARVCDHCYIKLQHKGDQSNVTFSPSGRGSTFAFSRKQKK-IPSALKEVSANTENSSMSGYLHRSKGHKKPWKRLWFVIKNKVLYTYAASEDVAALESQPLLGFFLREEKTGPAQK-LQFKLYHKNTLY-YIFRAEDIPTAQRWIEAFQEAM 1313          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Zebrafish
Match: fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:ZFIN;Acc:ZDB-GENE-041210-200])

HSP 1 Score: 90.5077 bits (223), Expect = 2.941e-18
Identity = 98/359 (27.30%), Postives = 154/359 (42.90%), Query Frame = 2
Query:  893 HHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVN----TLFSN--------SKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQ----VAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCEL-DKEDPFLKLYRNFEDKV-----RSFDIILLGMKIATG---KNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSL 1894
            HHE+ +  GR         F+ + T+ K S K      R+  LF+D L    P  + Q   +V   LSL  M+VSK P + + + +    LNI ++E +             W+E I  AI        + FS+        S     LG   P+W  D  T  C    C  +FT + RRHHCRA G + C++CSS +  L++ K+  +RVCD CY  L    DQ     +   +     F RK +K +  +  +V+      + S Y       + P+ +L+   ++KV      S D+  L  +   G   +  K  P  K  +F + H +    Y+F+A D      W+E  Q ++
Sbjct:  926 HHEI-VQPGRV--------FLKEGTLMKLSRK--VMQPRMFFLFNDILLYTTPVQSGQ--YKVNSMLSLAGMKVSK-PSQEAYQNE----LNIESVERSFILSANSATERDEWLEAIATAIDDYTRKKISFFSSRSQELEGISDDGLPLGSKAPIWIPDLRTTMC--MICTCEFTLTWRRHHCRACGKVVCQACSSNKFYLEYLKNQLARVCDHCYIKLQHKGDQSNVTFSPSGRGSTFAFSRKQKK-IPSALKEVSANTENSSMSGYLHRSKGHKKPWKRLWFVIKNKVLYTYAASEDVAALESQPLLGFFLREEKTGPAQK-LQFKLYHKNTLY-YIFRAEDIPTAQRWIEAFQEAM 1261          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Zebrafish
Match: fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:ZFIN;Acc:ZDB-GENE-041210-200])

HSP 1 Score: 89.3521 bits (220), Expect = 7.263e-18
Identity = 98/359 (27.30%), Postives = 154/359 (42.90%), Query Frame = 2
Query:  893 HHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVN----TLFSN--------SKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQ----VAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCEL-DKEDPFLKLYRNFEDKV-----RSFDIILLGMKIATG---KNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSL 1894
            HHE+ +  GR         F+ + T+ K S K      R+  LF+D L    P  + Q   +V   LSL  M+VSK P + + + +    LNI ++E +             W+E I  AI        + FS+        S     LG   P+W  D  T  C    C  +FT + RRHHCRA G + C++CSS +  L++ K+  +RVCD CY  L    DQ     +   +     F RK +K +  +  +V+      + S Y       + P+ +L+   ++KV      S D+  L  +   G   +  K  P  K  +F + H +    Y+F+A D      W+E  Q ++
Sbjct:  953 HHEI-VQPGRV--------FLKEGTLMKLSRK--VMQPRMFFLFNDILLYTTPVQSGQ--YKVNSMLSLAGMKVSK-PSQEAYQNE----LNIESVERSFILSANSATERDEWLEAIATAIDDYTRKKISFFSSRSQELEGISDDGLPLGSKAPIWIPDLRTTMC--MICTCEFTLTWRRHHCRACGKVVCQACSSNKFYLEYLKNQLARVCDHCYIKLQHKGDQSNVTFSPSGRGSTFAFSRKQKK-IPSALKEVSANTENSSMSGYLHRSKGHKKPWKRLWFVIKNKVLYTYAASEDVAALESQPLLGFFLREEKTGPAQK-LQFKLYHKNTLY-YIFRAEDIPTAQRWIEAFQEAM 1288          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Zebrafish
Match: fgd5b (FYVE, RhoGEF and PH domain containing 5b [Source:ZFIN;Acc:ZDB-GENE-130925-3])

HSP 1 Score: 81.2629 bits (199), Expect = 6.902e-16
Identity = 86/342 (25.15%), Postives = 148/342 (43.27%), Query Frame = 2
Query:  950 FISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDE-----VSIKGKE-GCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTEN--SDQVAQYKKDLNSVFDR-------KTRKGVKLSWLKVADMKSPKTYSEYFCELDK----------EDPFLKLYRNFEDKVRSFDIILLGMKI---ATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRS 1891
            F+ + T+ K S K   +  R L L +D +    P  +  G  R+   L L  M+VSK P E     + I+ K+    L+ ++      ++   + M ++ ++L   +   V++      P   LGE+ P     +    C   NC S F+ +NRRHHC A G + C  C   +  LK+ K+  ++VCD CY  L +N  +  +    + L++VF         ++RKG +L++ +V   +   + +   C   K          +D  L  Y   E++V    + LLG  +   A G++S +    K   F          Y F+A DS     WV  ++ +
Sbjct:   67 FVKEGTLMKVSRK--CKQPRHLFLMNDIMLYTYPQQD--GKYRLINRLPLAGMKVSKPPMESAQSAIKIEVKDISITLSASSCIERDGWF---VTMNRTLVDLGSASGDPVDSFELVESPEKCLGENAPPLLSVSQVTVC--MNCPSHFSLTNRRHHCHACGKVVCRDCCRNKFPLKYMKNRRAKVCDHCYTELRKNDVATVIEGSSRPLSAVFQNIHPSSLWRSRKG-QLTFNQVTGSEGVMSGTLQRCRNSKRSWRSLWFLLKDKVLYTYPQPEERVACETLPLLGFSVRSEAEGESSVFQLYHKSTLF----------YTFRAQDSHTAQRWVNAMEEA 388          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Zebrafish
Match: fgd4a (FYVE, RhoGEF and PH domain containing 4a [Source:ZFIN;Acc:ZDB-GENE-050420-347])

HSP 1 Score: 82.0333 bits (201), Expect = 1.083e-15
Identity = 87/365 (23.84%), Postives = 154/365 (42.19%), Query Frame = 2
Query:  515 LGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNS---KWIVQLNKTNVKCQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQDQEIFIKTHH-----ELNLLIGRSV-VPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRVSKI-----PDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPP--------AILGESEPVWQKDNATGYC----NGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSD 1528
            +GDI  +   L P L ++ E   + +     L Q+   S   K I+     +++ Q  C       NL+L+         +   E++++ + K      PE+   R+ +  L  I ++         KT +     E+  ++G    +   S   I +  + K ++++ + + R L LF++ L   +P  +  G    VR  + +  M V +      P    + GKE       TLE+  +   +  + +K++ E I  ++    T  S  K          + LG+  P W +DN    C     GFN +++     RRHHCRA G + C  CS Y+  L++  +  S+VC  CY ILT  +D
Sbjct:  248 IGDILQK---LTPFLKMYAEYVRNFDHAMDLLKQWIDRSPPFKAII----LDIQSQEVCG------NLTLQHHMLEPVQRVPRYEMLLKDYLKKLP---PEHMDRRDAEKSLEIIGMAATHSNTAIRKTENLKKLLEIYEMLGEEEDIVNPSNELIKEGHILKLAARNTSAMDRYLFLFNNMLLYCVPKFSLVGQKFTVRTRIGIEGMNVKETFNEDYPHTFQVSGKE------RTLELQASSKLDKESWIKAFTETIDISLQKNETFKSAIKDTEEASDLNISELGKRAPRWIRDNEVTMCMKCKEGFNAITR-----RRHHCRACGYVVCWKCSDYKATLEYDGNKISKVCKHCYFILTGRTD 585          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Xenopus
Match: mc3r (melanocortin 3 receptor [Source:Xenbase;Acc:XB-GENE-986713])

HSP 1 Score: 85.1149 bits (209), Expect = 2.239e-16
Identity = 65/220 (29.55%), Postives = 103/220 (46.82%), Query Frame = 2
Query:  893 HHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAI-------------GSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKIL 1513
            HHE+ +  GR         F+ + T+ K S K      R+  LF+D L    P  +  G+ ++   LSL  M+V K P + + + +    LNI ++E +        +    W+E I  AI              S+       K    LG + P+W  D     C    C S+FT + RRHHCRA G I C++CS+ +  L++ K++ +RVCD C+++L
Sbjct:  997 HHEI-VQPGRV--------FLKEGTLMKLSRK--VMQPRMFYLFNDALLYTTPVQS--GMYKLNNMLSLAGMKVRK-PTQEAYQNE----LNIESVERSFILSASSASERDDWLEAISLAIEEYAKKKITFNPTKSLEEADPGEKEDCTLGSTAPIWIPDGRVTMC--MICTSEFTLTWRRHHCRACGKIICQACSTNKHSLEYLKNHLARVCDRCFQVL 1196          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Xenopus
Match: ZFYVE9 (zinc finger FYVE-type containing 9 [Source:NCBI gene;Acc:100496662])

HSP 1 Score: 77.411 bits (189), Expect = 5.714e-14
Identity = 35/88 (39.77%), Postives = 50/88 (56.82%), Query Frame = 2
Query: 1283 SKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYK 1546
            SKP   LGE  PVW  D+    C    C ++FTF+ RRHHCRA G ++C +C S + KL++     +RVC +C+ +L   S    Q +
Sbjct:  589 SKPFTTLGEVAPVWVPDSHAPNC--MKCEARFTFTKRRHHCRACGKVFCAACCSLKCKLQYMDKKEARVCVICHSVLMNGSQSKEQRR 674          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Xenopus
Match: ZFYVE9 (zinc finger FYVE-type containing 9 [Source:NCBI gene;Acc:100496662])

HSP 1 Score: 76.2554 bits (186), Expect = 1.234e-13
Identity = 33/77 (42.86%), Postives = 47/77 (61.04%), Query Frame = 2
Query: 1283 SKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKIL 1513
            SKP   LGE  PVW  D+    C    C ++FTF+ RRHHCRA G ++C +C S + KL++     +RVC +C+ +L
Sbjct:  589 SKPFTTLGEVAPVWVPDSHAPNC--MKCEARFTFTKRRHHCRACGKVFCAACCSLKCKLQYMDKKEARVCVICHSVL 663          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Xenopus
Match: ZFYVE9 (zinc finger FYVE-type containing 9 [Source:NCBI gene;Acc:100496662])

HSP 1 Score: 76.2554 bits (186), Expect = 1.294e-13
Identity = 33/77 (42.86%), Postives = 47/77 (61.04%), Query Frame = 2
Query: 1283 SKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKIL 1513
            SKP   LGE  PVW  D+    C    C ++FTF+ RRHHCRA G ++C +C S + KL++     +RVC +C+ +L
Sbjct:  589 SKPFTTLGEVAPVWVPDSHAPNC--MKCEARFTFTKRRHHCRACGKVFCAACCSLKCKLQYMDKKEARVCVICHSVL 663          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Xenopus
Match: ZFYVE9 (zinc finger FYVE-type containing 9 [Source:NCBI gene;Acc:100496662])

HSP 1 Score: 76.2554 bits (186), Expect = 1.351e-13
Identity = 33/77 (42.86%), Postives = 47/77 (61.04%), Query Frame = 2
Query: 1283 SKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKIL 1513
            SKP   LGE  PVW  D+    C    C ++FTF+ RRHHCRA G ++C +C S + KL++     +RVC +C+ +L
Sbjct:  577 SKPFTTLGEVAPVWVPDSHAPNC--MKCEARFTFTKRRHHCRACGKVFCAACCSLKCKLQYMDKKEARVCVICHSVL 651          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Mouse
Match: Fgd2 (FYVE, RhoGEF and PH domain containing 2 [Source:MGI Symbol;Acc:MGI:1347084])

HSP 1 Score: 97.4413 bits (241), Expect = 1.283e-20
Identity = 90/345 (26.09%), Postives = 145/345 (42.03%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAI-----------GSVNTLFSNSKPPAI----LGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKD-----LNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRS 1891
            S   + +  V K S + +  + R LVLF++ L   +P     G   +VR  + +  M+V     ++ P    + GK+       TLE+      E +    SWM+  + AI            +V     +++ P      LG   P W +D     C    C   F   + RRHHCRA G + C  CS YR +LK+  +  +RVC  CY  LT N   + Q K+D     L         + +  S+L++   K  ++    +C + ++DP  L +Y   +D      I LLG ++ +G      P   P  F ++     + Y FKA   E    WV  ++R+
Sbjct:  317 SNTLLREGPVLKISFRRSDPMERYLVLFNNMLLYCVPRVLQVGAQFQVRTRIDVAGMKVRELTDAEFPHSFLVSGKQ------RTLELQARSRDEMV----SWMQACQAAIDQVEKRSETFKAAVQGPQGDTQEPKPQVEELGLRAPQWVRDKMVTMC--MRCQEPFNALTRRRHHCRACGYVVCAKCSDYRAELKYDSNRPNRVCLTCYTFLTGNV--LPQGKEDKRRGILEKEASAAPEQSLVCSFLQLIGDKCSRSLPRSWCVIPRDDPLVLYVYAAPQDTKAHTSIPLLGYQVISG------PQGDPRVFQLQQSG--QQYTFKAESVELQGRWVTAIKRA 639          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Mouse
Match: Fgd2 (FYVE, RhoGEF and PH domain containing 2 [Source:MGI Symbol;Acc:MGI:1347084])

HSP 1 Score: 88.5817 bits (218), Expect = 9.640e-19
Identity = 82/318 (25.79%), Postives = 132/318 (41.51%), Query Frame = 2
Query: 1022 FSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAI-----------GSVNTLFSNSKPPAI----LGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKD-----LNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRS 1891
            F++ L   +P     G   +VR  + +  M+V     ++ P    + GK+       TLE+      E +    SWM+  + AI            +V     +++ P      LG   P W +D     C    C   F   + RRHHCRA G + C  CS YR +LK+  +  +RVC  CY  LT N   + Q K+D     L         + +  S+L++   K  ++    +C + ++DP  L +Y   +D      I LLG ++ +G      P   P  F ++     + Y FKA   E    WV  ++R+
Sbjct:    5 FNNMLLYCVPRVLQVGAQFQVRTRIDVAGMKVRELTDAEFPHSFLVSGKQ------RTLELQARSRDEMV----SWMQACQAAIDQVEKRSETFKAAVQGPQGDTQEPKPQVEELGLRAPQWVRDKMVTMC--MRCQEPFNALTRRRHHCRACGYVVCAKCSDYRAELKYDSNRPNRVCLTCYTFLTGNV--LPQGKEDKRRGILEKEASAAPEQSLVCSFLQLIGDKCSRSLPRSWCVIPRDDPLVLYVYAAPQDTKAHTSIPLLGYQVISG------PQGDPRVFQLQQSG--QQYTFKAESVELQGRWVTAIKRA 300          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Mouse
Match: Fgd4 (FYVE, RhoGEF and PH domain containing 4 [Source:MGI Symbol;Acc:MGI:2183747])

HSP 1 Score: 82.0333 bits (201), Expect = 1.255e-15
Identity = 72/293 (24.57%), Postives = 128/293 (43.69%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYF----EDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKL-SWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPN 1780
            S   I +  + K ++++ +   R L LF++ L   +P  +  G    VR  + +  M++      + P    I GKE       + E +K  +     E I+      E  + AI   N +       A LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS Y+ +L++     ++VC  CY+I++  +D   + ++ +  +   +     ++ S+L+   M+  K + + +C + K+DP  L +Y   +D      I LLG  +     S   P+
Sbjct:  420 SNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQISGKERTLELQASSEQDKEEWIKALQESIDAFHQRHETFRNAIAKENDIPLEVST-AELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGRLNKVCKDCYQIISGFTDSEEKKRRGILEIESAEVSGNSEVCSFLQY--MEKSKPWQKIWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDDMPKSADLPH 707          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Mouse
Match: Fgd4 (FYVE, RhoGEF and PH domain containing 4 [Source:MGI Symbol;Acc:MGI:2183747])

HSP 1 Score: 82.0333 bits (201), Expect = 1.282e-15
Identity = 72/293 (24.57%), Postives = 128/293 (43.69%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYF----EDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKL-SWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPN 1780
            S   I +  + K ++++ +   R L LF++ L   +P  +  G    VR  + +  M++      + P    I GKE       + E +K  +     E I+      E  + AI   N +       A LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS Y+ +L++     ++VC  CY+I++  +D   + ++ +  +   +     ++ S+L+   M+  K + + +C + K+DP  L +Y   +D      I LLG  +     S   P+
Sbjct:  420 SNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQISGKERTLELQASSEQDKEEWIKALQESIDAFHQRHETFRNAIAKENDIPLEVST-AELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGRLNKVCKDCYQIISGFTDSEEKKRRGILEIESAEVSGNSEVCSFLQY--MEKSKPWQKIWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDDMPKSADLPH 707          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Mouse
Match: Fgd4 (FYVE, RhoGEF and PH domain containing 4 [Source:MGI Symbol;Acc:MGI:2183747])

HSP 1 Score: 82.0333 bits (201), Expect = 1.282e-15
Identity = 72/293 (24.57%), Postives = 128/293 (43.69%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYF----EDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKL-SWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPN 1780
            S   I +  + K ++++ +   R L LF++ L   +P  +  G    VR  + +  M++      + P    I GKE       + E +K  +     E I+      E  + AI   N +       A LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS Y+ +L++     ++VC  CY+I++  +D   + ++ +  +   +     ++ S+L+   M+  K + + +C + K+DP  L +Y   +D      I LLG  +     S   P+
Sbjct:  420 SNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQISGKERTLELQASSEQDKEEWIKALQESIDAFHQRHETFRNAIAKENDIPLEVST-AELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGRLNKVCKDCYQIISGFTDSEEKKRRGILEIESAEVSGNSEVCSFLQY--MEKSKPWQKIWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDDMPKSADLPH 707          
BLAST of Zinc finger FYVE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BY35|FGD2_MOUSE (FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 8.976e-20
Identity = 90/345 (26.09%), Postives = 145/345 (42.03%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAI-----------GSVNTLFSNSKPPAI----LGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKD-----LNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRS 1891
            S   + +  V K S + +  + R LVLF++ L   +P     G   +VR  + +  M+V     ++ P    + GK+       TLE+      E +    SWM+  + AI            +V     +++ P      LG   P W +D     C    C   F   + RRHHCRA G + C  CS YR +LK+  +  +RVC  CY  LT N   + Q K+D     L         + +  S+L++   K  ++    +C + ++DP  L +Y   +D      I LLG ++ +G      P   P  F ++     + Y FKA   E    WV  ++R+
Sbjct:  317 SNTLLREGPVLKISFRRSDPMERYLVLFNNMLLYCVPRVLQVGAQFQVRTRIDVAGMKVRELTDAEFPHSFLVSGKQ------RTLELQARSRDEMV----SWMQACQAAIDQVEKRSETFKAAVQGPQGDTQEPKPQVEELGLRAPQWVRDKMVTMC--MRCQEPFNALTRRRHHCRACGYVVCAKCSDYRAELKYDSNRPNRVCLTCYTFLTGNV--LPQGKEDKRRGILEKEASAAPEQSLVCSFLQLIGDKCSRSLPRSWCVIPRDDPLVLYVYAAPQDTKAHTSIPLLGYQVISG------PQGDPRVFQLQQSG--QQYTFKAESVELQGRWVTAIKRA 639          
BLAST of Zinc finger FYVE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7Z6J4|FGD2_HUMAN (FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.024e-19
Identity = 91/345 (26.38%), Postives = 144/345 (41.74%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVN----TLFSNSKPPAI-----------LGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKD-----LNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRS 1891
            S   + +  V K S + N  + R L LF++ L   +P     G   +VR  + +  M+V     ++ P    + GK+       TLE+      E I    SWM+  + AI  +     T  + ++ P             LG   P W +D     C    C   F   + RRHHCRA G + C  CS YR +LK+  +  +RVC  CY  LT N   + + K+D     L         + +  S+L++   K  K+    +C + ++DP  L +Y   +D      I LLG ++  G      P   P  F ++   +   Y FKA   E    WV+ ++R+
Sbjct:  317 SNTLLREGPVLKISFRRNDPMERYLFLFNNMLLYCVPRVIQVGAQFQVRTRIDVAGMKVRELMDAEFPHSFLVSGKQ------RTLELQARSQEEMI----SWMQAFQAAIDQIEKRNETFKAAAQGPEGDIQEQELQSEELGLRAPQWVRDKMVTMC--MRCQEPFNALTRRRHHCRACGYVVCARCSDYRAELKYDDNRPNRVCLHCYAFLTGNV--LPEAKEDKRRGILEKGSSATPDQSLMCSFLQLIGDKWGKSGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVTVG------PQGDPRVFQLQQSGQL--YTFKAETEELKGRWVKAMERA 639          
BLAST of Zinc finger FYVE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96M96|FGD4_HUMAN (FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 6.456e-16
Identity = 76/299 (25.42%), Postives = 131/299 (43.81%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELI----------KKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRK-TRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPN 1780
            S   I +  + K ++++ +   R L LF++ L   +P  +  G    VR  + +  M++      + P    + GKE       TLE+  +   +    +K+  E I          + AI   N + S     A LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS Y+ +L++     S+VC  CY+I++  +D   + +K +  +   + +   V  S+L+   M+  K + + +C + K+DP  L +Y   +D      I LLG  +     S   P+
Sbjct:  420 SNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKFTVRTRVGIDGMKIVETQNEEYPHTFQVSGKE------RTLELQASSAQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDIHSEVST-AELGKRAPRWIRDNEVTMC--MKCKEPFNALTRRRHHCRACGYVVCWKCSDYKAQLEYDGGKLSKVCKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQY--MEKSKPWQKAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDEMPRSADLPH 707          
BLAST of Zinc finger FYVE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91ZT5|FGD4_MOUSE (FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Fgd4 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 8.966e-15
Identity = 72/293 (24.57%), Postives = 128/293 (43.69%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYF----EDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKL-SWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPN 1780
            S   I +  + K ++++ +   R L LF++ L   +P  +  G    VR  + +  M++      + P    I GKE       + E +K  +     E I+      E  + AI   N +       A LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS Y+ +L++     ++VC  CY+I++  +D   + ++ +  +   +     ++ S+L+   M+  K + + +C + K+DP  L +Y   +D      I LLG  +     S   P+
Sbjct:  420 SNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQISGKERTLELQASSEQDKEEWIKALQESIDAFHQRHETFRNAIAKENDIPLEVST-AELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGRLNKVCKDCYQIISGFTDSEEKKRRGILEIESAEVSGNSEVCSFLQY--MEKSKPWQKIWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDDMPKSADLPH 707          
BLAST of Zinc finger FYVE domain-containing protein vs. UniProt/SwissProt
Match: sp|O88387|FGD4_RAT (FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.106e-14
Identity = 70/293 (23.89%), Postives = 128/293 (43.69%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRV-----SKIPDEVSIKGKEGCGLNINTLEMNKAFYF----EDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKL-SWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPN 1780
            S   I +  + K ++++ +   R L LF++ L   +P  +  G    VR  + +  M++      + P    + GKE       + E +K  +     E I+      E  + AI   N +       A LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS Y+ +L++     ++VC  CY+I++  ++   + ++ +  +   +     ++ S+L+   M+  K + + +C + K+DP  L +Y   +D      I LLG  +     S   P+
Sbjct:  420 SNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQVSGKERTLELQASSEQDKEEWIKALQESIDAFHQRHETFRNAIAKENDIPLEVST-AELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGRLNKVCKDCYQIMSGFAESEEKKRRGILEIESAEVSGNSEVCSFLQY--MEKSKPWQKIWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYIVDDMPKSADLPH 707          
BLAST of Zinc finger FYVE domain-containing protein vs. TrEMBL
Match: A0A4Z2DQC2 (FYVE, RhoGEF and PH domain-containing protein OS=Schistosoma japonicum OX=6182 GN=EWB00_010080 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.706e-25
Identity = 111/379 (29.29%), Postives = 177/379 (46.70%), Query Frame = 2
Query:  452 ITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSI-----QEENL-SLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQD---QEIFIKTHHELNLLIGRSV----VPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVA-IPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNS----KPPAI----LGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTEN 1522
            I+G+F+DI  L  +++ +  S  D  N  + +LP  F   +    LN YKSFL +YA N K   ++  TN + Q  C+  +     +E+ + ++    Y V  +L   + +I R        DPEY    +     +N+L    Q+   QE        L+ L G  V    +P +     +K   ++  S     L R L LFS+ L +  +P  N+ G  +V+ E+ L  M + ++ D+  I  +    +    L +  AF  ED  ML  W   +++AI S +   +N+    K   I    LGE    W KD ++  C   NC ++FT  NRRHHCRA G ++C SCS+Y+  L F      RVC + Y ++ +N
Sbjct:  137 ISGMFKDIPSLFKLHEHLTDSF-DSCNTEDLILPTAFTSDKETQILNIYKSFLCRYATNFKPFSEMYSTNDELQSICKGIVANSQYEEQRIQNVPGMFYGVSTALPRYKDLIYRLKGTMLSSDPEYVSVTKAWNFFKNLLDRSEQEIILQEKMQNAREALDKLDGLRVKYTQIPLLHLEGPAKKLPRR--SVHRRLLDRYLFLFSEYLVMTELP--NSVGRHQVKSEIRLAGMTLWEVKDDEEINVEHCFRIKAKELCVEVAFSNEDEKML--WWHELQQAIDSESNKQNNNNFEEKKSLIGINDLGEVAAQWVKDESSTMCT--NCCTEFTTLNRRHHCRACGKVFCGSCSAYKAPLAFYGGKYQRVCVVDYYLINKN 506          
BLAST of Zinc finger FYVE domain-containing protein vs. TrEMBL
Match: A0A095AGY5 (FYVE, RhoGEF and PH domain-containing protein 4 OS=Schistosoma haematobium OX=6185 GN=MS3_01346 PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 5.175e-24
Identity = 110/378 (29.10%), Postives = 174/378 (46.03%), Query Frame = 2
Query:  452 ITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSI-----QEENL-SLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQD---QEIFIKTHHELNLLIGRSV----VPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAI----GSVNTLFSNSKPPAI----LGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTEN 1522
            I G+F+DI  L  V++ + +S    + + +  LP  F   +    LN YKSFL +YAVN K   ++  TN + Q  C+  +     QE+ + ++    Y V  +L   + +I R        DPEYT   +    ++++L    Q+   QE  +     L  L G  V    +P +     +K   ++  S     L R L LFS+ L V   S N  G  +V+ E+ L  M + ++ D+  I  +    +    L +  AF  +D   L  W   +++AI       N+   N K   +    LGE    W KD ++  C   NC ++FT  NRRHHCRA G ++C SCS+Y+  L+       RVC + Y +L +N
Sbjct:  137 INGMFKDIPSLFKVHEHLTESFDSCEAE-DIELPSTFTSDKEMQILNIYKSFLCRYAVNFKTFSEMYSTNEELQNICKGIVAKSQYQEQRIQNVPGMFYGVSTALPRYKDLIYRLKGTMLPSDPEYTNVTKAWNFIKDLLDRSEQEIILQEKMLNAREALGKLDGLRVKYTQIPLLHLEGPAKKLPRR--SIHRRLLDRYLFLFSEYL-VMTESPNAVGRYQVKSEIGLAGMTLCEVKDDEEINVEHCFRIKAKELCVEVAFSNDDEKQL--WWRELQQAIDCECNKPNSNCFNEKKSIMSANNLGEVAAQWVKDESSTMCT--NCCTEFTTLNRRHHCRACGKLFCGSCSAYKAPLESCGGKYERVCVVDYYLLNKN 506          
BLAST of Zinc finger FYVE domain-containing protein vs. TrEMBL
Match: A0A5K4E8F1 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.089e-23
Identity = 110/378 (29.10%), Postives = 173/378 (45.77%), Query Frame = 2
Query:  452 ITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSI-----QEENL-SLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQD---QEIFIKTHHELNLLIGRSV----VPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAI----GSVNTLFSNSKPPAI----LGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTEN 1522
            I G+F+DI  L  +++ + +S  D +   +  LP  F   +    LN YKSFL +YAVN K   ++  TN + Q  C+  +     QE+ + ++    Y V  +L   + +I R        DPEYT   +    ++++L    Q+   QE        L  L G  V    +P +     +K   ++  S     L R L LFS+ L V   S N  G  +V+ E+ L  M + ++ D+  I  +    +    L +  AF  +D   L  W   +++AI       N+   N K   +    LGE    W KD ++  C   NC ++FT  NRRHHCRA G ++C SCS+Y+  L+       RVC + Y +L +N
Sbjct:  137 INGMFKDIPSLFKLHEHLTESF-DSREAEDVELPSAFTSDKEMQILNIYKSFLCRYAVNFKAFSEMYSTNEELQNICKGIVAKSQYQEQRIQNVPGMFYGVSTALTRYKDLIYRLKGTMLPSDPEYTNVTKAWNFIKDLLDRSEQEIILQEKMSNAREALGKLDGLRVKYTQIPLLHLEGPAKKLPRR--SIHRRLLDRYLFLFSEYL-VMTESPNAVGRYQVKSEIGLAGMTLCEVKDDEEINVEHCFRIKAKELCVEVAFSNDDEKQL--WWRELQQAIDCECNRPNSNGFNEKKSIMSANNLGEVAAQWVKDESSTMCT--NCCTEFTTLNRRHHCRACGKLFCGSCSAYKAPLESCGGKYQRVCVVDYYLLNKN 506          
BLAST of Zinc finger FYVE domain-containing protein vs. TrEMBL
Match: A0A5K4E8Y7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.104e-23
Identity = 110/378 (29.10%), Postives = 173/378 (45.77%), Query Frame = 2
Query:  452 ITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSI-----QEENL-SLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQD---QEIFIKTHHELNLLIGRSV----VPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAI----GSVNTLFSNSKPPAI----LGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTEN 1522
            I G+F+DI  L  +++ + +S  D +   +  LP  F   +    LN YKSFL +YAVN K   ++  TN + Q  C+  +     QE+ + ++    Y V  +L   + +I R        DPEYT   +    ++++L    Q+   QE        L  L G  V    +P +     +K   ++  S     L R L LFS+ L V   S N  G  +V+ E+ L  M + ++ D+  I  +    +    L +  AF  +D   L  W   +++AI       N+   N K   +    LGE    W KD ++  C   NC ++FT  NRRHHCRA G ++C SCS+Y+  L+       RVC + Y +L +N
Sbjct:  137 INGMFKDIPSLFKLHEHLTESF-DSREAEDVELPSAFTSDKEMQILNIYKSFLCRYAVNFKAFSEMYSTNEELQNICKGIVAKSQYQEQRIQNVPGMFYGVSTALTRYKDLIYRLKGTMLPSDPEYTNVTKAWNFIKDLLDRSEQEIILQEKMSNAREALGKLDGLRVKYTQIPLLHLEGPAKKLPRR--SIHRRLLDRYLFLFSEYL-VMTESPNAVGRYQVKSEIGLAGMTLCEVKDDEEINVEHCFRIKAKELCVEVAFSNDDEKQL--WWRELQQAIDCECNRPNSNGFNEKKSIMSANNLGEVAAQWVKDESSTMCT--NCCTEFTTLNRRHHCRACGKLFCGSCSAYKAPLESCGGKYQRVCVVDYYLLNKN 506          
BLAST of Zinc finger FYVE domain-containing protein vs. TrEMBL
Match: A0A430Q716 (FYVE, RhoGEF and PH domain containing 4 OS=Schistosoma bovis OX=6184 GN=DC041_0006554 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 4.937e-22
Identity = 111/376 (29.52%), Postives = 172/376 (45.74%), Query Frame = 2
Query:  452 ITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSI-----QEENL-SLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQD---QEIFIKTHHELNLLIGRSV----VPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKI-----PDEVSIKGKE-GCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTEN 1522
            I G+F+DI  L  V++ + +S    + + +  LP  F   +    LN YKSFL +YAVN K   ++  TN + Q  C+  +     QE+ + ++    Y V  +L   + +I R        DPEYT   +    ++++L    Q+   QE  +     L  L G  V    +P +     +K   ++  S     L R L LFS+ L V   S N  G  +V+ E+ L  M VS +      DE  +  +E    ++    + N   + E +    SW  L+ K+I S N L          GE    W KD ++  C   NC ++FT  NRRHHCRA G ++C SCS+Y+  L+       RVC + Y +L +N
Sbjct:  137 INGMFKDIPSLFKVHEHLTESFDSCEAE-DIELPSTFTSDKEMQILNIYKSFLCRYAVNFKTFSEMYSTNEELQNICKGIVAKSQYQEQRIQNVPGMFYGVSTALPRYKDLIYRLKGTMLPSDPEYTNVTKAWNFIKDLLDRSEQEIILQEKMLNAREALGKLDGLRVKYTQIPLLHLEGPAKKLPRR--SIHRRLLDRYLFLFSEYL-VMTESPNAVGRYQVKSEIGLAGMTVSFLIIYVNDDEKQLWWRELQQAIDCECNKPNSNCFNEKV----SW--LLFKSIMSANNL----------GEVAAQWVKDESSTMCT--NCCTEFTTLNRRHHCRACGKLFCGSCSAYKAPLESCGGKYERVCVVDYYLLNKN 490          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000014177.2 (FYVE, RhoGEF and PH domain-containing protein 6-like [Source:NCBI gene;Acc:103024376])

HSP 1 Score: 95.5153 bits (236), Expect = 8.017e-20
Identity = 115/483 (23.81%), Postives = 195/483 (40.37%), Query Frame = 2
Query:  554 DLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTN---VKCQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQDQ---EIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNT---LFSNSKPP---------AILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQ---VAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDP---------------FLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSL 1894
            D+FL +     L  Y S++ ++  N   + +  + N    K  R  + S    NL+++         L   +L++  + K   E  P Y   ++   +++++     +     + F K       L+G   + K     + + T+ K S K      R+  LF+D L    P    Q   ++  ELSL  M+VSK     S +G +   LNI ++E +             W+E I  AI         F +S+ P         A LG   P+W  D     C    C  +FT + RRHHCRA G + C++CS+ +  L++ K +  RVCD C++ L  NS     ++   K L     R+ RK +  +  +V+      + S Y   L++  P                L  Y   ED      + LLG  +   ++          +F + H D+   Y+FK  DS   + W+E  + ++
Sbjct:  702 DIFLKK--GPYLKMYSSYICEFDKNVALLEEQCRKNPAFAKVVREFESSPCCANLAVKHYMLKPVQRLPQYQLLLSDYVKNLNENSPHYKDTQDALKLVKDVANHANETMRKGDNFQKLIQVQYSLMGHHEIVKPGRTLLKEGTLMKLSRK--VMQPRMFFLFNDTLLYTTPLQTGQ--YKLNNELSLAGMKVSK----PSQEGHQN-ELNIESVERSFILSASSPTARDEWLEAISAAINDYTKKMISFGSSRSPEEGGKDTVDAQLGSKAPIWIPDLRATMC--MICTCEFTLTWRRHHCRACGKVVCQACSTNKYPLEYLKYHPERVCDQCFETLQHNSSGSSILSPNAKTLGGFHFRRQRK-IAAALKEVSANTDESSMSGY---LERNKPKKKQWKRLWFVIKNKVLYTYAASEDVAALESLPLLGFSLKEDQSESS------QQFKLYHKDKLI-YIFKTDDSNIHHRWIEAFREAM 1160          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Cavefish
Match: fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:NCBI gene;Acc:103037109])

HSP 1 Score: 87.8113 bits (216), Expect = 2.034e-17
Identity = 99/364 (27.20%), Postives = 156/364 (42.86%), Query Frame = 2
Query:  893 HHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAI-----GSVNTLFSNSK---------PPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTE--NSDQ----VAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDK--EDPFLKLYRNFEDKV-----RSFDIILLGMKIATG---KNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSL 1894
            HHE+ +  GR         F+ + T+ K S K      R+  LF+D L    P  + Q   +V   LSL  M+VSK     S++  +   LNI ++E +             W+E I  AI       ++ + S S+         PP  LG   P+W  D  T  C    C  +FT + RRHHCRA G + C++CSS +  L++ K+  +RVCD CY  L +    DQ    V+   +   S F    ++    S LK     +  +    +    K  + P+ +L+   ++KV      S D+  L  +   G   +  K  P  K  +F + H +    Y+F+A D      W+E  Q ++
Sbjct:  945 HHEI-VQPGRV--------FLKEGTLMKLSRK--VMQPRMFFLFNDILLYTTPVQSGQ--YKVNSMLSLAGMKVSK----PSLEAYQN-ELNIESVERSFILSASSATERDEWLEAIATAIEDYTRKKISFISSRSQESEGLSVDGPP--LGSKAPIWIPDLRTTMC--MICTCEFTLTWRRHHCRACGKVVCQACSSNKYYLEYLKNQLARVCDQCYAKLQQKDKGDQSEVCVSPSGRSSGSAFSFSRKQKKIPSALKEVSANTENSSMSGYLHRSKGNKKPWKRLWFVIKNKVLYTYAASEDVAALESQPLLGFFLREEKSGPAQK-LQFKLYHKNTLY-YIFRADDIPTAQRWIEAFQEAM 1284          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000054774.1 (FYVE, RhoGEF and PH domain-containing protein 4-like [Source:NCBI gene;Acc:103046578])

HSP 1 Score: 74.3294 bits (181), Expect = 1.925e-13
Identity = 56/205 (27.32%), Postives = 94/205 (45.85%), Query Frame = 2
Query:  938 VSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRVSKI-----PDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPP-----AILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILT 1516
             S  FI +  + K ++++ + + R L LF++ L   +P  +  G    VR  + +  M+V++      P    + GKE       TLE+  +   +  + +K++ E I+       T  + SK       + LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS  +  L++  +  ++VC  CY ILT
Sbjct:  343 ASNEFIKEGHILKLAARNTSAMDRYLFLFNNMLLYCVPKFSLVGQKFTVRTRIGIDGMKVAETYNEDYPHTFQVSGKE------RTLELQASTQQDKEDWIKAFQETIEIFHQKNETFKTASKEVEEVSISELGKRAPRWIRDNEVTMC--MKCREPFNALTRRRHHCRACGYVVCWKCSDNKASLEYDGNKMNKVCRDCYSILT 539          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000032138.1 (FYVE, RhoGEF and PH domain-containing protein 4-like [Source:NCBI gene;Acc:103046578])

HSP 1 Score: 74.3294 bits (181), Expect = 1.944e-13
Identity = 56/205 (27.32%), Postives = 94/205 (45.85%), Query Frame = 2
Query:  938 VSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRVSKI-----PDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPP-----AILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILT 1516
             S  FI +  + K ++++ + + R L LF++ L   +P  +  G    VR  + +  M+V++      P    + GKE       TLE+  +   +  + +K++ E I+       T  + SK       + LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS  +  L++  +  ++VC  CY ILT
Sbjct:  360 ASNEFIKEGHILKLAARNTSAMDRYLFLFNNMLLYCVPKFSLVGQKFTVRTRIGIDGMKVAETYNEDYPHTFQVSGKE------RTLELQASTQQDKEDWIKAFQETIEIFHQKNETFKTASKEVEEVSISELGKRAPRWIRDNEVTMC--MKCREPFNALTRRRHHCRACGYVVCWKCSDNKASLEYDGNKMNKVCRDCYSILT 556          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055861.1 (FYVE, RhoGEF and PH domain-containing protein 4-like [Source:NCBI gene;Acc:103046578])

HSP 1 Score: 73.9442 bits (180), Expect = 3.278e-13
Identity = 56/205 (27.32%), Postives = 94/205 (45.85%), Query Frame = 2
Query:  938 VSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRVSKI-----PDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPP-----AILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILT 1516
             S  FI +  + K ++++ + + R L LF++ L   +P  +  G    VR  + +  M+V++      P    + GKE       TLE+  +   +  + +K++ E I+       T  + SK       + LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS  +  L++  +  ++VC  CY ILT
Sbjct:  479 ASNEFIKEGHILKLAARNTSAMDRYLFLFNNMLLYCVPKFSLVGQKFTVRTRIGIDGMKVAETYNEDYPHTFQVSGKE------RTLELQASTQQDKEDWIKAFQETIEIFHQKNETFKTASKEVEEVSISELGKRAPRWIRDNEVTMC--MKCREPFNALTRRRHHCRACGYVVCWKCSDNKASLEYDGNKMNKVCRDCYSILT 675          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005437.1 (pep scaffold:Pmarinus_7.0:GL486528:10206:16522:1 gene:ENSPMAG00000004933.1 transcript:ENSPMAT00000005437.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 8.954e-16
Identity = 60/229 (26.20%), Postives = 98/229 (42.79%), Query Frame = 2
Query:  875 EIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLF------SNSKPPAI----LGESEPVWQKDNATGYCNGFNCLSQFT-FSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENS 1525
            +  ++ H  L   +   V P   T  + +  + K S +      R L LF++ L   +P   + G    +R  +++R + V  +     +   + CG+   T++       E  + +K+  E+IK       T        S+  PPA     LG+  P+W +D     C    C   FT  + RRHHCRA G + C  CS +R+ L +      RVC+ CY  LTE +
Sbjct:   71 QALLRVHEMLGGEVTDIVCP--DTELLKEGIILKRSVRIGVPQERYLFLFNNMLLHCVPKLWSMGQRYTLRTRINVRDLEVKDVNQHDQVPTFQVCGVQ-RTIDFQARTEEEKQDWMKAINEVIKTFREKEETFMGHTANVSDVSPPATQGMELGQRAPMWVRDVNVTLC--MTCQDPFTTLTRRRHHCRACGKVVCWKCSDHRVLLAYEPRKLQRVCEACYAQLTEEA 294          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Sea Lamprey
Match: fgd1 (FYVE, RhoGEF and PH domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081104-33])

HSP 1 Score: 65.855 bits (159), Expect = 1.940e-11
Identity = 60/217 (27.65%), Postives = 97/217 (44.70%), Query Frame = 2
Query:  908 LLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISR--VRQEL---SLRYMRVS--KIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMEL-----IKKAIGSVNTLFSNSKP-PAI-LGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKIL 1513
            +L G   +   S   I +  + K S+K+ T   R L LF++ L   +P     G  R  VR  L    ++Y R S  ++P   +++ +    +     E  K  + + IN  +S          KK IG+ + L+    P PA  LG   P   ++ +   C   +C   F   + R+HHCRA G + C  CS Y+ +L++     +RVC  CY +L
Sbjct:  438 MLDGEEDIVHPSNELIKEGQILKLSAKNGTAQERHLFLFNNMLLYCVPKLRLMGQQRFSVRTRLNIDGMQYKRTSPAQLPSP-TLRSRLHRSIYFYRSEAEKKEWVKAINNSESHQRSQVRVNFKKFIGNNHELYLIPPPHPATELGRRAPHLVRERSVSEC--MSCSEPFNALTRRKHHCRACGHVVCGKCSEYKAQLEYEGGKLARVCHDCYGVL 651          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Sea Lamprey
Match: zfyve9a (zinc finger, FYVE domain containing 9a [Source:ZFIN;Acc:ZDB-GENE-070705-182])

HSP 1 Score: 63.1586 bits (152), Expect = 1.349e-10
Identity = 26/67 (38.81%), Postives = 40/67 (59.70%), Query Frame = 2
Query: 1304 GESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCY 1504
            G S P+W  D     C    C ++FTF+ RRHHCRA G ++C  C S + +L++ ++  +RVC  C+
Sbjct:    4 GTSAPMWVPDAEAPNC--MRCKARFTFTRRRHHCRACGKVFCAPCCSQKSRLRYMENKEARVCIRCH 68          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001934.1 (pep scaffold:Pmarinus_7.0:GL488632:1056:3278:1 gene:ENSPMAG00000001758.1 transcript:ENSPMAT00000001934.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.994e-8
Identity = 27/67 (40.30%), Postives = 35/67 (52.24%), Query Frame = 2
Query: 1319 VWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTE 1519
            VW KD     C    C  +F+ S R+HHCR  G I+C SCS   + L        RVCDLC+ +L +
Sbjct:   54 VWLKDQDATNCKL--CEKEFSISRRKHHCRNCGEIFCNSCSDNELPLP-SSPKPVRVCDLCHALLLQ 117          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Sea Lamprey
Match: ankfy1 (ankyrin repeat and FYVE domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-041222-1])

HSP 1 Score: 55.4546 bits (132), Expect = 3.762e-8
Identity = 27/72 (37.50%), Postives = 39/72 (54.17%), Query Frame = 2
Query: 1313 EPVWQKDNATGYCNGFNC---LSQFTFSNRRHHCRADGLIYCESCSSYRIK-LKFGKSNTSRVCDLCYKILT 1516
            EP W        C+G NC    ++F  + R+HHCR  G + C  CS+  I  +KF  +   RVCD+C+ +LT
Sbjct: 1100 EPPW--------CDGSNCYECAAKFGVTTRKHHCRHCGRLLCNRCSAKEIPIIKFDLNKPVRVCDICFDVLT 1163          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Yeast
Match: VPS27 (Endosomal protein that forms a complex with Hse1p; required for recycling Golgi proteins, forming lumenal membranes and sorting ubiquitinated proteins destined for degradation; has Ubiquitin Interaction Motifs which bind ubiquitin (Ubi4p) [Source:SGD;Acc:S000005289])

HSP 1 Score: 48.1358 bits (113), Expect = 3.634e-6
Identity = 30/99 (30.30%), Postives = 48/99 (48.48%), Query Frame = 2
Query: 1217 MLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPV-WQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLK-FGKSNTSRVCDLCYK 1507
            + K + +LI + I     L  ++ P A+     P  W   +A   C+      +F+  NR+HHCR+ G ++C+  SS  I L   G     RVCD C++
Sbjct:  134 VAKVYDKLISRGIKFPEKLTLSNSPTAMFDSKTPADWIDSDACMICSK-----KFSLLNRKHHCRSCGGVFCQEHSSNSIPLPDLGIYEPVRVCDSCFE 227          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Yeast
Match: FAB1 (1-phosphatidylinositol-3-phosphate 5-kinase; vacuolar membrane kinase that generates phosphatidylinositol (3,5)P2, which is involved in vacuolar sorting and homeostasis [Source:SGD;Acc:S000001915])

HSP 1 Score: 48.1358 bits (113), Expect = 5.302e-6
Identity = 25/66 (37.88%), Postives = 34/66 (51.52%), Query Frame = 2
Query: 1310 SEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYK 1507
            S+  W KD ++  C  F+C   F    R+HHCR  G I+C SC+      +FG     RVC  CY+
Sbjct:  233 SKEYWMKDESSKEC--FSCGKTFNTFRRKHHCRICGQIFCSSCTLLIDGDRFGCHAKMRVCYNCYE 296          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Nematostella
Match: EDO48232 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKE8])

HSP 1 Score: 81.2629 bits (199), Expect = 3.666e-16
Identity = 58/220 (26.36%), Postives = 93/220 (42.27%), Query Frame = 2
Query:  911 LIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTL----------FSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQ 1540
            L+G   + +    FI +  + K   KD  E  R   L +D L    P   NQ   ++R+ L L  M+V  +P+      +        +  ++ +   E       W+E +++AI ++              +       LGE  PVW  D     C    C   FT +NRRHHCR  G + C SCS     L +     +RVCD+CY++L    +Q+++
Sbjct:  203 LVGHEEIVRPGREFIKQGNLLKLCRKDMQE--RTFFLLTDVLLYTAPVGGNQ--YKLRETLPLLGMKVI-LPESQEFVNEFSIISTTRSFTLSASTSAER----DEWLEELERAINAMTKKKISFFKSKEGITQDSEDTKLGEKAPVWIPDARVTMC--MLCTDDFTVTNRRHHCRGCGKVVCGSCSDNLAPLTYLDYAQARVCDMCYEVLLRGKEQLSR 411          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Nematostella
Match: EDO48184 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK38])

HSP 1 Score: 60.8474 bits (146), Expect = 3.227e-11
Identity = 29/71 (40.85%), Postives = 38/71 (53.52%), Query Frame = 2
Query: 1301 LGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKIL 1513
            LG   P W +D +   C    C + FT + RRHHCRA G IYC +CS  +  L++      RVC  C +IL
Sbjct:    6 LGTKAPAWIRDESVTMC--MLCDALFTLTRRRHHCRACGGIYCNACSHNKAPLEYRDGKLCRVCRSCREIL 74          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Nematostella
Match: EDO38501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCW3])

HSP 1 Score: 57.3806 bits (137), Expect = 3.319e-9
Identity = 39/132 (29.55%), Postives = 57/132 (43.18%), Query Frame = 2
Query: 1160 GLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCL-SQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKD 1552
            G  I + + + A Y         WM  I K I     L + +   A  G    VW  D+    C   +C+ ++FT  NRRHHCR  G + C +CS+ +  L    S   RVC+ CY  L+    +    K +
Sbjct:  101 GWQIISTKKSFAVYAATATEKAEWMAHINKCI---QDLLAKTGKKA-GGVHAAVWVPDSEASTC--MSCMKTKFTAINRRHHCRKCGAVVCGACSTKKFLLPAQSSKPLRVCNSCYNTLSNTKPRAPGEKPE 226          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Nematostella
Match: EDO25334 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWS6])

HSP 1 Score: 52.373 bits (124), Expect = 7.586e-9
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 2
Query: 1346 YCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKL-KFGKSNTSRVCDLCYKIL 1513
            YC G  C + F+   R HHCR+ G  +CE+CSS R+ L + G     RVCD CY  L
Sbjct:   14 YCAG--CNTSFSVFFRPHHCRSCGGSFCEACSSKRMTLPRLGYDTFERVCDACYHAL 68          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Nematostella
Match: EDO44864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUJ2])

HSP 1 Score: 54.6842 bits (130), Expect = 4.344e-8
Identity = 54/191 (28.27%), Postives = 86/191 (45.03%), Query Frame = 2
Query: 1067 GISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIK-KAIGSVNT---LFSNS------------------KPPAILGESEPVWQKDNATGYCNG---FNCLSQFTFSNRRHHCRADGLIYCESCSSYR-IKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNS 1561
             +S +++++  R   V+K    V     + CG  I+     K F  E  N++K+  + +K KA+G + T    F N                   K PA   ES+ ++  D+A  +  G     C  +F    R+HHCR  G ++C+ CSS   I  +FG     RVCD CY  +  NS + AQ K + ++
Sbjct:   47 AVSAIKKKMFDRNPHVAKYALTVLEACMKNCGSIIHDEIATKDFMDEMRNLIKNGADPVKDKALGLIQTWSHAFRNEPKYKIVQDTFNLMKMEGCKFPA-FNESDAMFSADSAPAWAEGDVCHMCRVKFGTFIRQHHCRNCGQVFCKKCSSKESIIPQFGIEKEVRVCDPCYLKINPNS-KTAQTKPEPST 235          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Medaka
Match: fgd6 (FYVE, RhoGEF and PH domain-containing protein 6 [Source:NCBI gene;Acc:101165435])

HSP 1 Score: 90.8929 bits (224), Expect = 2.128e-18
Identity = 98/366 (26.78%), Postives = 155/366 (42.35%), Query Frame = 2
Query:  884 IKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIG----------------SVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYK----KDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEY-FCELDKEDPFLKLYRNFEDKV-----RSFDIILLGMKIATG---KNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSL 1894
            +  HHE+ +  GR         F+ + T+ K S K      R+  LF+D L    P  + Q   ++   LSL  M+VSK P + + + +    LNI ++E +             W+E I KAI                        N  P   LG   P+W  D     C    C  +FT + RRHHCRA G + C++CS+ +  L++ K+  +RVCD C+  L ENSD+ A       K     F RK +K +  +  +V+      + S Y +     +  + +L+   ++KV      S D+  L  +   G   +  K  P  K  +F + H +    Y+FKA D      W+E  Q ++
Sbjct:  930 LNGHHEI-VQPGRV--------FLKEGTLMKLSRK--VMQPRMFFLFNDALMYTTPVQSGQ--YKLNSVLSLAGMKVSK-PSQEAYQNE----LNIESVERSFILSASSATERDEWLEAIAKAIDDYTKKKITFISSRSQEEAEVFVDNGAP---LGSKAPIWIPDLRATMC--MICTCEFTLTWRRHHCRACGKVVCQACSTNKYYLEYLKNQPARVCDHCFAKLKENSDRCASTSVSPIKSGAFSFTRKQKK-IPAALKEVSANTENSSMSGYLYRSKGNKKQWKRLWFVIKNKVLYTYAASEDVAALESQPLLGFFLREEKNGPAQK-LQFKLYHKNTL-FYMFKADDIPTAQRWIEAFQEAM 1269          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001799.2 (FYVE, RhoGEF and PH domain-containing protein 5 [Source:NCBI gene;Acc:101171656])

HSP 1 Score: 84.7297 bits (208), Expect = 1.926e-16
Identity = 129/551 (23.41%), Postives = 224/551 (40.65%), Query Frame = 2
Query:  464 FRDIVPL----DSVYKLIEKSLGDIQNQNECLLPDLF-LHQEIKSSLNF--------------YKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSI-----------QEENLSLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQDQEIFIKTHHELNLLIGRSVVPKVSTR---------FISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSK-----IPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTE-----------NSDQVAQYKKDLNSVFDR-------KTRKGVKLSWLKVA-------------DMKSPKTYSEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRS 1891
            FRD V L    +    L +  LG+I N+    LPD++ LH++I S L +              + S  +++ V + +I   +++    + +CQ S            Q   +SL+     V   +    +++  +         EY   +    I+ +I        +I     H  NLL   ++   V  +         F+ + T+ K S K  +   R L L +D L    P  N  G  R++  LSL  ++VSK      P+ + I+G +   +   +  + +  +F  +N  ++  E  + +  +  +  S      +LGE  P     +    C   NC + F+ + RRHHC   G I C SCS  R  LK+ K   ++VCD CY  L +           +S ++ +  + L++VF         + RKG+ +S+ +V                KS K +   +  L  +D  L  YR  E+++ S  + LLG  +    + KY    + N F + H D    Y FKA D+     WV  ++ +
Sbjct:  903 FRDAVGLAVGDEGQPVLDDGRLGEILNE----LPDVYTLHRKILSELEYRIRHWEEWQRIADIFLSRKAEFLVFTTYIGHYDRSMSLLENSCQTSPAFAAIVQKFEEQSSAVSLKQQLLQVIVRVARYRMLLTDYLNNLSPDSREYEDTQAAVGIVSDIA------DQINDNIKHGENLLRLINIAHSVHGQRDLLHPDRVFVKEGTLMKVSRK--SRQPRHLFLMNDVLLYTYPQQN--GKYRLKNTLSLTGLKVSKPTIDNAPNALKIEGTDISIILSASSFLEREDWFYTLN--RTVTEHTRGSAFNSCSGESRDGLKLLLGEKAPTLVPVSQVMMC--MNCTADFSLTLRRHHCHGCGRIVCRSCSRNRYPLKYMKDRMAKVCDHCYSELKKRGGEICELSGSSSPRMHRLSRPLSTVFHNIHPHNIWRNRKGI-ISFTQVTVSEEGSISGTLQRSKKSKKNWKRLWFLL--KDKVLYTYRAQEERIASESLPLLGFTVKL--SDKYAGEEETNVFQLYHKDTL-FYSFKAEDNFTAQRWVNAMEEA 1429          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Medaka
Match: FGD6 (FYVE, RhoGEF and PH domain-containing protein 6 [Source:NCBI gene;Acc:101155348])

HSP 1 Score: 80.8777 bits (198), Expect = 2.510e-15
Identity = 83/344 (24.13%), Postives = 149/344 (43.31%), Query Frame = 2
Query:  554 DLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVK---CQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNI------LLSVPQDQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVN----TLFSNSKPPA---------ILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTE 1519
            D+FL +     L  Y +++ ++  N   + + ++ N+      +  ++S +  NL+L+         +   +L++  + K   E    Y + +   ++++ +      ++    + +  I   H LN   G   + +    F  +  + K S K      R+  LF+D L    P    Q   +++  LSL  M+VSK P++ + + +    LNI ++E +             W+  I  AI        T  S +  PA          LG   P+W  D  T  C    C S+FT + RRHHCRA G + C+ CSS +  L++ K  + RVCDLC++ L +
Sbjct:  712 DIFLKK--GPYLKMYSTYIREFDKNVALLEEQSRKNLAFGAVVKEFEKSPRCANLALKHYLLKPVQRIPQYQLLLTDYLKNLSEGTDGYEETKAALSLVKEVANHANDIMKHGDNFQKLIDVQHRLN---GNHQIIQPGRIFFKEGILMKLSRK--VMQPRMFFLFNDILLYTKPVQTGQ--YKLKNMLSLAGMKVSK-PNQEAYQNE----LNIESVERSFILSASSATERDDWLNSISAAINDFTKKKITFLSGN--PANEADLTDGTPLGSKAPIWIPDPRTTMC--MICTSEFTLTWRRHHCRACGKVICQGCSSNKHYLQYMK-KSDRVCDLCFQTLRQ 1036          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Medaka
Match: FGD6 (FYVE, RhoGEF and PH domain-containing protein 6 [Source:NCBI gene;Acc:101155348])

HSP 1 Score: 80.8777 bits (198), Expect = 2.533e-15
Identity = 83/344 (24.13%), Postives = 149/344 (43.31%), Query Frame = 2
Query:  554 DLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVK---CQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNI------LLSVPQDQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVN----TLFSNSKPPA---------ILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTE 1519
            D+FL +     L  Y +++ ++  N   + + ++ N+      +  ++S +  NL+L+         +   +L++  + K   E    Y + +   ++++ +      ++    + +  I   H LN   G   + +    F  +  + K S K      R+  LF+D L    P    Q   +++  LSL  M+VSK P++ + + +    LNI ++E +             W+  I  AI        T  S +  PA          LG   P+W  D  T  C    C S+FT + RRHHCRA G + C+ CSS +  L++ K  + RVCDLC++ L +
Sbjct:  714 DIFLKK--GPYLKMYSTYIREFDKNVALLEEQSRKNLAFGAVVKEFEKSPRCANLALKHYLLKPVQRIPQYQLLLTDYLKNLSEGTDGYEETKAALSLVKEVANHANDIMKHGDNFQKLIDVQHRLN---GNHQIIQPGRIFFKEGILMKLSRK--VMQPRMFFLFNDILLYTKPVQTGQ--YKLKNMLSLAGMKVSK-PNQEAYQNE----LNIESVERSFILSASSATERDDWLNSISAAINDFTKKKITFLSGN--PANEADLTDGTPLGSKAPIWIPDPRTTMC--MICTSEFTLTWRRHHCRACGKVICQGCSSNKHYLQYMK-KSDRVCDLCFQTLRQ 1038          
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Medaka
Match: fgd4a (FYVE, RhoGEF and PH domain containing 4 [Source:NCBI gene;Acc:101161238])

HSP 1 Score: 74.7146 bits (182), Expect = 1.601e-13
Identity = 72/286 (25.17%), Postives = 121/286 (42.31%), Query Frame = 2
Query:  941 STRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGIS-RVRQELSLRYMRVSKI-----PDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNS------KPPAILGESEPVWQKDNATGYCNGFNCLSQF-TFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTE---NSDQVAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPF-LKLYRNFEDKVRSFDIILLGMKI 1747
            S  FI +  + K ++++ + + R L LF++ L   +P  +  G    VR  + +  M V +      P    + GKE       TLE+  +   +    +K++ E I+      N  F N+         A LG+  P W +DN    C    C   F   + RRHHCRA G + C  CS  +  L++  +  ++VC  CY  LT      D   + K  L     + T   +   +L+ +D    K + + +C + ++D   L LY   +D      I L+G  +
Sbjct:  362 SNEFIREGHILKLAARNTSAMERYLFLFNNMLLYCVPKFSLGGPKYTVRTRIGIEGMTVRETSNEDYPHTFQVSGKE------RTLELQASSEQDKAGWIKAFQETIE-VFQQKNESFKNALKEVEEVSKAELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGYVVCWKCSDNKAPLEYDGNKMNKVCRDCYSTLTGERVTEDGKKERKGILEIEAAKFTESSIICGFLQHSDKG--KLWQKVWCVIPEKDSLVLYLYGAPQDVKAQGSIPLVGYSV 636          
BLAST of Zinc finger FYVE domain-containing protein vs. Planmine SMEST
Match: SMESG000014968.1 (SMESG000014968.1)

HSP 1 Score: 1157.51 bits (2993), Expect = 0.000e+0
Identity = 602/604 (99.67%), Postives = 604/604 (100.00%), Query Frame = 2
Query:  110 MSMNVEREFDKCQTHGNQLIHSNKNLNPNNSSEHIANSDLEDDRKXXXXXXXXXXXXXXXEGNTKEGKLFSKANSIAQECVDFIYNISKCLSQXXXXXXXXXXXXXXXXXXXIQITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQDQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSLDKFCDKERS 1921
            MSMNVEREFDKCQTHGNQLIHSNKNLNPNNSSEHIANSDLEDDRKSSSNSSIDNSSNNDNEGNTKEGKLFSKANSIAQECVDF+YNISKCLSQLKKFKDELEKEFAEDFELKIQITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQE+DPEYTKAREVKTILRNILLSVPQDQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSLDKFCDKERS
Sbjct:    1 MSMNVEREFDKCQTHGNQLIHSNKNLNPNNSSEHIANSDLEDDRKSSSNSSIDNSSNNDNEGNTKEGKLFSKANSIAQECVDFLYNISKCLSQLKKFKDELEKEFAEDFELKIQITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQEQDPEYTKAREVKTILRNILLSVPQDQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSLDKFCDKERS 604          
BLAST of Zinc finger FYVE domain-containing protein vs. Planmine SMEST
Match: SMESG000014968.1 (SMESG000014968.1)

HSP 1 Score: 1152.89 bits (2981), Expect = 0.000e+0
Identity = 600/602 (99.67%), Postives = 602/602 (100.00%), Query Frame = 2
Query:  116 MNVEREFDKCQTHGNQLIHSNKNLNPNNSSEHIANSDLEDDRKXXXXXXXXXXXXXXXEGNTKEGKLFSKANSIAQECVDFIYNISKCLSQXXXXXXXXXXXXXXXXXXXIQITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQDQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSLDKFCDKERS 1921
            MNVEREFDKCQTHGNQLIHSNKNLNPNNSSEHIANSDLEDDRKSSSNSSIDNSSNNDNEGNTKEGKLFSKANSIAQECVDF+YNISKCLSQLKKFKDELEKEFAEDFELKIQITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQE+DPEYTKAREVKTILRNILLSVPQDQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSLDKFCDKERS
Sbjct:    1 MNVEREFDKCQTHGNQLIHSNKNLNPNNSSEHIANSDLEDDRKSSSNSSIDNSSNNDNEGNTKEGKLFSKANSIAQECVDFLYNISKCLSQLKKFKDELEKEFAEDFELKIQITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQEQDPEYTKAREVKTILRNILLSVPQDQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTYSEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSLDKFCDKERS 602          
BLAST of Zinc finger FYVE domain-containing protein vs. Planmine SMEST
Match: SMESG000036666.1 (SMESG000036666.1)

HSP 1 Score: 397.512 bits (1020), Expect = 4.477e-130
Identity = 237/553 (42.86%), Postives = 332/553 (60.04%), Query Frame = 2
Query:  305 EGKLFSKANSIAQECVDFIYNISKCLSQXXXXXXXXXXXXXXXXXXXIQITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSIQE----ENLSLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQ--DQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKI---PDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSN-SKPPAIL--GESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTEN---SDQVAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPK----TYSEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSLDKFC 1906
            E +  SK ++I  ECV+FI NI K LS L +FK  L  EF ++ E+   +T VFR+I PL  +YKL+ + + +++++    LPDLFL  EIK  LN YKSF  QY++NSKW+ +  K+N  CQ  C++        E L+LESC Y+VF SLFS +L I R++ CF EKD    KA +VKT + ++L  + +  DQE F+ TH ELNL+ GRS   K++T+FI K    K S +D   L R L+LFSDCLY                ELSL  M++SKI    D++S+K     GLNI T E  + FYFED   +  W+  ++  IG    + ++ SK  +IL  GE  P WQKD  + +CNG NC  +F+ + RRHHCR DGL+YC+SC S +  LKF K+  SRVC+ CY IL  +     +V + +K L +V+++KTRKG+K+ WL+       K    +  +YFCEL  E PFL LY   EDK +   I+LL M +   K S++   +KP +FTIEH+D+ E YLF     E+CNEWV+CL  ++  +C
Sbjct:   82 ECEYVSKLDNITNECVNFINNILKSLSYLMEFKAALHAEFHDNKEISSYLTSVFREIEPLHMLYKLVLEKITELKDKGTFCLPDLFLDNEIKGPLNIYKSFFGQYSINSKWLGEFIKSNTACQEVCKQVKDRLQIGELLTLESCLYTVFGSLFSFDLFINRYASCFGEKDEARQKAEDVKTQISSLLSIINKNLDQENFLLTHKELNLMTGRSRETKIATKFIYKGNASKLSRRDQRMLPRQLMLFSDCLY----------------ELSLDTMQISKIISEDDKISLKW----GLNIFTREALQDFYFEDEETMNLWISKLQLVIGEKAVVPNDVSKAISILKIGEEPPRWQKDCNSNFCNGHNCNQRFSSTVRRHHCRTDGLLYCDSCCSLKAVLKFEKNCESRVCEPCYVILNRDKISPQEVKEAEKQLETVYEKKTRKGMKMDWLEERIYNCEKGVFNSSVKYFCELHNEHPFLALYDKLEDKNKHHGIMLLRMTVCIKKQSRFIRKLKPQQFTIEHMDKNEAYLFDTPSPESCNEWVQCLNENIRNYC 614          
BLAST of Zinc finger FYVE domain-containing protein vs. Planmine SMEST
Match: SMESG000036666.1 (SMESG000036666.1)

HSP 1 Score: 396.356 bits (1017), Expect = 7.534e-130
Identity = 237/553 (42.86%), Postives = 332/553 (60.04%), Query Frame = 2
Query:  305 EGKLFSKANSIAQECVDFIYNISKCLSQXXXXXXXXXXXXXXXXXXXIQITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSIQE----ENLSLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQ--DQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKI---PDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSN-SKPPAIL--GESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKILTEN---SDQVAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPK----TYSEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSLDKFC 1906
            E +  SK ++I  ECV+FI NI K LS L +FK  L  EF ++ E+   +T VFR+I PL  +YKL+ + + +++++    LPDLFL  EIK  LN YKSF  QY++NSKW+ +  K+N  CQ  C++        E L+LESC Y+VF SLFS +L I R++ CF EKD    KA +VKT + ++L  + +  DQE F+ TH ELNL+ GRS   K++T+FI K    K S +D   L R L+LFSDCLY                ELSL  M++SKI    D++S+K     GLNI T E  + FYFED   +  W+  ++  IG    + ++ SK  +IL  GE  P WQKD  + +CNG NC  +F+ + RRHHCR DGL+YC+SC S +  LKF K+  SRVC+ CY IL  +     +V + +K L +V+++KTRKG+K+ WL+       K    +  +YFCEL  E PFL LY   EDK +   I+LL M +   K S++   +KP +FTIEH+D+ E YLF     E+CNEWV+CL  ++  +C
Sbjct:   67 ECEYVSKLDNITNECVNFINNILKSLSYLMEFKAALHAEFHDNKEISSYLTSVFREIEPLHMLYKLVLEKITELKDKGTFCLPDLFLDNEIKGPLNIYKSFFGQYSINSKWLGEFIKSNTACQEVCKQVKDRLQIGELLTLESCLYTVFGSLFSFDLFINRYASCFGEKDEARQKAEDVKTQISSLLSIINKNLDQENFLLTHKELNLMTGRSRETKIATKFIYKGNASKLSRRDQRMLPRQLMLFSDCLY----------------ELSLDTMQISKIISEDDKISLKW----GLNIFTREALQDFYFEDEETMNLWISKLQLVIGEKAVVPNDVSKAISILKIGEEPPRWQKDCNSNFCNGHNCNQRFSSTVRRHHCRTDGLLYCDSCCSLKAVLKFEKNCESRVCEPCYVILNRDKISPQEVKEAEKQLETVYEKKTRKGMKMDWLEERIYNCEKGVFNSSVKYFCELHNEHPFLALYDKLEDKNKHHGIMLLRMTVCIKKQSRFIRKLKPQQFTIEHMDKNEAYLFDTPSPESCNEWVQCLNENIRNYC 599          
BLAST of Zinc finger FYVE domain-containing protein vs. Planmine SMEST
Match: SMESG000070146.1 (SMESG000070146.1)

HSP 1 Score: 366.696 bits (940), Expect = 1.196e-118
Identity = 213/540 (39.44%), Postives = 325/540 (60.19%), Query Frame = 2
Query:  335 IAQECVDFIYNISKCLSQXXXXXXXXXXXXXXXXXXXIQITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVK----CQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLSVPQDQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPP-----AILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKIL---TENSDQVAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTY----SEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSLDKFC 1906
            I+ EC+DFI+++ + LS L  F  EL KE  +      + + VFRDI PL+ +Y+ I   + D +      LP +FL  +++ SL+ YKSFL+QY+ ++KWI  + +        C+   +R   +E ++L+S  Y++FNSLFS  + + R++KCF E +    K +EV+ I+ ++L  +  +Q+       EL+L+ GRS   K+++RFI K      + KD  ++ R+LVLFSDCLYV     N  G  +V++ELS+  + +++  ++ S   K   GLNIN  E    FYFE+ + +  W  L+   +      FS ++ P     + +GE+ P WQKD+A GYCNG+NC  +FT   RRHHCRADGL+YC+SC+S+++KLKF K++ S+VC+LCY+IL     NS  + + KK+L +VFD KTRKG K  WL+     S K       +YFCELD + P+L LY  +EDK     IIL+GM I +  +S+Y+  +KP++F IEH D+ E YLFK   +E C +WV+ L  S+  +C
Sbjct:   40 ISNECLDFIHSVLRALSFLNDFYRELSKENLDVETSH-RFSQVFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCREKEIYLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVEGIIADLLNDININQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDE-KIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKK----FSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSFKLKLKFLKNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESMKNYC 573          
The following BLAST results are available for this feature:
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FGD22.132e-2026.38FYVE, RhoGEF and PH domain containing 2 [Source:HG... [more]
FGD41.002e-1625.42FYVE, RhoGEF and PH domain containing 4 [Source:HG... [more]
FGD41.344e-1625.42FYVE, RhoGEF and PH domain containing 4 [Source:HG... [more]
FGD41.924e-1625.42FYVE, RhoGEF and PH domain containing 4 [Source:HG... [more]
FGD42.400e-1625.42FYVE, RhoGEF and PH domain containing 4 [Source:HG... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hgrs-14.847e-935.05Hepatocyte Growth factor-Regulated TK Substrate (H... [more]
hgrs-14.847e-935.05Hepatocyte Growth factor-Regulated TK Substrate (H... [more]
tag-776.937e-735.63pep chromosome:WBcel235:IV:8503493:8509398:-1 gene... [more]
tag-776.992e-735.63pep chromosome:WBcel235:IV:8503493:8509398:-1 gene... [more]
tag-778.269e-735.63pep chromosome:WBcel235:IV:8503493:8508553:-1 gene... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sara4.441e-1546.84gene:FBgn0026369 transcript:FBtr0071641[more]
Hrs8.306e-936.00gene:FBgn0031450 transcript:FBtr0089749[more]
Hrs8.467e-936.00gene:FBgn0031450 transcript:FBtr0089750[more]
Hrs8.467e-936.00gene:FBgn0031450 transcript:FBtr0089751[more]
rush6.381e-834.69gene:FBgn0025381 transcript:FBtr0070259[more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgd62.135e-1827.30FYVE, RhoGEF and PH domain containing 6 [Source:ZF... [more]
fgd62.941e-1827.30FYVE, RhoGEF and PH domain containing 6 [Source:ZF... [more]
fgd67.263e-1827.30FYVE, RhoGEF and PH domain containing 6 [Source:ZF... [more]
fgd5b6.902e-1625.15FYVE, RhoGEF and PH domain containing 5b [Source:Z... [more]
fgd4a1.083e-1523.84FYVE, RhoGEF and PH domain containing 4a [Source:Z... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mc3r2.239e-1629.55melanocortin 3 receptor [Source:Xenbase;Acc:XB-GEN... [more]
ZFYVE95.714e-1439.77zinc finger FYVE-type containing 9 [Source:NCBI ge... [more]
ZFYVE91.234e-1342.86zinc finger FYVE-type containing 9 [Source:NCBI ge... [more]
ZFYVE91.294e-1342.86zinc finger FYVE-type containing 9 [Source:NCBI ge... [more]
ZFYVE91.351e-1342.86zinc finger FYVE-type containing 9 [Source:NCBI ge... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fgd21.283e-2026.09FYVE, RhoGEF and PH domain containing 2 [Source:MG... [more]
Fgd29.640e-1925.79FYVE, RhoGEF and PH domain containing 2 [Source:MG... [more]
Fgd41.255e-1524.57FYVE, RhoGEF and PH domain containing 4 [Source:MG... [more]
Fgd41.282e-1524.57FYVE, RhoGEF and PH domain containing 4 [Source:MG... [more]
Fgd41.282e-1524.57FYVE, RhoGEF and PH domain containing 4 [Source:MG... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BY35|FGD2_MOUSE8.976e-2026.09FYVE, RhoGEF and PH domain-containing protein 2 OS... [more]
sp|Q7Z6J4|FGD2_HUMAN1.024e-1926.38FYVE, RhoGEF and PH domain-containing protein 2 OS... [more]
sp|Q96M96|FGD4_HUMAN6.456e-1625.42FYVE, RhoGEF and PH domain-containing protein 4 OS... [more]
sp|Q91ZT5|FGD4_MOUSE8.966e-1524.57FYVE, RhoGEF and PH domain-containing protein 4 OS... [more]
sp|O88387|FGD4_RAT4.106e-1423.89FYVE, RhoGEF and PH domain-containing protein 4 OS... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DQC22.706e-2529.29FYVE, RhoGEF and PH domain-containing protein OS=S... [more]
A0A095AGY55.175e-2429.10FYVE, RhoGEF and PH domain-containing protein 4 OS... [more]
A0A5K4E8F11.089e-2329.10Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4E8Y71.104e-2329.10Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A430Q7164.937e-2229.52FYVE, RhoGEF and PH domain containing 4 OS=Schisto... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000014177.28.017e-2023.81FYVE, RhoGEF and PH domain-containing protein 6-li... [more]
fgd62.034e-1727.20FYVE, RhoGEF and PH domain containing 6 [Source:NC... [more]
ENSAMXT00000054774.11.925e-1327.32FYVE, RhoGEF and PH domain-containing protein 4-li... [more]
ENSAMXT00000032138.11.944e-1327.32FYVE, RhoGEF and PH domain-containing protein 4-li... [more]
ENSAMXT00000055861.13.278e-1327.32FYVE, RhoGEF and PH domain-containing protein 4-li... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005437.18.954e-1626.20pep scaffold:Pmarinus_7.0:GL486528:10206:16522:1 g... [more]
fgd11.940e-1127.65FYVE, RhoGEF and PH domain containing 1 [Source:ZF... [more]
zfyve9a1.349e-1038.81zinc finger, FYVE domain containing 9a [Source:ZFI... [more]
ENSPMAT00000001934.11.994e-840.30pep scaffold:Pmarinus_7.0:GL488632:1056:3278:1 gen... [more]
ankfy13.762e-837.50ankyrin repeat and FYVE domain containing 1 [Sourc... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
VPS273.634e-630.30Endosomal protein that forms a complex with Hse1p;... [more]
FAB15.302e-637.881-phosphatidylinositol-3-phosphate 5-kinase; vacuo... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO482323.666e-1626.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481843.227e-1140.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385013.319e-929.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO253347.586e-945.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO448644.344e-828.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgd62.128e-1826.78FYVE, RhoGEF and PH domain-containing protein 6 [S... [more]
ENSORLT00000001799.21.926e-1623.41FYVE, RhoGEF and PH domain-containing protein 5 [S... [more]
FGD62.510e-1524.13FYVE, RhoGEF and PH domain-containing protein 6 [S... [more]
FGD62.533e-1524.13FYVE, RhoGEF and PH domain-containing protein 6 [S... [more]
fgd4a1.601e-1325.17FYVE, RhoGEF and PH domain containing 4 [Source:NC... [more]
back to top
BLAST of Zinc finger FYVE domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014968.10.000e+099.67SMESG000014968.1[more]
SMESG000014968.10.000e+099.67SMESG000014968.1[more]
SMESG000036666.14.477e-13042.86SMESG000036666.1[more]
SMESG000036666.17.534e-13042.86SMESG000036666.1[more]
SMESG000070146.11.196e-11839.44SMESG000070146.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001380 ID=SMED30001380|Name=Zinc finger FYVE domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2006bp
GTTGTGGTTATTTTAGCAGTGATAGAATCATTCTGCATCTGTACACAATA
AAATTCGTTATATTCATAGAACTTTATTTATTTTTTATTGTTTTAATGTG
TGTTAATTAATGTCAATGAACGTTGAGAGAGAATTTGATAAATGCCAAAC
TCATGGAAATCAGTTAATTCATTCAAACAAAAATCTCAATCCAAATAATT
CTTCAGAACATATAGCAAATTCAGATCTCGAAGACGATCGGAAATCCAGC
TCCAATTCTTCCATCGACAATTCAAGCAACAACGATAATGAAGGTAACAC
AAAAGAAGGAAAACTTTTCTCCAAGGCGAATTCAATTGCCCAAGAGTGTG
TCGACTTTATTTATAATATCTCCAAATGTCTTTCTCAATTGAAGAAATTC
AAAGATGAGCTAGAAAAGGAATTCGCCGAAGATTTTGAACTCAAAATTCA
AATAACTGGTGTATTTCGTGACATTGTTCCACTGGATTCCGTCTACAAAC
TGATTGAAAAATCTCTCGGAGACATCCAAAATCAGAATGAATGTCTTTTG
CCAGATTTATTTTTGCATCAAGAAATAAAGAGTTCACTCAATTTTTACAA
ATCTTTCCTTAGTCAGTATGCGGTAAATTCTAAATGGATCGTACAACTGA
ACAAGACAAATGTTAAATGTCAAAGAGCTTGTCAAAGATCAATCCAAGAA
GAAAATTTAAGTCTAGAAAGTTGTCATTATTCGGTTTTCAACAGCTTGTT
TTCTTTAGAGTTAATAATTGAGAGATTCTCGAAATGTTTCCAAGAGAAAG
ACCCTGAATACACCAAGGCTCGAGAAGTAAAAACTATACTAAGAAATATT
TTGCTCAGCGTTCCACAAGATCAAGAAATATTCATTAAAACCCATCACGA
ACTAAATCTTTTAATCGGAAGGTCGGTAGTCCCAAAAGTCAGCACTCGAT
TCATATCAAAAGTAACTGTCAAAAAGTATTCCTCCAAAGACAACACCGAA
TTAACTCGACTACTCGTATTGTTTTCAGATTGTCTTTATGTCGCGATCCC
TTCTCACAATAACCAAGGAATTAGTAGAGTTCGCCAAGAACTCTCACTAA
GGTACATGAGAGTTTCAAAGATTCCAGATGAAGTTTCAATAAAAGGCAAA
GAGGGCTGTGGGTTGAACATCAACACTTTGGAAATGAATAAAGCGTTTTA
TTTTGAAGATATAAATATGCTGAAAAGTTGGATGGAACTAATAAAAAAAG
CAATAGGCTCAGTAAATACACTTTTTAGCAATAGTAAGCCACCGGCAATT
CTAGGAGAGTCAGAACCAGTTTGGCAAAAGGATAACGCAACTGGATATTG
TAACGGCTTCAATTGTCTTAGTCAATTTACATTCTCCAACCGTCGTCATC
ACTGTCGAGCCGACGGACTGATATACTGCGAGTCTTGTTCATCATACCGA
ATCAAATTGAAATTCGGCAAATCAAATACTTCAAGAGTTTGTGATCTTTG
CTATAAGATTCTCACAGAGAATTCCGATCAAGTCGCACAATATAAAAAAG
ATCTAAATTCGGTTTTTGATAGAAAAACGAGAAAAGGTGTAAAGCTGAGT
TGGCTGAAAGTGGCCGATATGAAATCCCCGAAAACATACTCTGAATACTT
TTGTGAGCTTGATAAAGAAGATCCGTTCTTAAAGTTGTACAGAAATTTTG
AAGACAAGGTTCGATCATTTGATATCATTTTGCTTGGAATGAAGATTGCA
ACCGGTAAAAATTCGAAATATTTTCCGAATATGAAGCCAAATAAATTTAC
TATCGAGCATATCGACAGGTTCGAAGGGTATCTCTTTAAGGCTTTGGACA
GCGAAAATTGCAACGAATGGGTCGAGTGTTTACAACGCAGTCTGGACAAA
TTCTGCGACAAAGAACGATCTTAAAACTTTTTTTCAGTTTTAAATAATAT
TTATTGTATAAAAAAATGATTTTGTGATAAATAAATAATATTATCATTTG
TTGTAA
back to top

protein sequence of SMED30001380-orf-1

>SMED30001380-orf-1 ID=SMED30001380-orf-1|Name=SMED30001380-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=605bp
MSMNVEREFDKCQTHGNQLIHSNKNLNPNNSSEHIANSDLEDDRKSSSNS
SIDNSSNNDNEGNTKEGKLFSKANSIAQECVDFIYNISKCLSQLKKFKDE
LEKEFAEDFELKIQITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDL
FLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVKCQRACQRSIQEENL
SLESCHYSVFNSLFSLELIIERFSKCFQEKDPEYTKAREVKTILRNILLS
VPQDQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTR
LLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGC
GLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPPAILGE
SEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKL
KFGKSNTSRVCDLCYKILTENSDQVAQYKKDLNSVFDRKTRKGVKLSWLK
VADMKSPKTYSEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGK
NSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSLDKFCD
KERS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:00055451-phosphatidylinositol binding
GO:0046872metal ion binding
GO:0005089Rho guanyl-nucleotide exchange factor activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005768endosome
GO:0005769early endosome
GO:0005829cytosol
GO:0016020membrane
GO:0031901early endosome membrane
GO:0043231intracellular membrane-bounded organelle
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000306Znf_FYVE
IPR001849PH_domain
IPR011993PH-like_dom_sf
IPR013083Znf_RING/FYVE/PHD
IPR017455Znf_FYVE-rel
IPR011011Znf_FYVE_PHD
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 279..385
e-value: 0.22
score: 20.6
coord: 493..598
e-value: 7.1E-5
score: 32.2
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 492..596
score: 7.263
IPR000306FYVE zinc fingerSMARTSM00064fyve_4coord: 400..470
e-value: 3.0E-17
score: 73.3
IPR000306FYVE zinc fingerPFAMPF01363FYVEcoord: 404..468
e-value: 1.9E-14
score: 53.5
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 394..482
e-value: 1.2E-19
score: 71.8
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 277..386
e-value: 2.7E-7
score: 32.6
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 496..597
e-value: 9.1E-7
score: 30.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 38..66
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 49..66
NoneNo IPR availablePANTHERPTHR12673FACIOGENITAL DYSPLASIA PROTEINcoord: 278..594
NoneNo IPR availablePANTHERPTHR12673:SF82FYVE, RHOGEF AND PH DOMAIN-CONTAINING PROTEIN 2coord: 278..594
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 278..383
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 493..597
IPR017455Zinc finger, FYVE-relatedPROSITEPS50178ZF_FYVEcoord: 419..469
score: 9.872
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 403..482