Collagen IV NC1 domain-containing protein

Overview
NameCollagen IV NC1 domain-containing protein
Smed IDSMED30001376
Length (bp)5736
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Collagen IV NC1 domain-containing protein (SMED30001376) t-SNE clustered cells

Violin plots show distribution of expression levels for Collagen IV NC1 domain-containing protein (SMED30001376) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Collagen IV NC1 domain-containing protein (SMED30001376) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Collagen IV NC1 domain-containing protein (SMED30001376) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001376

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30001376SMESG000071508.1 dd_Smed_v4_1579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001376SMESG000071508.1 dd_Smed_v4_1579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001376SMESG000071508.1 dd_Smed_v4_1579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001376SMESG000071508.1 dd_Smed_v4_1579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001376SMESG000071508.1 dd_Smed_v4_1579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30001376SMESG000071508.1 dd_Smed_v4_1579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig3759uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig3759newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig38132uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig38132newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig38149uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig38149newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig29706uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig29706newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig24336uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig24336newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig7821uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000071508.1 Contig7821newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000057601.1 Contig3759uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001376SMESG000057601.1 Contig3759newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30001376SMESG000071508.1 dd_Smed_v6_1579_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30001376SMESG000071508.1 dd_Smed_v6_1579_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30001376SMESG000071508.1 dd_Smed_v6_1579_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30001376SMESG000071508.1 dd_Smed_v4_1579_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
muscle cellSMED30001376SMESG000071508.1 dd_Smed_v4_1579_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 389.037 bits (998), Expect = 1.441e-109
Identity = 406/1197 (33.92%), Postives = 523/1197 (43.69%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIG----EKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPG---EIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIG-------IQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS----SNGERGQRG----PQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLG-VKGERGDPGPDGYEGQ------------------------------RGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSF-QMTMGHNIKTMQSEDLIAKCLVCMRN 5445
              G  GPSG  G PG  G +G RGL G  G+ G SG  G+ G  GL       G  G RG+ GLPG      PG  G  G  G +G  G  G KG   ++            E G  G QG  G  G+KG  G++GL G+ G HGK G  G  GE+G+ G  G+ G  G  G  G  GIKG  GL G  G  G  G PG+KG  G  G PG  +                                    KG  GL+G  G+ G  GL G PG   +       GPKG +G++G  G PGI G  G  G      +G KGIPG   ++GP G  G PGEKG +G  GP G    R    +   +G KG QG  G  G  G  G +G+ G  G  G  G       I+G  G+ G  G +G++GL G +G +G  G  GM G  G QG +G  G  G  GL G KG  G     I GS G KG  G  G  G KG  G IG IG PG+   +G++G+ G+ GD                                    VG  G        G +GE G  G  G++G  G  G  G +G +G  G+ G +G NG+ G                                                + G+ G +      GE+G  G      G  G +G+KG+ G  G +GP G  G  GI L   + G+ GDPG  G +G+                               GPKGPKGD+G    + G  GE G+KG +GE G +G  G  G  G+ G  G++G  G +G  G QG  G+                                        IPG  GD G  G  G +G KG PGI G  G  G  G  G  G+    G +G  G +G  G+ GP G             PG  G++    G     HSQS ++P CP     LW GYS L + G E+AH  DL   GSCL  FS +PF++C   E C Y+ RND++YWLS+   + M M ++ TQ+  Y+SRC VCEAPS+  A HSQ    P+CP GW +LW G SFLM+T  GA GGGQ L SPGSCL  F+   F+EC+ A+G C Y+     FWL   +  + F ++ +   +K  Q    +++C VCM++
Sbjct:  658 IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPG-----FPGLPGKDGLPGMIGSPGLPGSKGATGDIF---------GAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIV-----------------------------------KKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPG-----TRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQ-TVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGN---KGEDGKVGVSGD------------------------------------VGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGT-------------------------------------KGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPG-FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDG-------------------IPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFG------------MPGMPGQSM-RVGYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPM-MPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKS 1689          

HSP 2 Score: 148.288 bits (373), Expect = 7.848e-35
Identity = 278/866 (32.10%), Postives = 342/866 (39.49%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGE------KGLAGFSGPKGIKGERGDTGLPGKEA---------------EKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKG------SKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGL---VGDPGILAI-GEKGPKGFQGNIGERGNP------GIK---GYKGNSGFPDIT----------------------LKGYKGIPGEIGPKGFQGLPGE------------KGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKG-------------VQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG-RSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPD-----GYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRG 4365
            G RGD G  G QG  G  G  G  G SG  G KGE      +G+ G  G  G +G RG  G PGK+                +  PG+KG+ G  GE G  G  G  G             GD G+ G+ G QG    PG+KG        G  G SG PG  G  G  G  G  G  G+ G +G  G  G  G + +  + G  G +G++G  GFPG  G  G+ G+ G               +               G  G+ G +G TG +G  GD G  GL    G PG+L   GE+G  G  G +G+ G P      GIK   G  G  GFP I+                      L G KG+PG  G  G +G PG             KG KG +G  G  G+ G  G  G +G KG+ G  G +G  G  G+ G+KGD G  G +GI   +    N   L LKG KG+QG AG       G  GP+G KGE+G  G             ++G++G  GP GF     MG +G  G KG  G  G  G  G+ G  G+ GS G  G  G  GLKGD G T                                             G  G  G+ GE G KG KG  GL G +G     G KG++G+ G+ G++                                       G+ G  G  G++G R   G  G  G QG  G  G  G  G  G  G  G  G    GL G KG  G PGP      G  G  GPKG KG  G  I  PG  G  G KG +G  G  GP G+PG+ G      I G  GD G  G
Sbjct:  512 GARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQG---LPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSP------------GLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSN---LWLKGDKGSQGSAGS-----NGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGF-----MGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEI-----------------------------------------SGSPGPKGQPGESGFKGTKGRDGLIGNIGFP---GNKGEDGKVGVSGDV---------------------------------------GLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLN--GLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPG 1264          

HSP 3 Score: 145.976 bits (367), Expect = 3.810e-34
Identity = 331/974 (33.98%), Postives = 423/974 (43.43%), Query Frame = 1
Query:  322 GFGGHEGK---PGFRGVKGDRG------PPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIP------------GDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXX-LRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDT 3174
            G  G +GK   PG +G+ G +G       PG+ G  G  G  G  GPKG  G  G  G  G +G KG PG  G        G  G  G+KG  G  G  G  G+PGM G  G  G KG +     +  AE G  G +G  GL G  G  GD G PG KG+       G  G LG KGE+G P        + G++G  G  G S    +   +    + G  G  G  G  G  G  G KG  G    KG  GLKG+ G+ G +G  G P   GSPG  G+  + G +G  G  G+ G  G  G  G  G +G KG+ G T  +    +G  G  GEKG++G  G  GIP            GD+GS+G +G  G  G +G+KG +     PG  G  G  G ++G+ GK G  G  G +GL G KG  G+    G  G  G  G+ G  G  G +G  G  G+ G   ++  S PG +G  G  G  G  GR G+ G  GF G KG      DG  G  GD G PG PG  G+ G+ G                                                     G  G SG +G  G +G  GL G  G+ G  G  G++G  G KG  G  GP  I G  G  GLPG + EK  G  GI   +G  G  G +G+K                 G++G  G QG AG PG  G    + ++G PG  G+ G  G+ G  G  G  G  G    +G  G+ G  G+ G +G KGD+G  GF G  G++G+ G+ G+                        G +G  G+ G  GD GF G++G++G +G  GL GDPG     E      Q   G  G PGI G  G +G P     G +G  G  G KG  G+PG+ G  G  GP G  G  G  G QGP G++G  GQ+G  GM G  G     G T
Sbjct:  630 GLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGAT---GDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGV------HGKPGLLGPKGERGSP-------GTPGQVGQPGTPGSSGPYGIKGKSG---LPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSP---GSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM--GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGS-PGPKGQPGESGFKGTKGRDGLIGNIGFPGNKG-----EDGKVGVSGDVGLPGAPGFPGVAGMRG---------------------------------------------------EPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPS-ITGVPGPAGLPGPKGEK--GYPGI--GIGAPGKPGLRGQK-----------------GDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEP-----------------------GFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEA----VQVPPGPLGLPGIDGIPGLTGDP-----GAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYT 1468          

HSP 4 Score: 137.117 bits (344), Expect = 2.297e-31
Identity = 287/849 (33.80%), Postives = 360/849 (42.40%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQG--YDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGE------IGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMI---------SLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGD---LGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTG--------VRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKG--VKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS----IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYS----GKKGESGIHGDKGEKGLAGFSGPKG------------IKGERGDTGLPGKEAE-------KIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQ----------GNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG 2655
             G  G  G  G PGF G KG RG PG  G+ G+ G KG+ G  G++    + G  G  G+KG PG  G  G  G  G  G PG  G+ G  G  +    G PG QG +G  G KGF    +  LP  +G  G  G  G KGE       G+ G  G PG+ G  G +G  G  G  GF G  G P K           S+ K +G  G KG  G      L  +     + G   + GP G  G +G  G  G  G  G  G  GLKGI G    +GP G+ G PGE G  G PG  GIP  R P      +G +G  G+AG++G  G +G KG+                  ++G  G+ G  G  G RG+PG +GS G +G  G  GE G+                     +G+ G  G  G  G  GLKGD G  V+     G KG+ G +G  G KG  G  G  G  G KG+ G VG S    +PGA G  G+ G  G  G  G  G +G IG  GS         G  G KGFPG P   G+ GLNG  G +G                                             T G  GPS   G PG  G  G +G  GY     G  G+ G+ G KG++G  G  GP G            I G+ GD G PG + E         PG  G   + G+ GD GF G  G            KG  G++G+ G  G  G  G KG +GE G  G PGK G  G+ G  G KG  G +G +GL G  G+           G +G+ G+ G+ G+ GD G  G  G +G  G+ G+PG
Sbjct:  659 PGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFL--GDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVK-KGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGS---------------------QGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGS--------PGLIGPKGFPGFP---GLHGLNGLPGTKG---------------------------------------------THGTPGPS-ITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGP-----------KGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPG 1415          

HSP 5 Score: 131.339 bits (329), Expect = 1.184e-29
Identity = 277/892 (31.05%), Postives = 349/892 (39.13%), Query Frame = 1
Query: 2074 GEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEA---------EKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHG------------KVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGIL-AIGEKGPKG---------FQGNIGERGNPGIKGYKG-----------------------NSGFPDITLKGYKGIPGEI-----------------------------GPKGFQGLPGEKG------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGS---------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG-RSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQG-PAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGD-------------------KGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G  G RG  G  G +G  G  G KG  G  G +G +GI+G++GD GLPG +             PGD G+ G  G  GD+G +G +G         +   G     GV G+ G  GFPG KG +G  G + I G  G              G    + E   +  K E+G  G RG QG    KG  GL+G+KGD GF    G        GVP                          G+ G  G  G +G  G  G RG+ G  G +G  G PG++  +G  GPKG          QG  G+RG+ G +G++G                         GFP    KG  G+PGE                              G  G QGLPG KG        G  GP+G  G  G  G +G +G  G  GQ G  G  GE GS          G  G  GE+G  G  G  G+ G  G +G  GL G++G  GD      G  G QG +G +G+KG  G +G  G KG  GK  ++G KGE+G+ G  G++G  G  G  GP G+ G  G  G  G  G+ G                             G  G +G  G  G   K+   G KG  G  G +G KG  G+ G++G     GPKG KG  G  G  G                                               GL GI G R   G  G  G  G +G  G  GE GD G  GP G P+  + +  L +KG++G  G  G  G  GP+G KG+                   KG S   PGP G  G++G  G  GS G TG PG  GE G +GI G  G  G  G  GL G+ 
Sbjct:  296 GLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGP--------SGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTI-GAAGLPGRDGLPGPPGPPGPPSPEFETETLHNK-ESGFPGLRGEQGP---KGNLGLKGIKGDSGFCACDG--------GVPNTGPP---------------------GEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPG--EKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHP---------------------------GKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPG---------------------------------------------IPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSG-KPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDN 1070          

HSP 6 Score: 123.25 bits (308), Expect = 3.712e-27
Identity = 294/951 (30.91%), Postives = 371/951 (39.01%), Query Frame = 1
Query: 2065 GEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIP-GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTA---------------GFP-GNKGSKGETGLSGIPGKHGKVGNSGK-----------------DGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE--------------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKG-------------------------------YKGNSGFPDITLKGYKGIPGEIGPKGFQG------------------------------LPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKG--IIGMI-GEMGSQGDKGDTGERGSIG--------------------IQGYQGEKGNQGSLGLK--------------------GLKGNQG----PAGDGIKGMKGLIGP---QGQKGESGYKGVQGLAGDKGPKGFPGKN----IMGSKGEKGNKGRI------------GEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQG-IGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G  G  G  G DGY G  G  G+ G KG KG    + P   KG +GD GLPG +    P G  G  G VG  G  G +G  G    +        G  GEKGVKG  G                 GFP G KGSKGE G  G PG  G  G  G                   G +G MG +G  G  G++G++G +G  G+ G +G++G +G IG PG                GD GV G+PG                                     GD+G  GLRG SG  G   L G PG L     GP+GF G  G++GNPG                                  +   SGFP   L+G +G  G +G KG +G                              LPG KG +G+ G  G  G  G  G  GP G  G +G+KG  I+  I G  G +GD G  G RG IG                     QG+ GEKG  G  G K                    GL G++G    P   G+ G KG+  P    G  G SG+ G  G  G KG +G PG        GSKGE G+ G +            GE G+ GF G  G  GLPG IG  G  G +G  GD                                         ++    E+G +G  G KG +G+ G  G +G+ G+ G  GPKG +G  G  G  G  G  G +G  G++G+ GL G  G  G  G+ G KG +G +G  G +  +G+ G      +G  G  G  G KG  G  G AG     GP G++G +G +G  G  G PG  G  G +G  G  G         GP G  G  G KG+ G+ GP GIP  +       ++GD G +G  G  G  G R
Sbjct:  127 GTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLA-PGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLK-----------------------------------GDEGIQGLRGPSGVPGLPALSGVPGAL-----GPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPG--LRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGD-------------------------------------IFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGL-----KGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM-------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPR 985          

HSP 7 Score: 109.768 bits (273), Expect = 4.829e-23
Identity = 209/713 (29.31%), Postives = 260/713 (36.47%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPK------------------GIKGERGDTGLPGKEAEK--------------------IPGD-KGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYK---------------------GDNGEKGVKGSQGT---------------AGFP-GNKGSKGETGLSGIPGKHGKVGN-----------------SGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE--------------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSG--------------------FPDITL----KGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSG---------------------LRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG---------------PAGDGIKGMKGLIGPQGQ--------------------------KGESGYKGVQGLAGDK------------GPKGFPGKN----IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            G +GP+G +G  G  G  GL+G  G+ G  G  G  GDKG  G+ GF G                    G  G +G  G PG +                        PG  KG++GD G  G  G  G +G       +                          G  GEKGVKG  G                 GFP G KGSKGE G  G PG  G  G                   G  G +G MG +G  G  G++G++G +G  G+ G +G++G +G IG PG                GD GV G+PG                                     GD+G  GLRG SG  G   L G PG L     GP+GF G  G++GNPG +   G +G                    F   TL     G+ G+ GE GPKG  GL   KG KG+ G     G                     L G KG +G +G  G QG  G  G++G +G  G KG  GE     IQG  G++G+ GS G +G+ G  G                 G G  G KGL G  G+                          KG+ G  G QGL G K            GP GFPG        GS+G  G  G+ G  G KG  G  G + LP   GF G  G++GL G
Sbjct:   55 GIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLK-----------------------------------GDEGIQGLRGPSGVPGLPALSGVPGAL-----GPQGFPGLKGDQGNPG-RTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGL---KGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPG 723          

HSP 8 Score: 102.064 bits (253), Expect = 8.929e-21
Identity = 186/541 (34.38%), Postives = 226/541 (41.77%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGE--------PVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXX----AKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNV-----TGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPK--GDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDG 1860
            G LG  G  G  G  GKPG  G KG+RG PG  G+ G  G  G  GP G+ G  G+ G  G  G  G PG KG +G  G  G   K         +G  G++G+PG  G  G KG  G   P    LPA  G KG KG  G  G  G  G  G PG +G+ G  G  G +G  G  G  GE        PV + S  +    +  KGDKG   +            KG+ G  GPPG  G  G  G      G  G  G  G  GL G++G  G  G  G PGE+GS G  G                       G  G SGL G KG  G T++ISG+       G  G +G KG  G+ G+ G PG++G  G  G+ G +G  G  G        GE G  G  G +G  G  G  G  G KG  G  G+ G++  G  G KG +G  GP   G  G AG  GP GEKG  G +G   PG                                     G  G +GD+GFPG+ G  G+ G
Sbjct:  773 GFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVK---------KGLPGLKGLPGNPGLVGLKGSPGS--PGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSP---------------------GLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLN--GLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPG-IGIGAPG-----------------------------------KPGLRGQKGDRGFPGLQGPAGLPG 1243          

HSP 9 Score: 93.2041 bits (230), Expect = 5.143e-18
Identity = 168/485 (34.64%), Postives = 210/485 (43.30%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS----LPQEGVLPA---ERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMIS-LDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGD---------------EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKG 1650
            G+ G  G  GF G  G PG +G  G  G PG  GE G++G +G  G  G  G  G++G++G   +            +G  G  G+PG+ G  G +G DG+ G  G  G KG  G  G S    LP     P     RG+ G  G SG +G IG  G  G  G KG  G+ G  G  G  G KG  G P   I+ +    G  G KG+KGY            +   G+ G+RG             KG  G  G +G  GL G  G   P    G+PG+ G PG  G  G PG  GPPGP G    +GD G  G  G+ G KG KGD   I G  +G+ G+ G KG +G  G  G PG                 G RG SGLQG   + G    +  V  P          + G+ G TG  G QG  GL+G KG+ G+             G  G  G+ GL GP G  G  G+ GP G  G
Sbjct: 1011 GVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVE-----------ISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG--------IGAPGKPGLRG------------QKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQ-GIPG-FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQG---DPGQTPTAEAVQVPPGPLGLPG--IDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPG 1457          

HSP 10 Score: 86.6557 bits (213), Expect = 5.038e-16
Identity = 164/501 (32.73%), Postives = 206/501 (41.12%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGI---NXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQG---IPGMQGEKGRKGPKG------FSLPQEGVLPAERGDKGAKGFSGLKGEIGE--------------FGDVGEPGNKGMIGYQGDKGDIGEL--------------GFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGI---RXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------------------MIGTKGRKGVNGLTGPKGDTGDAGEA------GPIGEKGDIGDVGTS-IPG 1683
            E G  G +G+QGPKG +G KG++G+SG    +G     G  G  G  G  G  G PG KGA G +G  G QG    PG+ G  G  GPKG       S  Q   +P +RGD G++GF G+ GE G+               G  G PG KG+ G  G+KG  G                G  G+KG+       D   G+ G  G KG +    +  +       G  G    +G  G  G  G  G+ G +G  GS G   L  + G  GP G+ G PG  G PGK G+                      G  G+ GL G KG  GD         G +G +G  G KG  GD G+PG +G  G  GL GP GE+G+ G    V +             G  G +G  G +G  GL G  G  G+                       + G KG  G  GL G KG  G  G A      GP GEKG +G VG   IPG
Sbjct:  453 ESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQG--MPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGK-------DGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLP---------------------GMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQ------------PGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPG 911          

HSP 11 Score: 86.6557 bits (213), Expect = 5.081e-16
Identity = 186/549 (33.88%), Postives = 228/549 (41.53%), Query Frame = 1
Query:  298 LLGPKGE---MGFGGHEGKPGFRGVKGDR------------GPPGALGEKGNEGYKGDQGPKGMI------------GDKGVQGNSGINXXXXXXXXXXXXXYTGE-------------EGCCGKPGQ------KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVLPAERGDKGA----------------KGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDI---------GELGFKGEKGEPVK-----MISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKG--IRXXXXXXXXXXXXXAKGYEGR-AGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGD-------TIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPG 1683
            L GPKGE   +GF G  G PG  G+ G R            GP G  G  G +G +G+ GP G+             GDKG QG++G NG  G  G KG  G  G              +G  GKPG       +G  GL+G  G+ G PGM GE G +G +G   LP    LP  +GD G                  GF G KG  G  G++G PGNKG  G  G  GD+         G  G +GE G P        I    S G IG KG  G+     L          G  G  I G PGP G  G  G KGY G   G+ G  GL+G +GD G  G  G  G  G+PG                            AG  G  G  GL G+               +  +GD G+ G  GI G +G  GD+G  G SGL G +G KG +G    +  PG+ GP G+ G  G+ GK G RG  G +G  G         +   G  G+ G+ G  G TGD G  GP+G +G  G  G  IPG
Sbjct:  891 LSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSL---------------------IAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQV-PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPG--IPG 1415          

HSP 12 Score: 85.5001 bits (210), Expect = 1.160e-15
Identity = 211/662 (31.87%), Postives = 264/662 (39.88%), Query Frame = 1
Query: 2101 GYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPG---------------NKGSKGETGLSGIPGKH-GKVGNSGKDGEKGNMGRKGENGLDGR------------------RGRQGNMGIKGVKGLEGVKGDRG---------------FIGFP----GEKGDIGVTGVPGDSITGPX-----------XXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGF--------QGNIGERGNPGIKGYKGNSGFPDIT-------LKGYKGIPGEIGPKGFQGLPGEKGFKGE--IGPTGT-----------------------------SGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGS---------------------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGV-----------------------QGLAGDKGPKGFPGKNIM------------------GSKGEKGNKGRIGEMGVKGFK---------GDIGPIGLPGSIGFQGQEGQRGLKG 3540
            G  G+ G  GI G  G +G  G +G  G+KGERG  GL G    K        GD G +G  GF G  G   +        +G  G  G  G+QG  GFPG                KGSKG+  L+  PG   G  G+ G  G  G  G +G  G  G                    G  GNMG+ G +G +GVKGD G               F+GFP    G KG+ G  G PG  I+GP            G+KG+KG  G+ G +G  G  G++G  GQ G KG  G  G +G +G EG  GD     IG  GP  F         GN G+ G PG+ G KG+ G   +        L    G+PG +GP+GF GL G++G  G   IG  G                              SG  G +G+QGP+G  G++G KG  G     G                       G KG  G+RGS G QG  G  G  G LG  G KG +G P    I+GM G    +G  G  G++GV                       QG  G+KG  G PG+                     G  G+KG  G  G+ G+ G K         G  GP G PG+ GF G +G RGL G
Sbjct:   46 GARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPK--------GDKGPMGVPGFLGINGIPGHPGQ--PGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLA--PGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGL-GFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPG--ISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGD-----IGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGD---RGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPG 684          

HSP 13 Score: 75.0998 bits (183), Expect = 1.386e-12
Identity = 143/424 (33.73%), Postives = 184/424 (43.40%), Query Frame = 1
Query: 2344 KGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVT---------GVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGI---------------------LAIGEKGPKGFQGNIGERGNPGIKGYKGN---SGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKG--------EIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQG-----------YQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGR--IGEMGV 3453
            KG  G  G  G QG  G  G  GS G +GL G  G  G +G  G  G+KG MG  G  G++G  G  G  G +G  GL+G  G +G +GFPG  G  G+          G  GD +  P   KG K                        GD G  GL G +G +G  G  G  G                      + +G +G KG +G++G  G  G     G     GFP    KG KG  GE GPKGF G+ G  GF G        E G  G  GL G +G  G +G +G  GQ+G  G +G  G  G +G  G++G IG+ G             G  G+ G  GL GLKG+     +GI+G++      G  G  G   + G+ G  GP+GFPG      KG++GN GR  IG  G+
Sbjct:   45 KGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMK------------------------GDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFP----KGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGD-----EGIQGLR------GPSGVPGLPALSGVPGALGPQGFPGL-----KGDQGNPGRTTIGAAGL 424          

HSP 14 Score: 67.0106 bits (162), Expect = 4.631e-10
Identity = 131/414 (31.64%), Postives = 172/414 (41.55%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT---------------IDISG--NVTGVRGDRGEKGEKGIDGDRGIPGDE---------------GSRGDSGLQGPIGEKGNKGR 1413
            N      +G  GPKG+ G  G +G  G  G+ G+ G PG  GE G  G  GD G   + G  G  G +G+ G+ G PG  G +G  G  G  G  G KG  G  G  G+ G+PG +G  G  GP    +P    LP  +G+KG  G             +G PG  G+ G +GD+G  G  G  G  G P + + SL       G  GD G                 G  G     G  GD G  G  G +G  G +G  G  G+ G+LG  G  G+PG  G+PGK G  G PG  G                 G +G +G  GL+GD                + + G   + G+ GD G +G  G+ G +G+PG                 G  G  GLQGP G +G  G+
Sbjct: 1070 NGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVG---LPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG-----------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIA-----GQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPG---------------MKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQ 1449          

HSP 15 Score: 65.0846 bits (157), Expect = 1.723e-9
Identity = 164/531 (30.89%), Postives = 199/531 (37.48%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXX--------XXXXXYTGEEGCCGKPGQ---KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGF---KGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGD-----------------EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMI----GTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
             KG +G KG+ GPKG  G  G  G  G+                  GP+G  G EG  G PGQ   KG  G  G +G QGI G +G+ G  GP  F      V+    GD G  G  GLKG+ G  G  G  G  G+    G  G +G  GF   KG++G P +                              E +   + G                 G  G  G KG  GLKGI+GD G     G     G PG+PG  G  G  G PG +G +G  G  GA G +G  G  G  G +         I   + G+ GDRG+ G +G  G  G PG                  +G  G+ GL G  GEKG+ G            P      RGL G  GK G  G +GL G KG+    +I    G  G  G  G  GPKG  G  G  G  G  G  G+ G+  PG                                     G  G RG+KG PG PG  G DGL
Sbjct:  253 PKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGF---------------PGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGP----RGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGS--PGLVH-----------------------------LPELPGFPGPRGEKGLPGFPGLPGKDGL 733          

HSP 16 Score: 60.8474 bits (146), Expect = 3.017e-8
Identity = 198/632 (31.33%), Postives = 245/632 (38.77%), Query Frame = 1
Query:  241 ESAAAICNRSNCT-ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGE--------------LGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEV----MIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGA--------EGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT--------IDISGNVT-------GVRGDRGEKGEKGIDGDRG------------IPGDEGSRGDSGLQGPIGEKGNKGRSR----------------------GVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG----SCFNCSDGDAGNRGDKGFPGIPGERGID 1857
            +S    C   +C+  C C    G +G  G  G +G  G +G  G  G  G  GE+G  G  G  GPKG  G  GV G  GING  G PG  GP+G  G +GC G  G  G  G  GY G+ G PG+ G+KG KG        + VL A    KG KG  GL G  G  G  G PG  G +G  G  G  G               LGF+GEKG                 KGD G         +T E+      KG+KG +G PGP G  G +G  G+ G   +            GL G RG +G  G  G PG+ G  G                         +G  G +G +G +G KGD         IDI G V        GV G  G KG++GI G RG            +PG  G +G  GL+G   ++GN GR+                             E     E G  GL G+ G +G  G KG+KGD G    D               G  G  G+ GL G +GD G  G  GP G  G +G +G S P                           G+KG    S      GD G+ G +GF G+ GE G D
Sbjct:   24 KSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKG--------DPVL-APGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGV----------------KGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGT------------------------LGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKG---DQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP--------------------------KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKD 577          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 388.652 bits (997), Expect = 1.737e-109
Identity = 405/1194 (33.92%), Postives = 522/1194 (43.72%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT-LKGYKGIPG---EIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIG-------IQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS----SNGERGQRG----PQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLG-VKGERGDPGPDGYEGQ------------------------------RGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSF-QMTMGHNIKTMQSEDLIAKCLVCMRN 5445
              G  GPSG  G PG  G +G RGL G  G+ G SG  G+ G  GL       G  G RG+ GLPG      PG  G  G  G +G  G  G KG   ++            E G  G QG  G  G+KG  G++GL G+ G HGK G  G  GE+G+ G  G+ G  G  G  G  GIKG  GL G  G  G  G PG+KG  G  G PG  +                                    KG  GL+G  G+ G  GL G PG  + G  G     G  GE+G+ G  G+ G  G P I   +G KGIPG   ++GP G  G PGEKG +G  GP G    R    +   +G KG QG  G  G  G  G +G+ G  G  G  G       I+G  G+ G  G +G++GL G +G +G  G  GM G  G QG +G  G  G  GL G KG  G     I GS G KG  G  G  G KG  G IG IG PG+   +G++G+ G+ GD                                    VG  G        G +GE G  G  G++G  G  G  G +G +G  G+ G +G NG+ G                                                + G+ G +      GE+G  G      G  G +G+KG+ G  G +GP G  G  GI L   + G+ GDPG  G +G+                               GPKGPKGD+G    + G  GE G+KG +GE G +G  G  G  G+ G  G++G  G +G  G QG  G+                                        IPG  GD G  G  G +G KG PGI G  G  G  G  G  G+    G +G  G +G  G+ GP G             PG  G++    G     HSQS ++P CP     LW GYS L + G E+AH  DL   GSCL  FS +PF++C   E C Y+ RND++YWLS+   + M M ++ TQ+  Y+SRC VCEAPS+  A HSQ    P+CP GW +LW G SFLM+T  GA GGGQ L SPGSCL  F+   F+EC+ A+G C Y+     FWL   +  + F ++ +   +K  Q    +++C VCM++
Sbjct:  659 IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPG-----FPGLPGKDGLPGMIGSPGLPGSKGATGDIF---------GAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIV-----------------------------------KKGLPGLKGLPGNPGLVGLKGSPG--SPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQ-TVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGN---KGEDGKVGVSGD------------------------------------VGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGT-------------------------------------KGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPG-FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDG-------------------IPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFG------------MPGMPGQSM-RVGYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPM-MPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKS 1690          

HSP 2 Score: 147.902 bits (372), Expect = 9.535e-35
Identity = 278/866 (32.10%), Postives = 342/866 (39.49%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGE------KGLAGFSGPKGIKGERGDTGLPGKEA---------------EKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKG------SKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGL---VGDPGILAI-GEKGPKGFQGNIGERGNP------GIK---GYKGNSGFPDIT----------------------LKGYKGIPGEIGPKGFQGLPGE------------KGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKG-------------VQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG-RSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPD-----GYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRG 4365
            G RGD G  G QG  G  G  G  G SG  G KGE      +G+ G  G  G +G RG  G PGK+                +  PG+KG+ G  GE G  G  G  G             GD G+ G+ G QG    PG+KG        G  G SG PG  G  G  G  G  G  G+ G +G  G  G  G + +  + G  G +G++G  GFPG  G  G+ G+ G               +               G  G+ G +G TG +G  GD G  GL    G PG+L   GE+G  G  G +G+ G P      GIK   G  G  GFP I+                      L G KG+PG  G  G +G PG             KG KG +G  G  G+ G  G  G +G KG+ G  G +G  G  G+ G+KGD G  G +GI   +    N   L LKG KG+QG AG       G  GP+G KGE+G  G             ++G++G  GP GF     MG +G  G KG  G  G  G  G+ G  G+ GS G  G  G  GLKGD G T                                             G  G  G+ GE G KG KG  GL G +G     G KG++G+ G+ G++                                       G+ G  G  G++G R   G  G  G QG  G  G  G  G  G  G  G  G    GL G KG  G PGP      G  G  GPKG KG  G  I  PG  G  G KG +G  G  GP G+PG+ G      I G  GD G  G
Sbjct:  513 GARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQG---LPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSP------------GLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSN---LWLKGDKGSQGSAGS-----NGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGF-----MGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEI-----------------------------------------SGSPGPKGQPGESGFKGTKGRDGLIGNIGFP---GNKGEDGKVGVSGDV---------------------------------------GLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLN--GLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPG 1265          

HSP 3 Score: 145.976 bits (367), Expect = 4.437e-34
Identity = 331/974 (33.98%), Postives = 423/974 (43.43%), Query Frame = 1
Query:  322 GFGGHEGK---PGFRGVKGDRG------PPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIP------------GDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXX-LRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDT 3174
            G  G +GK   PG +G+ G +G       PG+ G  G  G  G  GPKG  G  G  G  G +G KG PG  G        G  G  G+KG  G  G  G  G+PGM G  G  G KG +     +  AE G  G +G  GL G  G  GD G PG KG+       G  G LG KGE+G P        + G++G  G  G S    +   +    + G  G  G  G  G  G  G KG  G    KG  GLKG+ G+ G +G  G P   GSPG  G+  + G +G  G  G+ G  G  G  G  G +G KG+ G T  +    +G  G  GEKG++G  G  GIP            GD+GS+G +G  G  G +G+KG +     PG  G  G  G ++G+ GK G  G  G +GL G KG  G+    G  G  G  G+ G  G  G +G  G  G+ G   ++  S PG +G  G  G  G  GR G+ G  GF G KG      DG  G  GD G PG PG  G+ G+ G                                                     G  G SG +G  G +G  GL G  G+ G  G  G++G  G KG  G  GP  I G  G  GLPG + EK  G  GI   +G  G  G +G+K                 G++G  G QG AG PG  G    + ++G PG  G+ G  G+ G  G  G  G  G    +G  G+ G  G+ G +G KGD+G  GF G  G++G+ G+ G+                        G +G  G+ G  GD GF G++G++G +G  GL GDPG     E      Q   G  G PGI G  G +G P     G +G  G  G KG  G+PG+ G  G  GP G  G  G  G QGP G++G  GQ+G  GM G  G     G T
Sbjct:  631 GLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGAT---GDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGV------HGKPGLLGPKGERGSP-------GTPGQVGQPGTPGSSGPYGIKGKSG---LPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSP---GSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM--GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGS-PGPKGQPGESGFKGTKGRDGLIGNIGFPGNKG-----EDGKVGVSGDVGLPGAPGFPGVAGMRG---------------------------------------------------EPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPS-ITGVPGPAGLPGPKGEK--GYPGI--GIGAPGKPGLRGQK-----------------GDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEP-----------------------GFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEA----VQVPPGPLGLPGIDGIPGLTGDP-----GAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYT 1469          

HSP 4 Score: 136.732 bits (343), Expect = 2.814e-31
Identity = 287/848 (33.84%), Postives = 360/848 (42.45%), Query Frame = 1
Query:  313 GEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQG--YDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGE------IGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMI---------SLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGD---LGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTG--------VRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKG--VKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS----IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYS----GKKGESGIHGDKGEKGLAGFSGPKG------------IKGERGDTGLPGKEAE-------KIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQ----------GNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG 2655
            G  G  G  G PGF G KG RG PG  G+ G+ G KG+ G  G++    + G  G  G+KG PG  G  G  G  G  G PG  G+ G  G  +    G PG QG +G  G KGF    +  LP  +G  G  G  G KGE       G+ G  G PG+ G  G +G  G  G  GF G  G P K           S+ K +G  G KG  G      L  +     + G   + GP G  G +G  G  G  G  G  G  GLKGI G    +GP G+ G PGE G  G PG  GIP  R P      +G +G  G+AG++G  G +G KG+                  ++G  G+ G  G  G RG+PG +GS G +G  G  GE G+                     +G+ G  G  G  G  GLKGD G  V+     G KG+ G +G  G KG  G  G  G  G KG+ G VG S    +PGA G  G+ G  G  G  G  G +G IG  GS         G  G KGFPG P   G+ GLNG  G +G                                             T G  GPS   G PG  G  G +G  GY     G  G+ G+ G KG++G  G  GP G            I G+ GD G PG + E         PG  G   + G+ GD GF G  G            KG  G++G+ G  G  G  G KG +GE G  G PGK G  G+ G  G KG  G +G +GL G  G+           G +G+ G+ G+ G+ GD G  G  G +G  G+ G+PG
Sbjct:  661 GSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFL--GDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVK-KGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGS---------------------QGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGS--------PGLIGPKGFPGFP---GLHGLNGLPGTKG---------------------------------------------THGTPGPS-ITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGP-----------KGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPG 1416          

HSP 5 Score: 130.954 bits (328), Expect = 1.367e-29
Identity = 277/892 (31.05%), Postives = 349/892 (39.13%), Query Frame = 1
Query: 2074 GEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEA---------EKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHG------------KVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGIL-AIGEKGPKG---------FQGNIGERGNPGIKGYKG-----------------------NSGFPDITLKGYKGIPGEI-----------------------------GPKGFQGLPGEKG------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGS---------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG-RSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQG-PAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGD-------------------KGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G  G RG  G  G +G  G  G KG  G  G +G +GI+G++GD GLPG +             PGD G+ G  G  GD+G +G +G         +   G     GV G+ G  GFPG KG +G  G + I G  G              G    + E   +  K E+G  G RG QG    KG  GL+G+KGD GF    G        GVP                          G+ G  G  G +G  G  G RG+ G  G +G  G PG++  +G  GPKG          QG  G+RG+ G +G++G                         GFP    KG  G+PGE                              G  G QGLPG KG        G  GP+G  G  G  G +G +G  G  GQ G  G  GE GS          G  G  GE+G  G  G  G+ G  G +G  GL G++G  GD      G  G QG +G +G+KG  G +G  G KG  GK  ++G KGE+G+ G  G++G  G  G  GP G+ G  G  G  G  G+ G                             G  G +G  G  G   K+   G KG  G  G +G KG  G+ G++G     GPKG KG  G  G  G                                               GL GI G R   G  G  G  G +G  G  GE GD G  GP G P+  + +  L +KG++G  G  G  G  GP+G KG+                   KG S   PGP G  G++G  G  GS G TG PG  GE G +GI G  G  G  G  GL G+ 
Sbjct:  297 GLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGP--------SGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTI-GAAGLPGRDGLPGPPGPPGPPSPEFETETLHNK-ESGFPGLRGEQGP---KGNLGLKGIKGDSGFCACDG--------GVPNTGPP---------------------GEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPG--EKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHP---------------------------GKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPG---------------------------------------------IPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSG-KPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDN 1071          

HSP 6 Score: 122.865 bits (307), Expect = 4.108e-27
Identity = 294/951 (30.91%), Postives = 371/951 (39.01%), Query Frame = 1
Query: 2065 GEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIP-GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTA---------------GFP-GNKGSKGETGLSGIPGKHGKVGNSGK-----------------DGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE--------------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKG-------------------------------YKGNSGFPDITLKGYKGIPGEIGPKGFQG------------------------------LPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKG--IIGMI-GEMGSQGDKGDTGERGSIG--------------------IQGYQGEKGNQGSLGLK--------------------GLKGNQG----PAGDGIKGMKGLIGP---QGQKGESGYKGVQGLAGDKGPKGFPGKN----IMGSKGEKGNKGRI------------GEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQG-IGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G  G  G  G DGY G  G  G+ G KG KG    + P   KG +GD GLPG +    P G  G  G VG  G  G +G  G    +        G  GEKGVKG  G                 GFP G KGSKGE G  G PG  G  G  G                   G +G MG +G  G  G++G++G +G  G+ G +G++G +G IG PG                GD GV G+PG                                     GD+G  GLRG SG  G   L G PG L     GP+GF G  G++GNPG                                  +   SGFP   L+G +G  G +G KG +G                              LPG KG +G+ G  G  G  G  G  GP G  G +G+KG  I+  I G  G +GD G  G RG IG                     QG+ GEKG  G  G K                    GL G++G    P   G+ G KG+  P    G  G SG+ G  G  G KG +G PG        GSKGE G+ G +            GE G+ GF G  G  GLPG IG  G  G +G  GD                                         ++    E+G +G  G KG +G+ G  G +G+ G+ G  GPKG +G  G  G  G  G  G +G  G++G+ GL G  G  G  G+ G KG +G +G  G +  +G+ G      +G  G  G  G KG  G  G AG     GP G++G +G +G  G  G PG  G  G +G  G  G         GP G  G  G KG+ G+ GP GIP  +       ++GD G +G  G  G  G R
Sbjct:  128 GTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLA-PGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLK-----------------------------------GDEGIQGLRGPSGVPGLPALSGVPGAL-----GPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPG--LRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGD-------------------------------------IFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGL-----KGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM-------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPR 986          

HSP 7 Score: 109.383 bits (272), Expect = 5.767e-23
Identity = 209/713 (29.31%), Postives = 260/713 (36.47%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPK------------------GIKGERGDTGLPGKEAEK--------------------IPGD-KGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYK---------------------GDNGEKGVKGSQGT---------------AGFP-GNKGSKGETGLSGIPGKHGKVGN-----------------SGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE--------------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSG--------------------FPDITL----KGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSG---------------------LRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG---------------PAGDGIKGMKGLIGPQGQ--------------------------KGESGYKGVQGLAGDK------------GPKGFPGKN----IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            G +GP+G +G  G  G  GL+G  G+ G  G  G  GDKG  G+ GF G                    G  G +G  G PG +                        PG  KG++GD G  G  G  G +G       +                          G  GEKGVKG  G                 GFP G KGSKGE G  G PG  G  G                   G  G +G MG +G  G  G++G++G +G  G+ G +G++G +G IG PG                GD GV G+PG                                     GD+G  GLRG SG  G   L G PG L     GP+GF G  G++GNPG +   G +G                    F   TL     G+ G+ GE GPKG  GL   KG KG+ G     G                     L G KG +G +G  G QG  G  G++G +G  G KG  GE     IQG  G++G+ GS G +G+ G  G                 G G  G KGL G  G+                          KG+ G  G QGL G K            GP GFPG        GS+G  G  G+ G  G KG  G  G + LP   GF G  G++GL G
Sbjct:   56 GIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLK-----------------------------------GDEGIQGLRGPSGVPGLPALSGVPGAL-----GPQGFPGLKGDQGNPG-RTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGL---KGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPG 724          

HSP 8 Score: 102.064 bits (253), Expect = 9.965e-21
Identity = 186/541 (34.38%), Postives = 226/541 (41.77%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGE--------PVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXX----AKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNV-----TGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPK--GDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDG 1860
            G LG  G  G  G  GKPG  G KG+RG PG  G+ G  G  G  GP G+ G  G+ G  G  G  G PG KG +G  G  G   K         +G  G++G+PG  G  G KG  G   P    LPA  G KG KG  G  G  G  G  G PG +G+ G  G  G +G  G  G  GE        PV + S  +    +  KGDKG   +            KG+ G  GPPG  G  G  G      G  G  G  G  GL G++G  G  G  G PGE+GS G  G                       G  G SGL G KG  G T++ISG+       G  G +G KG  G+ G+ G PG++G  G  G+ G +G  G  G        GE G  G  G +G  G  G  G  G KG  G  G+ G++  G  G KG +G  GP   G  G AG  GP GEKG  G +G   PG                                     G  G +GD+GFPG+ G  G+ G
Sbjct:  774 GFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVK---------KGLPGLKGLPGNPGLVGLKGSPGS--PGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSP---------------------GLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLN--GLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPG-IGIGAPG-----------------------------------KPGLRGQKGDRGFPGLQGPAGLPG 1244          

HSP 9 Score: 92.8189 bits (229), Expect = 5.549e-18
Identity = 168/485 (34.64%), Postives = 210/485 (43.30%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS----LPQEGVLPA---ERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMIS-LDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGD---------------EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKG 1650
            G+ G  G  GF G  G PG +G  G  G PG  GE G++G +G  G  G  G  G++G++G   +            +G  G  G+PG+ G  G +G DG+ G  G  G KG  G  G S    LP     P     RG+ G  G SG +G IG  G  G  G KG  G+ G  G  G  G KG  G P   I+ +    G  G KG+KGY            +   G+ G+RG             KG  G  G +G  GL G  G   P    G+PG+ G PG  G  G PG  GPPGP G    +GD G  G  G+ G KG KGD   I G  +G+ G+ G KG +G  G  G PG                 G RG SGLQG   + G    +  V  P          + G+ G TG  G QG  GL+G KG+ G+             G  G  G+ GL GP G  G  G+ GP G  G
Sbjct: 1012 GVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVE-----------ISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG--------IGAPGKPGLRG------------QKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQ-GIPG-FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQG---DPGQTPTAEAVQVPPGPLGLPG--IDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPG 1458          

HSP 10 Score: 86.2705 bits (212), Expect = 5.529e-16
Identity = 186/549 (33.88%), Postives = 228/549 (41.53%), Query Frame = 1
Query:  298 LLGPKGE---MGFGGHEGKPGFRGVKGDR------------GPPGALGEKGNEGYKGDQGPKGMI------------GDKGVQGNSGINXXXXXXXXXXXXXYTGE-------------EGCCGKPGQ------KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVLPAERGDKGA----------------KGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDI---------GELGFKGEKGEPVK-----MISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKG--IRXXXXXXXXXXXXXAKGYEGR-AGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGD-------TIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPG 1683
            L GPKGE   +GF G  G PG  G+ G R            GP G  G  G +G +G+ GP G+             GDKG QG++G NG  G  G KG  G  G              +G  GKPG       +G  GL+G  G+ G PGM GE G +G +G   LP    LP  +GD G                  GF G KG  G  G++G PGNKG  G  G  GD+         G  G +GE G P        I    S G IG KG  G+     L          G  G  I G PGP G  G  G KGY G   G+ G  GL+G +GD G  G  G  G  G+PG                            AG  G  G  GL G+               +  +GD G+ G  GI G +G  GD+G  G SGL G +G KG +G    +  PG+ GP G+ G  G+ GK G RG  G +G  G         +   G  G+ G+ G  G TGD G  GP+G +G  G  G  IPG
Sbjct:  892 LSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSL---------------------IAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQV-PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPG--IPG 1416          

HSP 11 Score: 86.2705 bits (212), Expect = 5.718e-16
Identity = 163/499 (32.67%), Postives = 205/499 (41.08%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGI---NXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQG---IPGMQGEKGRKGPKGFS----LPQEGVLPAERGDKGAKGFSGLKGEIGE--------------FGDVGEPGNKGMIGYQGDKGDIGEL--------------GFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGI---RXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------------------MIGTKGRKGVNGLTGPKGDTGDAGEA------GPIGEKGDIGDVGTS-IPG 1683
            E G  G +G+QGPKG +G KG++G+SG    +G     G  G  G  G  G  G PG KGA G +G  G QG    PG+ G  G  GPKG      L     +P +RGD G++GF G+ GE G+               G  G PG KG+ G  G+KG  G                G  G+KG+       D   G+ G  G KG +    +  +       G  G    +G  G  G  G  G+ G +G  GS G   L  + G  GP G+ G PG  G PGK G+                      G  G+ GL G KG  GD         G +G +G  G KG  GD G+PG +G  G  GL GP GE+G+ G    V +             G  G +G  G +G  GL G  G  G+                       + G KG  G  GL G KG  G  G A      GP GEKG +G VG   IPG
Sbjct:  454 ESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGK-------DGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLP---------------------GMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQ------------PGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPG 912          

HSP 12 Score: 85.1149 bits (209), Expect = 1.317e-15
Identity = 211/662 (31.87%), Postives = 264/662 (39.88%), Query Frame = 1
Query: 2101 GYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPG---------------NKGSKGETGLSGIPGKH-GKVGNSGKDGEKGNMGRKGENGLDGR------------------RGRQGNMGIKGVKGLEGVKGDRG---------------FIGFP----GEKGDIGVTGVPGDSITGPX-----------XXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGF--------QGNIGERGNPGIKGYKGNSGFPDIT-------LKGYKGIPGEIGPKGFQGLPGEKGFKGE--IGPTGT-----------------------------SGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGS---------------------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGV-----------------------QGLAGDKGPKGFPGKNIM------------------GSKGEKGNKGRIGEMGVKGFK---------GDIGPIGLPGSIGFQGQEGQRGLKG 3540
            G  G+ G  GI G  G +G  G +G  G+KGERG  GL G    K        GD G +G  GF G  G   +        +G  G  G  G+QG  GFPG                KGSKG+  L+  PG   G  G+ G  G  G  G +G  G  G                    G  GNMG+ G +G +GVKGD G               F+GFP    G KG+ G  G PG  I+GP            G+KG+KG  G+ G +G  G  G++G  GQ G KG  G  G +G +G EG  GD     IG  GP  F         GN G+ G PG+ G KG+ G   +        L    G+PG +GP+GF GL G++G  G   IG  G                              SG  G +G+QGP+G  G++G KG  G     G                       G KG  G+RGS G QG  G  G  G LG  G KG +G P    I+GM G    +G  G  G++GV                       QG  G+KG  G PG+                     G  G+KG  G  G+ G+ G K         G  GP G PG+ GF G +G RGL G
Sbjct:   47 GARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPK--------GDKGPMGVPGFLGINGIPGHPGQ--PGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLA--PGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGL-GFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPG--ISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGD-----IGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGD---RGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPG 685          

HSP 13 Score: 75.0998 bits (183), Expect = 1.398e-12
Identity = 143/424 (33.73%), Postives = 184/424 (43.40%), Query Frame = 1
Query: 2344 KGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVT---------GVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGI---------------------LAIGEKGPKGFQGNIGERGNPGIKGYKGN---SGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKG--------EIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQG-----------YQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGR--IGEMGV 3453
            KG  G  G  G QG  G  G  GS G +GL G  G  G +G  G  G+KG MG  G  G++G  G  G  G +G  GL+G  G +G +GFPG  G  G+          G  GD +  P   KG K                        GD G  GL G +G +G  G  G  G                      + +G +G KG +G++G  G  G     G     GFP    KG KG  GE GPKGF G+ G  GF G        E G  G  GL G +G  G +G +G  GQ+G  G +G  G  G +G  G++G IG+ G             G  G+ G  GL GLKG+     +GI+G++      G  G  G   + G+ G  GP+GFPG      KG++GN GR  IG  G+
Sbjct:   46 KGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMK------------------------GDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFP----KGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGD-----EGIQGLR------GPSGVPGLPALSGVPGALGPQGFPGL-----KGDQGNPGRTTIGAAGL 425          

HSP 14 Score: 66.6254 bits (161), Expect = 4.996e-10
Identity = 131/408 (32.11%), Postives = 172/408 (42.16%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKG--LKGDTIDISGN---------VTGVRGDRGEKGEKGIDGDRGIPGDE---------------GSRGDSGLQGPIGEKGNKGR 1413
            N      +G  GPKG+ G  G +G  G  G+ G+ G PG  GE G  G  GD G   + G  G  G +G+ G+ G PG  G +G  G  G  G  G KG  G  G  G+ G+PG +G  G  GP    +P    LP  +G+KG  G             +G PG  G+ G +GD+G  G  G  G  G P + + SL       G  GD G                 G  G     G  GD G  G  G +G  G +G  G  G+ G+LG  G  G+PG  G+PGK G  G PG  G  G           G  G+SGL+G  G     + + +            + G+ GD G +G  G+ G +G+PG                 G  G  GLQGP G +G  G+
Sbjct: 1071 NGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVG---LPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG-----------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIA-----GQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKA---------GPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQ 1450          

HSP 15 Score: 65.0846 bits (157), Expect = 1.680e-9
Identity = 164/531 (30.89%), Postives = 199/531 (37.48%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXX--------XXXXXYTGEEGCCGKPGQ---KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGF---KGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGD-----------------EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMI----GTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
             KG +G KG+ GPKG  G  G  G  G+                  GP+G  G EG  G PGQ   KG  G  G +G QGI G +G+ G  GP  F      V+    GD G  G  GLKG+ G  G  G  G  G+    G  G +G  GF   KG++G P +                              E +   + G                 G  G  G KG  GLKGI+GD G     G     G PG+PG  G  G  G PG +G +G  G  GA G +G  G  G  G +         I   + G+ GDRG+ G +G  G  G PG                  +G  G+ GL G  GEKG+ G            P      RGL G  GK G  G +GL G KG+    +I    G  G  G  G  GPKG  G  G  G  G  G  G+ G+  PG                                     G  G RG+KG PG PG  G DGL
Sbjct:  254 PKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGF---------------PGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGP----RGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGS--PGLVH-----------------------------LPELPGFPGPRGEKGLPGFPGLPGKDGL 734          

HSP 16 Score: 60.8474 bits (146), Expect = 3.174e-8
Identity = 198/632 (31.33%), Postives = 245/632 (38.77%), Query Frame = 1
Query:  241 ESAAAICNRSNCT-ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGE--------------LGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEV----MIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGA--------EGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT--------IDISGNVT-------GVRGDRGEKGEKGIDGDRG------------IPGDEGSRGDSGLQGPIGEKGNKGRSR----------------------GVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG----SCFNCSDGDAGNRGDKGFPGIPGERGID 1857
            +S    C   +C+  C C    G +G  G  G +G  G +G  G  G  G  GE+G  G  G  GPKG  G  GV G  GING  G PG  GP+G  G +GC G  G  G  G  GY G+ G PG+ G+KG KG        + VL A    KG KG  GL G  G  G  G PG  G +G  G  G  G               LGF+GEKG                 KGD G         +T E+      KG+KG +G PGP G  G +G  G+ G   +            GL G RG +G  G  G PG+ G  G                         +G  G +G +G +G KGD         IDI G V        GV G  G KG++GI G RG            +PG  G +G  GL+G   ++GN GR+                             E     E G  GL G+ G +G  G KG+KGD G    D               G  G  G+ GL G +GD G  G  GP G  G +G +G S P                           G+KG    S      GD G+ G +GF G+ GE G D
Sbjct:   25 KSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKG--------DPVL-APGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGV----------------KGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGT------------------------LGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKG---DQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP--------------------------KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKD 578          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 389.037 bits (998), Expect = 1.853e-109
Identity = 405/1194 (33.92%), Postives = 522/1194 (43.72%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT-LKGYKGIPG---EIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIG-------IQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS----SNGERGQRG----PQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLG-VKGERGDPGPDGYEGQ------------------------------RGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSF-QMTMGHNIKTMQSEDLIAKCLVCMRN 5445
              G  GPSG  G PG  G +G RGL G  G+ G SG  G+ G  GL       G  G RG+ GLPG      PG  G  G  G +G  G  G KG   ++            E G  G QG  G  G+KG  G++GL G+ G HGK G  G  GE+G+ G  G+ G  G  G  G  GIKG  GL G  G  G  G PG+KG  G  G PG  +                                    KG  GL+G  G+ G  GL G PG  + G  G     G  GE+G+ G  G+ G  G P I   +G KGIPG   ++GP G  G PGEKG +G  GP G    R    +   +G KG QG  G  G  G  G +G+ G  G  G  G       I+G  G+ G  G +G++GL G +G +G  G  GM G  G QG +G  G  G  GL G KG  G     I GS G KG  G  G  G KG  G IG IG PG+   +G++G+ G+ GD                                    VG  G        G +GE G  G  G++G  G  G  G +G +G  G+ G +G NG+ G                                                + G+ G +      GE+G  G      G  G +G+KG+ G  G +GP G  G  GI L   + G+ GDPG  G +G+                               GPKGPKGD+G    + G  GE G+KG +GE G +G  G  G  G+ G  G++G  G +G  G QG  G+                                        IPG  GD G  G  G +G KG PGI G  G  G  G  G  G+    G +G  G +G  G+ GP G             PG  G++    G     HSQS ++P CP     LW GYS L + G E+AH  DL   GSCL  FS +PF++C   E C Y+ RND++YWLS+   + M M ++ TQ+  Y+SRC VCEAPS+  A HSQ    P+CP GW +LW G SFLM+T  GA GGGQ L SPGSCL  F+   F+EC+ A+G C Y+     FWL   +  + F ++ +   +K  Q    +++C VCM++
Sbjct:  675 IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPG-----FPGLPGKDGLPGMIGSPGLPGSKGATGDIF---------GAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIV-----------------------------------KKGLPGLKGLPGNPGLVGLKGSPG--SPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQ-TVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGN---KGEDGKVGVSGD------------------------------------VGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGT-------------------------------------KGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPG-FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDG-------------------IPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFG------------MPGMPGQSM-RVGYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPM-MPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKS 1706          

HSP 2 Score: 139.428 bits (350), Expect = 3.605e-32
Identity = 331/991 (33.40%), Postives = 423/991 (42.68%), Query Frame = 1
Query:  322 GFGGHEGK---PGFRGVKGDRGP-----------------------PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIP------------GDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXX-LRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDT 3174
            G  G +GK   PG +G+ G +G                        PG+ G  G  G  G  GPKG  G  G  G  G +G KG PG  G        G  G  G+KG  G  G  G  G+PGM G  G  G KG +     +  AE G  G +G  GL G  G  GD G PG KG+       G  G LG KGE+G P        + G++G  G  G S    +   +    + G  G  G  G  G  G  G KG  G    KG  GLKG+ G+ G +G  G P   GSPG  G+  + G +G  G  G+ G  G  G  G  G +G KG+ G T  +    +G  G  GEKG++G  G  GIP            GD+GS+G +G  G  G +G+KG +     PG  G  G  G ++G+ GK G  G  G +GL G KG  G+    G  G  G  G+ G  G  G +G  G  G+ G   ++  S PG +G  G  G  G  GR G+ G  GF G KG      DG  G  GD G PG PG  G+ G+ G                                                     G  G SG +G  G +G  GL G  G+ G  G  G++G  G KG  G  GP  I G  G  GLPG + EK  G  GI   +G  G  G +G+K                 G++G  G QG AG PG  G    + ++G PG  G+ G  G+ G  G  G  G  G    +G  G+ G  G+ G +G KGD+G  GF G  G++G+ G+ G+                        G +G  G+ G  GD GF G++G++G +G  GL GDPG     E      Q   G  G PGI G  G +G P     G +G  G  G KG  G+PG+ G  G  GP G  G  G  G QGP G++G  GQ+G  GM G  G     G T
Sbjct:  630 GLPGDKGKDGLPGQQGLPGSKGDCCCREVGKGDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGAT---GDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGV------HGKPGLLGPKGERGSP-------GTPGQVGQPGTPGSSGPYGIKGKSG---LPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSP---GSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM--GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGS-PGPKGQPGESGFKGTKGRDGLIGNIGFPGNKG-----EDGKVGVSGDVGLPGAPGFPGVAGMRG---------------------------------------------------EPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPS-ITGVPGPAGLPGPKGEK--GYPGI--GIGAPGKPGLRGQK-----------------GDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEP-----------------------GFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEA----VQVPPGPLGLPGIDGIPGLTGDP-----GAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYT 1485          

HSP 3 Score: 137.117 bits (344), Expect = 2.290e-31
Identity = 290/865 (33.53%), Postives = 363/865 (41.97%), Query Frame = 1
Query:  262 NRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQG--YDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGE------IGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMI---------SLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGD---LGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTG--------VRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKG--VKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS----IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYS----GKKGESGIHGDKGEKGLAGFSGPKG------------IKGERGDTGLPGKEAE-------KIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQ----------GNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG 2655
             R     C   G  GP G        G PGF G KG RG PG  G+ G+ G KG+ G  G++    + G  G  G+KG PG  G  G  G  G  G PG  G+ G  G  +    G PG QG +G  G KGF    +  LP  +G  G  G  G KGE       G+ G  G PG+ G  G +G  G  G  GF G  G P K           S+ K +G  G KG  G      L  +     + G   + GP G  G +G  G  G  G  G  G  GLKGI G    +GP G+ G PGE G  G PG  GIP  R P      +G +G  G+AG++G  G +G KG+                  ++G  G+ G  G  G RG+PG +GS G +G  G  GE G+                     +G+ G  G  G  G  GLKGD G  V+     G KG+ G +G  G KG  G  G  G  G KG+ G VG S    +PGA G  G+ G  G  G  G  G +G IG  GS         G  G KGFPG P   G+ GLNG  G +G                                             T G  GPS   G PG  G  G +G  GY     G  G+ G+ G KG++G  G  GP G            I G+ GD G PG + E         PG  G   + G+ GD GF G  G            KG  G++G+ G  G  G  G KG +GE G  G PGK G  G+ G  G KG  G +G +GL G  G+           G +G+ G+ G+ G+ GD G  G  G +G  G+ G+PG
Sbjct:  666 ERGITLPCIIPGSYGPSG------FPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFL--GDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVK-KGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGS---------------------QGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGS--------PGLIGPKGFPGFP---GLHGLNGLPGTKG---------------------------------------------THGTPGPS-ITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGP-----------KGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPG 1432          

HSP 4 Score: 133.265 bits (334), Expect = 3.190e-30
Identity = 271/901 (30.08%), Postives = 360/901 (39.96%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHG-----------------DKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNV--------------------------LLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPG------ILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGY------KGIPGEIGPKGF---QGLPGEKG-----------------------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQG---------DKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG-RSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQG-PAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGD-------------------KGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            +EG +GP G++G  G +G  GL G  G  G+KG+ G+ G                 D G  GL G  G +GI+G RG +G+PG     +P   G+ G +G  G  G KG++G      +                            T +  ++G  G++G QG  G  G KG KG++G     G     G  G+ G  G  G  G  GL G RG +G+ G +G  G  G+ G  G  G  G+KG+  ++ +                                         +G  G RG+SG +GF G++G+PG      +  +      G QG  GE+G PG+ G KG+ G P +   G       +G+PG+ G  G    QGLPG KG                         G  GP+G  G  G  G +G +G  G  GQ G  G  GE GS G           G  GE+G  G  G  G+ G  G +G  GL G++G  GD      G  G QG +G +G+KG  G +G  G KG  GK  ++G KGE+G+ G  G++G  G  G  GP G+ G  G  G  G  G+ G                             G  G +G  G  G   K+   G KG  G  G +G KG  G+ G++G     GPKG KG  G  G  G                                               GL GI G R   G  G  G  G +G  G  GE GD G  GP G P+  + +  L +KG++G  G  G  G  GP+G KG+                   KG S   PGP G  G++G  G  GS G TG PG  GE G +GI G  G  G  G  GL G+ 
Sbjct:  306 SEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPG-----LPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTI-----------------------------------------QGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGDCCCREVGKGDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHP---------------------------GKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPG---------------------------------------------IPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSG-KPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDN 1087          

HSP 5 Score: 115.161 bits (287), Expect = 1.127e-24
Identity = 294/970 (30.31%), Postives = 372/970 (38.35%), Query Frame = 1
Query: 2065 GEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIP-GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTA---------------GFP-GNKGSKGETGLSGIPGKHGKVGNSGK-----------------DGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE--------------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKG-------------------------------YKGNSGFPDITLKGYKGIPGEIGPKGFQG------------------------------LPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKG--IIGMI-GEMGSQGDKGDTGERGSIG--------------------IQGYQGEKGNQGSLGLK--------------------GLKGNQGPAGDGIKGMKGLIGPQ--------------------------GQKGESGYKGVQGLAGDKGPKGFPGKN----IMGSKGEKGNKGRI------------GEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQG-IGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G  G  G  G DGY G  G  G+ G KG KG    + P   KG +GD GLPG +    P G  G  G VG  G  G +G  G    +        G  GEKGVKG  G                 GFP G KGSKGE G  G PG  G  G  G                   G +G MG +G  G  G++G++G +G  G+ G +G++G +G IG PG                GD GV G+PG                                     GD+G  GLRG SG  G   L G PG L     GP+GF G  G++GNPG                                  +   SGFP   L+G +G  G +G KG +G                              LPG KG +G+ G  G  G  G  G  GP G  G +G+KG  I+  I G  G +GD G  G RG IG                     QG+ GEKG  G  G K                    GL G++G   DG+ G +GL G +                          G  G SG+ G  G  G KG +G PG        GSKGE G+ G +            GE G+ GF G  G  GLPG IG  G  G +G  GD                                         ++    E+G +G  G KG +G+ G  G +G+ G+ G  GPKG +G  G  G  G  G  G +G  G++G+ GL G  G  G  G+ G KG +G +G  G +  +G+ G      +G  G  G  G KG  G  G AG     GP G++G +G +G  G  G PG  G  G +G  G  G         GP G  G  G KG+ G+ GP GIP  +       ++GD G +G  G  G  G R
Sbjct:  127 GTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLA-PGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLK-----------------------------------GDEGIQGLRGPSGVPGLPALSGVPGAL-----GPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPG--LRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKG--KDGLPGQQGLPGSKGDCCCREVGKGDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGD-------------------------------------IFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGL-----KGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM-------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPR 1002          

HSP 6 Score: 109.383 bits (272), Expect = 6.297e-23
Identity = 209/691 (30.25%), Postives = 260/691 (37.63%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPK------------------GIKGERGDTGLPGKEAEK--------------------IPGD-KGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYK---------------------GDNGEKGVKGSQGT---------------AGFP-GNKGSKGETGLSGIPGKHGKVGN-----------------SGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE--------------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSG--------------------FPDITL----KGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSG---------------------LRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG---------------PAGDGIKGMKGLIGPQGQK-----------GESGYKGVQGLAGDKGPKGFPGKN-IMGSKG-----EKGNKGRIGEMGVKG---FKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            G +GP+G +G  G  G  GL+G  G+ G  G  G  GDKG  G+ GF G                    G  G +G  G PG +                        PG  KG++GD G  G  G  G +G       +                          G  GEKGVKG  G                 GFP G KGSKGE G  G PG  G  G                   G  G +G MG +G  G  G++G++G +G  G+ G +G++G +G IG PG                GD GV G+PG                                     GD+G  GLRG SG  G   L G PG L     GP+GF G  G++GNPG +   G +G                    F   TL     G+ G+ GE GPKG  GL   KG KG+ G     G                     L G KG +G +G  G QG  G  G++G +G  G KG  GE     IQG  G++G+ GS G +G+ G  G                 G G  G KGL G  G+K           G  G  G +GL GDKG  G PG+  + GSKG     E G      E G+       G  GP G PG+ GF G +G RGL G
Sbjct:   55 GIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLK-----------------------------------GDEGIQGLRGPSGVPGLPALSGVPGAL-----GPQGFPGLKGDQGNPG-RTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGL---KGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGDCCCREVGKGDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPG 701          

HSP 7 Score: 92.8189 bits (229), Expect = 5.660e-18
Identity = 168/485 (34.64%), Postives = 210/485 (43.30%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS----LPQEGVLPA---ERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMIS-LDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGD---------------EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKG 1650
            G+ G  G  GF G  G PG +G  G  G PG  GE G++G +G  G  G  G  G++G++G   +            +G  G  G+PG+ G  G +G DG+ G  G  G KG  G  G S    LP     P     RG+ G  G SG +G IG  G  G  G KG  G+ G  G  G  G KG  G P   I+ +    G  G KG+KGY            +   G+ G+RG             KG  G  G +G  GL G  G   P    G+PG+ G PG  G  G PG  GPPGP G    +GD G  G  G+ G KG KGD   I G  +G+ G+ G KG +G  G  G PG                 G RG SGLQG   + G    +  V  P          + G+ G TG  G QG  GL+G KG+ G+             G  G  G+ GL GP G  G  G+ GP G  G
Sbjct: 1028 GVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVE-----------ISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG--------IGAPGKPGLRG------------QKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQ-GIPG-FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQG---DPGQTPTAEAVQVPPGPLGLPG--IDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPG 1474          

HSP 8 Score: 84.3445 bits (207), Expect = 2.134e-15
Identity = 181/565 (32.04%), Postives = 235/565 (41.59%), Query Frame = 1
Query: 2101 GYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPG---------------NKGSKGETGLSGIPGKH-GKVGNSGKDGEKGNMGRKGENGLDGR------------------RGRQGNMGIKGVKGLEGVKGDRG---------------FIGFP----GEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFP------DITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSG---LRGRKGDQGPQGYKGVQGQKGIIG--MIGEMGSQGD-----------------KGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG-------------------------DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIG 3477
            G  G+ G  GI G  G +G  G +G  G+KGERG  GL G    K        GD G +G  GF G  G   +        +G  G  G  G+QG  GFPG                KGSKG+  L+  PG   G  G+ G  G  G  G +G  G  G                    G  GNMG+ G +G +GVKGD G               F+GFP    G KG+ G  G PG  I+GP G  G         +                 +KG  GL G  G  G EG+ G P     G++G KG  G  G  G  GI+G KG+ G P      DI      G PG+ G  G  GL G++G +G  GP+G  G   L G  G  GPQG+ G++G +G  G   IG  G  G                  + +T      G  G +GE+G +G+LGLKG+KG+ G                             G+KG +G  G  G +G +G  G+ G  G  GPKG  G+ I+ +   +G  G  G+ G +GF+G IG
Sbjct:   46 GARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPK--------GDKGPMGVPGFLGINGIPGHPGQ--PGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLA--PGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGL-GFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPG--ISGPPGFPGLGTTGEKGEKG----------------EKGIPGLPGPRGPMGSEGVQGPP-----GQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTI--QGMPGDRGDSGSQGFRGVIG 572          

HSP 9 Score: 82.8037 bits (203), Expect = 6.328e-15
Identity = 163/521 (31.29%), Postives = 203/521 (38.96%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGI---NXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQG---IPGMQGEKGRKGPKGFS----LPQEGVLPAERGDKGAKGFSGLKGEIGE--------------FGDVGEPGNKGMIGYQGDK-----------------------GDIGELGFKGEKGEP----------VKMISLDKSRGEI------GDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------------------MIGTKGRKGVNGLTGPKGDTGDAGEA------GPIGEKGDIGDVGTS-IPG 1683
            E G  G +G+QGPKG +G KG++G+SG    +G     G  G  G  G  G  G PG KGA G +G  G QG    PG+ G  G  GPKG      L     +P +RGD G++GF G+ GE G+               G  G PG KG+ G  G+K                       GD G+ G  G++G P          V    LD  RG        G  G  G+  T           + G  G              G+ G +G  GS G   L  + G  GP G+ G PG  G PGK G+                      G  G+ GL G KG  GD         G +G +G  G KG  GD G+PG +G  G  GL GP GE+G+ G    V +             G  G +G  G +G  GL G  G  G+                       + G KG  G  GL G KG  G  G A      GP GEKG +G VG   IPG
Sbjct:  453 ESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGDCCCREVGKGDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPG------------QPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLP---------------------GMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQ------------PGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPG 928          

HSP 10 Score: 75.485 bits (184), Expect = 1.288e-12
Identity = 143/424 (33.73%), Postives = 184/424 (43.40%), Query Frame = 1
Query: 2344 KGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVT---------GVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGI---------------------LAIGEKGPKGFQGNIGERGNPGIKGYKGN---SGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKG--------EIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQG-----------YQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGR--IGEMGV 3453
            KG  G  G  G QG  G  G  GS G +GL G  G  G +G  G  G+KG MG  G  G++G  G  G  G +G  GL+G  G +G +GFPG  G  G+          G  GD +  P   KG K                        GD G  GL G +G +G  G  G  G                      + +G +G KG +G++G  G  G     G     GFP    KG KG  GE GPKGF G+ G  GF G        E G  G  GL G +G  G +G +G  GQ+G  G +G  G  G +G  G++G IG+ G             G  G+ G  GL GLKG+     +GI+G++      G  G  G   + G+ G  GP+GFPG      KG++GN GR  IG  G+
Sbjct:   45 KGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMK------------------------GDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFP----KGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGD-----EGIQGLR------GPSGVPGLPALSGVPGALGPQGFPGL-----KGDQGNPGRTTIGAAGL 424          

HSP 11 Score: 66.6254 bits (161), Expect = 5.309e-10
Identity = 131/408 (32.11%), Postives = 172/408 (42.16%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKG--LKGDTIDISGN---------VTGVRGDRGEKGEKGIDGDRGIPGDE---------------GSRGDSGLQGPIGEKGNKGR 1413
            N      +G  GPKG+ G  G +G  G  G+ G+ G PG  GE G  G  GD G   + G  G  G +G+ G+ G PG  G +G  G  G  G  G KG  G  G  G+ G+PG +G  G  GP    +P    LP  +G+KG  G             +G PG  G+ G +GD+G  G  G  G  G P + + SL       G  GD G                 G  G     G  GD G  G  G +G  G +G  G  G+ G+LG  G  G+PG  G+PGK G  G PG  G  G           G  G+SGL+G  G     + + +            + G+ GD G +G  G+ G +G+PG                 G  G  GLQGP G +G  G+
Sbjct: 1087 NGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVG---LPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG-----------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIA-----GQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKA---------GPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQ 1466          

HSP 12 Score: 60.8474 bits (146), Expect = 3.576e-8
Identity = 193/632 (30.54%), Postives = 242/632 (38.29%), Query Frame = 1
Query:  241 ESAAAICNRSNCT-ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGE--------------LGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEV----MIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGA--------EGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT--------IDISGNVT-------GVRGDRGEKGEKGIDGDRG------------IPGDEGSRGDSGLQGPIGEKGNKGRSR----------------------GVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG----SCFNCSDGDAGNRGDKGFPGIPGERGID 1857
            +S    C   +C+  C C    G +G  G  G +G  G +G  G  G  G  GE+G  G  G  GPKG  G  GV G  GING  G PG  GP+G  G +GC G    +GA G  G DG  G+ G  G  G+KG KG  +   G     +GD G  G  G+ G        G PG  G +G  G  G  G               LGF+GEKG                 KGD G         +T E+      KG+KG +G PGP G  G +G  G+ G   +            GL G RG +G  G  G PG+ G  G                         +G  G +G +G +G KGD         IDI G V        GV G  G KG++GI G RG            +PG  G +G  GL+G   ++GN GR+                             E     E G  GL G+ G +G  G KG+KGD G    D               G  G  G+ GL G +GD G  G  GP G  G +G +G S P                           G+KG    S      GD G+ G +GF G+ GE G D
Sbjct:   24 KSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGT---QGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGP------QGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGV----------------KGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGT------------------------LGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKG---DQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP--------------------------KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKD 577          

HSP 13 Score: 57.3806 bits (137), Expect = 3.940e-7
Identity = 169/540 (31.30%), Postives = 204/540 (37.78%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXX--------XXXXXYTGEEGCCGKPGQ---KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGF---KGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGD-----------------EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLT---------GPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSC----FNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
             KG +G KG+ GPKG  G  G  G  G+                  GP+G  G EG  G PGQ   KG  G  G +G QGI G +G+ G  GP  F      V+    GD G  G  GLKG+ G  G  G  G  G+    G  G +G  GF   KG++G P +                              E +   + G                 G  G  G KG  GLKGI+GD G     G     G PG+PG  G  G  G PG +G +G  G  GA G +G  G  G  G +         I   + G+ GDRG+ G +G  G  G PG                  +G  G+ GL G  GEKG+ G            P      RGL G  GK G  G +GL G KG      +G        G+T         GP G  G  G  GP G +G  G  G   PG+ GSK                     GE GS          G  G RG+KG PG PG  G DGL
Sbjct:  253 PKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGF---------------PGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGP----RGLPGDKGKDGLPGQQGLPGSKGDCCCREVGKGDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQ--PGSSGSK---------------------GEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGL 750          

HSP 14 Score: 52.7582 bits (125), Expect = 9.737e-6
Identity = 77/236 (32.63%), Postives = 101/236 (42.80%), Query Frame = 1
Query: 3016 EKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQ---------------GYQGEKGNQGSLGLKGLKGNQGPAGDGI----KGMKG--LIGP---QGQKGESGYKGVQGLAGDKGPKGFPGK-----------------------NI-MGSKGEKGNKGRI------------GEMGVKGF-KGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            EKG +G  GP G  G  G +G  G  G  G++G++G  G++G  G +GDKG  G  G +GI                G  G  G QG++G  G  G  G  G       KG KG  ++ P   +G KG+ G  G+ G+ G +G  GFPG                        N+ +G +GEKG KG +            GE+   GF KG  G  G PG  GF G  G  G  G
Sbjct:   44 EKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPG 279          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 385.185 bits (988), Expect = 2.260e-108
Identity = 404/1184 (34.12%), Postives = 522/1184 (44.09%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIG----EKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPG---EIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIG-------IQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS----SNGERGQRG----PQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLG-VKGERGDPGPDGYEGQRGP---------------KGPKGDKGFSIL--YPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSF-QMTMGHNIKTMQSEDLIAKCLVCMRN 5445
              G  GPSG  G PG  G +G RGL G  G+ G SG  G+ G  GL       G  G RG+ GLPG      PG  G  G  G +G  G  G KG   ++            E G  G QG  G  G+KG  G++GL G+ G HGK G  G  GE+G+ G  G+ G  G  G  G  GIKG  GL G  G  G  G PG+KG  G  G PG  +                                    KG  GL+G  G+ G  GL G PG   +       GPKG +G++G  G PGI G  G  G      +G KGIPG   ++GP G  G PGEKG +G  GP G    R    +   +G KG QG  G  G  G  G +G+ G  G  G  G       I+G  G+ G  G +G++GL G +G +G  G  GM G  G QG +G  G  G  GL G KG  G     I GS G KG  G  G  G KG  G IG IG PG+   +G++G+ G+ GD                                    VG  G        G +GE G  G  G++G  G  G  G +G +G  G+ G +G NG+ G                                                + G+ G +      GE+G  G      G  G +G+KG+ G  G +GP G  G  GI L   + G+ GDPG  G +G+RG                +G  GD GF  +  + G  GE G+KG +GE G +G  G  G  G+ G  G++G  G +G  G QG  G+                                        IPG  GD G  G  G +G KG PGI G  G  G  G  G  G+    G +G  G +G  G+ GP G             PG  G++    G     HSQS ++P CP     LW GYS L + G E+AH  DL   GSCL  FS +PF++C   E C Y+ RND++YWLS+   + M M ++ TQ+  Y+SRC VCEAPS+  A HSQ    P+CP GW +LW G SFLM+T  GA GGGQ L SPGSCL  F+   F+EC+ A+G C Y+     FWL   +  + F ++ +   +K  Q    +++C VCM++
Sbjct:  658 IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPG-----FPGLPGKDGLPGMIGSPGLPGSKGATGDIF---------GAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIV-----------------------------------KKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPG-----TRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQ-TVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGN---KGEDGKVGVSGD------------------------------------VGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGT-------------------------------------KGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDG-------------------IPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFG------------MPGMPGQSM-RVGYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPM-MPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKS 1677          

HSP 2 Score: 148.673 bits (374), Expect = 6.709e-35
Identity = 278/866 (32.10%), Postives = 342/866 (39.49%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGE------KGLAGFSGPKGIKGERGDTGLPGKEA---------------EKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKG------SKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGL---VGDPGILAI-GEKGPKGFQGNIGERGNP------GIK---GYKGNSGFPDIT----------------------LKGYKGIPGEIGPKGFQGLPGE------------KGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKG-------------VQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG-RSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPD-----GYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRG 4365
            G RGD G  G QG  G  G  G  G SG  G KGE      +G+ G  G  G +G RG  G PGK+                +  PG+KG+ G  GE G  G  G  G             GD G+ G+ G QG    PG+KG        G  G SG PG  G  G  G  G  G  G+ G +G  G  G  G + +  + G  G +G++G  GFPG  G  G+ G+ G               +               G  G+ G +G TG +G  GD G  GL    G PG+L   GE+G  G  G +G+ G P      GIK   G  G  GFP I+                      L G KG+PG  G  G +G PG             KG KG +G  G  G+ G  G  G +G KG+ G  G +G  G  G+ G+KGD G  G +GI   +    N   L LKG KG+QG AG       G  GP+G KGE+G  G             ++G++G  GP GF     MG +G  G KG  G  G  G  G+ G  G+ GS G  G  G  GLKGD G T                                             G  G  G+ GE G KG KG  GL G +G     G KG++G+ G+ G++                                       G+ G  G  G++G R   G  G  G QG  G  G  G  G  G  G  G  G    GL G KG  G PGP      G  G  GPKG KG  G  I  PG  G  G KG +G  G  GP G+PG+ G      I G  GD G  G
Sbjct:  512 GARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQG---LPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSP------------GLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSN---LWLKGDKGSQGSAGS-----NGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGF-----MGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEI-----------------------------------------SGSPGPKGQPGESGFKGTKGRDGLIGNIGFP---GNKGEDGKVGVSGDV---------------------------------------GLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLN--GLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPG 1264          

HSP 3 Score: 137.117 bits (344), Expect = 1.821e-31
Identity = 282/833 (33.85%), Postives = 355/833 (42.62%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQG--YDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGE------IGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMI---------SLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGD---LGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTG--------VRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKG--VKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS----IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYS----GKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGN---KGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQ----------GNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG 2655
             G  G  G  G PGF G KG RG PG  G+ G+ G KG+ G  G++    + G  G  G+KG PG  G  G  G  G  G PG  G+ G  G  +    G PG QG +G  G KGF    +  LP  +G  G  G  G KGE       G+ G  G PG+ G  G +G  G  G  GF G  G P K           S+ K +G  G KG  G      L  +     + G   + GP G  G +G  G  G  G  G  G  GLKGI G    +GP G+ G PGE G  G PG  GIP  R P      +G +G  G+AG++G  G +G KG+                  ++G  G+ G  G  G RG+PG +GS G +G  G  GE G+                     +G+ G  G  G  G  GLKGD G  V+     G KG+ G +G  G KG  G  G  G  G KG+ G VG S    +PGA G  G+ G  G  G  G  G +G IG  GS         G  G KGFPG P   G+ GLNG  G +G                                             T G  GPS   G PG  G  G +G  GY     G  G+ G+ G KG++G  G  GP G+ G  G + LP   A + PGD G  G  GE                    +  +GD G+ G  G  G +G PG    KG +GE G  G PGK G  G+ G  G KG  G +G +GL G  G+           G +G+ G+ G+ G+ GD G  G  G +G  G+ G+PG
Sbjct:  659 PGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFL--GDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVK-KGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGS---------------------QGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGS--------PGLIGPKGFPGFP---GLHGLNGLPGTKG---------------------------------------------THGTPGPS-ITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGIS-LPSLIAGQ-PGDPGRPGLDGER-----GRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPG 1403          

HSP 4 Score: 131.339 bits (329), Expect = 1.103e-29
Identity = 277/892 (31.05%), Postives = 349/892 (39.13%), Query Frame = 1
Query: 2074 GEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEA---------EKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHG------------KVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGIL-AIGEKGPKG---------FQGNIGERGNPGIKGYKG-----------------------NSGFPDITLKGYKGIPGEI-----------------------------GPKGFQGLPGEKG------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGS---------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG-RSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQG-PAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGD-------------------KGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G  G RG  G  G +G  G  G KG  G  G +G +GI+G++GD GLPG +             PGD G+ G  G  GD+G +G +G         +   G     GV G+ G  GFPG KG +G  G + I G  G              G    + E   +  K E+G  G RG QG    KG  GL+G+KGD GF    G        GVP                          G+ G  G  G +G  G  G RG+ G  G +G  G PG++  +G  GPKG          QG  G+RG+ G +G++G                         GFP    KG  G+PGE                              G  G QGLPG KG        G  GP+G  G  G  G +G +G  G  GQ G  G  GE GS          G  G  GE+G  G  G  G+ G  G +G  GL G++G  GD      G  G QG +G +G+KG  G +G  G KG  GK  ++G KGE+G+ G  G++G  G  G  GP G+ G  G  G  G  G+ G                             G  G +G  G  G   K+   G KG  G  G +G KG  G+ G++G     GPKG KG  G  G  G                                               GL GI G R   G  G  G  G +G  G  GE GD G  GP G P+  + +  L +KG++G  G  G  G  GP+G KG+                   KG S   PGP G  G++G  G  GS G TG PG  GE G +GI G  G  G  G  GL G+ 
Sbjct:  296 GLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGP--------SGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTI-GAAGLPGRDGLPGPPGPPGPPSPEFETETLHNK-ESGFPGLRGEQGP---KGNLGLKGIKGDSGFCACDG--------GVPNTGPP---------------------GEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPG--EKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHP---------------------------GKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPG---------------------------------------------IPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSG-KPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDN 1070          

HSP 5 Score: 123.25 bits (308), Expect = 3.098e-27
Identity = 294/951 (30.91%), Postives = 371/951 (39.01%), Query Frame = 1
Query: 2065 GEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIP-GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTA---------------GFP-GNKGSKGETGLSGIPGKHGKVGNSGK-----------------DGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE--------------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKG-------------------------------YKGNSGFPDITLKGYKGIPGEIGPKGFQG------------------------------LPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKG--IIGMI-GEMGSQGDKGDTGERGSIG--------------------IQGYQGEKGNQGSLGLK--------------------GLKGNQG----PAGDGIKGMKGLIGP---QGQKGESGYKGVQGLAGDKGPKGFPGKN----IMGSKGEKGNKGRI------------GEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQG-IGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G  G  G  G DGY G  G  G+ G KG KG    + P   KG +GD GLPG +    P G  G  G VG  G  G +G  G    +        G  GEKGVKG  G                 GFP G KGSKGE G  G PG  G  G  G                   G +G MG +G  G  G++G++G +G  G+ G +G++G +G IG PG                GD GV G+PG                                     GD+G  GLRG SG  G   L G PG L     GP+GF G  G++GNPG                                  +   SGFP   L+G +G  G +G KG +G                              LPG KG +G+ G  G  G  G  G  GP G  G +G+KG  I+  I G  G +GD G  G RG IG                     QG+ GEKG  G  G K                    GL G++G    P   G+ G KG+  P    G  G SG+ G  G  G KG +G PG        GSKGE G+ G +            GE G+ GF G  G  GLPG IG  G  G +G  GD                                         ++    E+G +G  G KG +G+ G  G +G+ G+ G  GPKG +G  G  G  G  G  G +G  G++G+ GL G  G  G  G+ G KG +G +G  G +  +G+ G      +G  G  G  G KG  G  G AG     GP G++G +G +G  G  G PG  G  G +G  G  G         GP G  G  G KG+ G+ GP GIP  +       ++GD G +G  G  G  G R
Sbjct:  127 GTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLA-PGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLK-----------------------------------GDEGIQGLRGPSGVPGLPALSGVPGAL-----GPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPG--LRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGD-------------------------------------IFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGL-----KGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM-------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPR 985          

HSP 6 Score: 109.768 bits (273), Expect = 4.540e-23
Identity = 209/713 (29.31%), Postives = 260/713 (36.47%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPK------------------GIKGERGDTGLPGKEAEK--------------------IPGD-KGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYK---------------------GDNGEKGVKGSQGT---------------AGFP-GNKGSKGETGLSGIPGKHGKVGN-----------------SGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE--------------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSG--------------------FPDITL----KGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSG---------------------LRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG---------------PAGDGIKGMKGLIGPQGQ--------------------------KGESGYKGVQGLAGDK------------GPKGFPGKN----IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            G +GP+G +G  G  G  GL+G  G+ G  G  G  GDKG  G+ GF G                    G  G +G  G PG +                        PG  KG++GD G  G  G  G +G       +                          G  GEKGVKG  G                 GFP G KGSKGE G  G PG  G  G                   G  G +G MG +G  G  G++G++G +G  G+ G +G++G +G IG PG                GD GV G+PG                                     GD+G  GLRG SG  G   L G PG L     GP+GF G  G++GNPG +   G +G                    F   TL     G+ G+ GE GPKG  GL   KG KG+ G     G                     L G KG +G +G  G QG  G  G++G +G  G KG  GE     IQG  G++G+ GS G +G+ G  G                 G G  G KGL G  G+                          KG+ G  G QGL G K            GP GFPG        GS+G  G  G+ G  G KG  G  G + LP   GF G  G++GL G
Sbjct:   55 GIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLK-----------------------------------GDEGIQGLRGPSGVPGLPALSGVPGAL-----GPQGFPGLKGDQGNPG-RTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGL---KGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPG 723          

HSP 7 Score: 102.449 bits (254), Expect = 7.716e-21
Identity = 186/541 (34.38%), Postives = 226/541 (41.77%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGE--------PVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXX----AKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNV-----TGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPK--GDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDG 1860
            G LG  G  G  G  GKPG  G KG+RG PG  G+ G  G  G  GP G+ G  G+ G  G  G  G PG KG +G  G  G   K         +G  G++G+PG  G  G KG  G   P    LPA  G KG KG  G  G  G  G  G PG +G+ G  G  G +G  G  G  GE        PV + S  +    +  KGDKG   +            KG+ G  GPPG  G  G  G      G  G  G  G  GL G++G  G  G  G PGE+GS G  G                       G  G SGL G KG  G T++ISG+       G  G +G KG  G+ G+ G PG++G  G  G+ G +G  G  G        GE G  G  G +G  G  G  G  G KG  G  G+ G++  G  G KG +G  GP   G  G AG  GP GEKG  G +G   PG                                     G  G +GD+GFPG+ G  G+ G
Sbjct:  773 GFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVK---------KGLPGLKGLPGNPGLVGLKGSPGS--PGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSP---------------------GLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLN--GLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPG-IGIGAPG-----------------------------------KPGLRGQKGDRGFPGLQGPAGLPG 1243          

HSP 8 Score: 92.8189 bits (229), Expect = 6.443e-18
Identity = 164/479 (34.24%), Postives = 207/479 (43.22%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS----LPQEGVLPA---ERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMIS-LDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGD---------RGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKG 1650
            G+ G  G  GF G  G PG +G  G  G PG  GE G++G +G  G  G  G  G++G++G   +            +G  G  G+PG+ G  G +G DG+ G  G  G KG  G  G S    LP     P     RG+ G  G SG +G IG  G  G  G KG  G+ G  G  G  G KG  G P   I+ +    G  G KG+KGY            +   G+ G+RG             KG  G  G +G  GL G  G   P    G+PG+ G PG  G  G PG  GPPGP G    +GD G  G  G+ G+ GL G+         G++G RGE G  G  G           G+ G  G RG SGLQG   + G    +  V  P          + G+ G TG  G QG  GL+G KG+ G+             G  G  G+ GL GP G  G  G+ GP G  G
Sbjct: 1011 GVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVE-----------ISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG--------IGAPGKPGLRG------------QKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGFSGLPGEL--------GLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQG---DPGQTPTAEAVQVPPGPLGLPG--IDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPG 1445          

HSP 9 Score: 86.6557 bits (213), Expect = 5.071e-16
Identity = 164/501 (32.73%), Postives = 206/501 (41.12%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGI---NXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQG---IPGMQGEKGRKGPKG------FSLPQEGVLPAERGDKGAKGFSGLKGEIGE--------------FGDVGEPGNKGMIGYQGDKGDIGEL--------------GFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGI---RXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------------------MIGTKGRKGVNGLTGPKGDTGDAGEA------GPIGEKGDIGDVGTS-IPG 1683
            E G  G +G+QGPKG +G KG++G+SG    +G     G  G  G  G  G  G PG KGA G +G  G QG    PG+ G  G  GPKG       S  Q   +P +RGD G++GF G+ GE G+               G  G PG KG+ G  G+KG  G                G  G+KG+       D   G+ G  G KG +    +  +       G  G    +G  G  G  G  G+ G +G  GS G   L  + G  GP G+ G PG  G PGK G+                      G  G+ GL G KG  GD         G +G +G  G KG  GD G+PG +G  G  GL GP GE+G+ G    V +             G  G +G  G +G  GL G  G  G+                       + G KG  G  GL G KG  G  G A      GP GEKG +G VG   IPG
Sbjct:  453 ESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQG--MPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGK-------DGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLP---------------------GMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQ------------PGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPG 911          

HSP 10 Score: 85.5001 bits (210), Expect = 1.110e-15
Identity = 211/662 (31.87%), Postives = 264/662 (39.88%), Query Frame = 1
Query: 2101 GYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPG---------------NKGSKGETGLSGIPGKH-GKVGNSGKDGEKGNMGRKGENGLDGR------------------RGRQGNMGIKGVKGLEGVKGDRG---------------FIGFP----GEKGDIGVTGVPGDSITGPX-----------XXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGF--------QGNIGERGNPGIKGYKGNSGFPDIT-------LKGYKGIPGEIGPKGFQGLPGEKGFKGE--IGPTGT-----------------------------SGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGS---------------------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGV-----------------------QGLAGDKGPKGFPGKNIM------------------GSKGEKGNKGRIGEMGVKGFK---------GDIGPIGLPGSIGFQGQEGQRGLKG 3540
            G  G+ G  GI G  G +G  G +G  G+KGERG  GL G    K        GD G +G  GF G  G   +        +G  G  G  G+QG  GFPG                KGSKG+  L+  PG   G  G+ G  G  G  G +G  G  G                    G  GNMG+ G +G +GVKGD G               F+GFP    G KG+ G  G PG  I+GP            G+KG+KG  G+ G +G  G  G++G  GQ G KG  G  G +G +G EG  GD     IG  GP  F         GN G+ G PG+ G KG+ G   +        L    G+PG +GP+GF GL G++G  G   IG  G                              SG  G +G+QGP+G  G++G KG  G     G                       G KG  G+RGS G QG  G  G  G LG  G KG +G P    I+GM G    +G  G  G++GV                       QG  G+KG  G PG+                     G  G+KG  G  G+ G+ G K         G  GP G PG+ GF G +G RGL G
Sbjct:   46 GARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPK--------GDKGPMGVPGFLGINGIPGHPGQ--PGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLA--PGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGL-GFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPG--ISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGD-----IGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGD---RGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPG 684          

HSP 11 Score: 85.5001 bits (210), Expect = 1.158e-15
Identity = 181/548 (33.03%), Postives = 224/548 (40.88%), Query Frame = 1
Query:  298 LLGPKGE---MGFGGHEGKPGFRGVKGDR------------GPPGALGEKGNEGYKGDQGPKGMI------------GDKGVQGNSGINXXXXXXXXXXXXXYTGE-------------EGCCGKPGQ------KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDV-------GEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKH--GKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGL------KGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKG------------------IDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPG 1683
            L GPKGE   +GF G  G PG  G+ G R            GP G  G  G +G +G+ GP G+             GDKG QG++G NG  G  G KG  G  G              +G  GKPG       +G  GL+G  G+ G PGM GE G +G +G             G  GA G  GLKG+ G+  ++       G+PG  G  G +G  G IG +GF G KGE       D   G  GD G  G      +     E  + G  G +G  GP G  G  G KG+ G  G  G  GL G +G  G  G    G PG  G PG                     P   IGA G  GL      +G+ GL+G         I +   + G  GD G  G  G                    GD G PG  G  G SGL G +G KG +G    +  PG+ GP G+ G  G+ GK G RG  G +G  G         +   G  G+ G+ G  G TGD G  GP+G +G  G  G  IPG
Sbjct:  891 LSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRG-----------SPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGE-------DGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGP--------------KGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQV-PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPG--IPG 1403          

HSP 12 Score: 75.485 bits (184), Expect = 1.240e-12
Identity = 143/424 (33.73%), Postives = 184/424 (43.40%), Query Frame = 1
Query: 2344 KGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVT---------GVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGI---------------------LAIGEKGPKGFQGNIGERGNPGIKGYKGN---SGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKG--------EIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQG-----------YQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGR--IGEMGV 3453
            KG  G  G  G QG  G  G  GS G +GL G  G  G +G  G  G+KG MG  G  G++G  G  G  G +G  GL+G  G +G +GFPG  G  G+          G  GD +  P   KG K                        GD G  GL G +G +G  G  G  G                      + +G +G KG +G++G  G  G     G     GFP    KG KG  GE GPKGF G+ G  GF G        E G  G  GL G +G  G +G +G  GQ+G  G +G  G  G +G  G++G IG+ G             G  G+ G  GL GLKG+     +GI+G++      G  G  G   + G+ G  GP+GFPG      KG++GN GR  IG  G+
Sbjct:   45 KGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMK------------------------GDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFP----KGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGD-----EGIQGLR------GPSGVPGLPALSGVPGALGPQGFPGL-----KGDQGNPGRTTIGAAGL 424          

HSP 13 Score: 69.3218 bits (168), Expect = 8.021e-11
Identity = 133/414 (32.13%), Postives = 178/414 (43.00%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT---------------IDISG--NVTGVRGDRGEKGEKGIDGDRGIPGDE---------------GSRGDSGLQGPIGEKGNKGR 1413
            N      +G  GPKG+ G  G +G  G  G+ G+ G PG  GE G  G  GD    G+ G  G  G +G+ G+ G PG  G +G  G  G  G  G KG  G  G  G+ G+PG +G  G  GP    +P    LP  +G+KG  G             +G PG  G+ G +GD+G  G  G  G  G P + + SL    G+ GD G  G               + G++G  GP GP G  G +  +G  G  G  G  G  G+ G+LG  G  G+PG  G+PGK G  G PG  G                 G +G +G  GL+GD                + + G   + G+ GD G +G  G+ G +G+PG                 G  G  GLQGP G +G  G+
Sbjct: 1070 NGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGD---VGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG-----------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIA--GQPGDPGRPG---------------LDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPG---------------MKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQ 1437          

HSP 14 Score: 65.0846 bits (157), Expect = 1.649e-9
Identity = 164/531 (30.89%), Postives = 199/531 (37.48%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXX--------XXXXXYTGEEGCCGKPGQ---KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGF---KGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGD-----------------EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMI----GTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
             KG +G KG+ GPKG  G  G  G  G+                  GP+G  G EG  G PGQ   KG  G  G +G QGI G +G+ G  GP  F      V+    GD G  G  GLKG+ G  G  G  G  G+    G  G +G  GF   KG++G P +                              E +   + G                 G  G  G KG  GLKGI+GD G     G     G PG+PG  G  G  G PG +G +G  G  GA G +G  G  G  G +         I   + G+ GDRG+ G +G  G  G PG                  +G  G+ GL G  GEKG+ G            P      RGL G  GK G  G +GL G KG+    +I    G  G  G  G  GPKG  G  G  G  G  G  G+ G+  PG                                     G  G RG+KG PG PG  G DGL
Sbjct:  253 PKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGF---------------PGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGP----RGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGS--PGLVH-----------------------------LPELPGFPGPRGEKGLPGFPGLPGKDGL 733          

HSP 15 Score: 61.2326 bits (147), Expect = 2.589e-8
Identity = 193/632 (30.54%), Postives = 242/632 (38.29%), Query Frame = 1
Query:  241 ESAAAICNRSNCT-ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGE--------------LGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEV----MIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGA--------EGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT--------IDISGNVT-------GVRGDRGEKGEKGIDGDRG------------IPGDEGSRGDSGLQGPIGEKGNKGRSR----------------------GVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG----SCFNCSDGDAGNRGDKGFPGIPGERGID 1857
            +S    C   +C+  C C    G +G  G  G +G  G +G  G  G  G  GE+G  G  G  GPKG  G  GV G  GING  G PG  GP+G  G +GC G    +GA G  G DG  G+ G  G  G+KG KG  +   G     +GD G  G  G+ G        G PG  G +G  G  G  G               LGF+GEKG                 KGD G         +T E+      KG+KG +G PGP G  G +G  G+ G   +            GL G RG +G  G  G PG+ G  G                         +G  G +G +G +G KGD         IDI G V        GV G  G KG++GI G RG            +PG  G +G  GL+G   ++GN GR+                             E     E G  GL G+ G +G  G KG+KGD G    D               G  G  G+ GL G +GD G  G  GP G  G +G +G S P                           G+KG    S      GD G+ G +GF G+ GE G D
Sbjct:   24 KSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGT---QGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGP------QGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGV----------------KGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGT------------------------LGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKG---DQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP--------------------------KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKD 577          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 383.645 bits (984), Expect = 5.042e-108
Identity = 396/1173 (33.76%), Postives = 507/1173 (43.22%), Query Frame = 1
Query: 2101 GYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIP-GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGN--SGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKG-------------VQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGEKGEF-----GDAGKRGPQGPAGDQGIGL-----LGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILY-----PGPQGETGVKGP------------------KGEVGSVGPTGIPGSKGEKGERGIEG------DLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSF-QMTMGHNIKTMQSEDLIAKCLVCMRN 5445
            G  G KG+ G+ G +G  G  G + P  I G  G +G PG      P G +G+ G  G+ G  G KGE G    V+  L +  G  G +G KG  G  G PG  G  G  G  G+PG  G  G+    ++G  G  G +G  G  G  G  G  G+KGV G  G+ G +G  G PG  G +G  G PG S                                   G  G  G  G  G  GF G+ G PG      K  KG  G+I ++G PG+KG  GN G     L G KG PG  G  G   L G KG KG +G  G  G+ G  G  G +G KG+ G  G +G  G  G+ G+KGD G  G +GI   +    N   L LKG KG+QG AG       G  GP+G KGE+G  G             ++G++G  GP GF     MG +G  G KG  G  G  G  G+ G  G+ GS G  G  G  GLKGD G T                                           E G KG  G  G +GN G  GN+G  G+VG  G  G  G  G  G+ G                                                +RG  G   S+G +G  GP G+ G  G KG       G AG  GP+G  G  GIG+      G++G++GD    G+ G +GP G  G  G S+       PG  G  G+ G                   +G+ G  G  GIPG KG KG++GI G      +LG KG  G QG  G+                                        IPG  GD G  G  G +G KG PGI G  G  G  G  G  G+    G +G  G +G  G+ GP G             PG  G++    G     HSQS ++P CP     LW GYS L + G E+AH  DL   GSCL  FS +PF++C   E C Y+ RND++YWLS+   + M M ++ TQ+  Y+SRC VCEAPS+  A HSQ    P+CP GW +LW G SFLM+T  GA GGGQ L SPGSCL  F+   F+EC+ A+G C Y+     FWL   +  + F ++ +   +K  Q    +++C VCM++
Sbjct:  630 GLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVH--LPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSS-----------------------------------GPYGIKGKSGLPGAPGFPGISGHPGKKGTRGK--KGPPGSIVKKGLPGLKGLPGNPG-----LVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSN---LWLKGDKGSQGSAGS-----NGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGF-----MGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQ-----------------------------PGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAG------------------------------------------------MRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGD---RGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDG-------------------IPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFG------------MPGMPGQSM-RVGYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPM-MPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKS 1632          

HSP 2 Score: 170.244 bits (430), Expect = 1.419e-41
Identity = 247/696 (35.49%), Postives = 309/696 (44.40%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLA------GFSGPKGIKGERGDTGLPGKE-------AEKIPGDKGIQGDV--------------------GELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGL---SGIPGKHGKVGNSG------------------KDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRG---FIGFPGEKGDIGVTG------VPGDS-ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPG------------------IL--AIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT-LKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQG---YQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQ---------GQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENG 3819
              G  GPSG  G PG  G +G RGL G  G+ G SG  G+ G  GL       GF GP+G KG  G  GLPGK+       +  +PG KG  GD+                    G LGD G  G KG +    +L     G  GE+G  G+ G  G PG  GS G  G+   SG+PG  G  G SG                  K G  G  G  G  GL G +G  G+ G+ G+  L G KG++G   F+GFPG  G  G+ G      +PG +   GP G  G  G+ G  G  G  G    +     L  KG  G +G +G  GF G  GD G                  I+    G+ GP GF   +G RG PG+KG  G +GFP +    G +GI G  G  G  GLPG KG  G+      SG  G KG  G  G+KG +G+ G+IG IG  G++G+ G  G  G +G+ G   + G  G +G  GL G  G+QG  G    G  GLIGP+G    +G  G  GL G KG KG+PG  I    G  G  G  G+ G +GF G  GP GLPG+ G           G  G+ GL G++                           G PG  G  G  G S  + + GD G  G  G  G KGD+G  G SG  G+ G KG  G  G+ G
Sbjct:  658 IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLL-----GPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGF---MGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQT--VEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGP--LGSPGLIGPKGPS-ITGVPGPAGLPGPKGEKGYPGIGI----GAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGER---------------------------GRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGSSGLQGDPG 1309          

HSP 3 Score: 146.362 bits (368), Expect = 2.656e-34
Identity = 199/539 (36.92%), Postives = 251/539 (46.57%), Query Frame = 1
Query: 2035 KGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIP-------GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTK--------YKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVG---NSGKDGEKGNMGRKGENG----LDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQ---------GSLGLKGLKGNQG-----PAGDGIK------GMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-------IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIG 3504
             GP GE+G  G VG  G+ GL G  G +G  GI G  G+ G +G +G  G KG+RG+ G  G  + + P       GDKG QG  G  G  G +G+KG+                   KG +G+ G  G  G  G PG KGS G TG  G+PG+ G  G   + G  G  G  G KG+NG    + G  G +G  G  G KG +G  G  G IGFPG KG+ G  GV GD                        G  G  G  G  G +G  GL G SG +G  G +G PG+  IG KGP    G  G  G PG KG KG  G   I   G  G+ G+ G +GF GL G  G  G  G +  S + G+ GD G  G  G +G+ G  G  G  G   ++GDTG+ G  GI G +G KG+Q         G LGLKG  G QG     P  + ++      G+ G+ G  G  G+ G +G  GL G KG  G PGK+         G+ G+ G  G  G  G +G  G  GP G+PG  G
Sbjct:  892 SGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDV-----------------------GLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGL--IGPKGPS-ITGVPGPAGLPGPKGEKGYPGI-GIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPG 1403          

HSP 4 Score: 134.035 bits (336), Expect = 1.844e-30
Identity = 286/858 (33.33%), Postives = 364/858 (42.42%), Query Frame = 1
Query:  322 GFGGHEGK---PGFRGVKGDRG------PPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIP------------GDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXX-LRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYS--GKKGESGIHGDKGEKGLAGF----SGPKGIKGERGDTGLPGKEAEK-IPGDKGIQ------GDVGELGDKGFKGEKGKNQNVNVLLTK-------------YKGDNGEKGVKGSQGTAGF---PGNKGSKGETGLSGIPGKH----------GKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGV---------------KGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSI 2664
            G  G +GK   PG +G+ G +G       PG+ G  G  G  G  GPKG  G  G  G  G +G KG PG  G        G  G  G+KG  G  G  G  G+PGM G  G  G KG +     +  AE G  G +G  GL G  G  GD G PG KG+       G  G LG KGE+G P        + G++G  G  G S    +   +    + G  G  G  G  G  G  G KG  G    KG  GLKG+ G+ G +G  G P   GSPG  G+  + G +G  G  G+ G  G  G  G  G +G KG+ G T  +    +G  G  GEKG++G  G  GIP            GD+GS+G +G  G  G +G+KG +     PG  G  G  G ++G+ GK G  G  G +GL G KG  G+    G  G  G  G+ G  G  G +G  G  G+ G   ++  S PG +G  G  G  G  GR G+ G  GF G KG      DG  G  GD G PG PG  G+ G+ G                                                     G  G SG +G  G +G  GL G  G S  G  G +G+ G KGEKG  G      G  G++G++GD G PG +    +PG  GI       G  G+ G  G  GE+G+                       + G  G KG KG QG  GF   PG  G KG +GL G PG+           G +G  G DG  G  G  G  G  G +G +G  GI G                 GL G++G  GF G PG++G  G+ G+PG S+
Sbjct:  630 GLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGAT---GDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGV------HGKPGLLGPKGERGSP-------GTPGQVGQPGTPGSSGPYGIKGKSG---LPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSP---GSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM--GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGS-PGPKGQPGESGFKGTKGRDGLIGNIGFPGNKG-----EDGKVGVSGDVGLPGAPGFPGVAGMRG---------------------------------------------------EPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSM 1406          

HSP 5 Score: 133.265 bits (334), Expect = 2.959e-30
Identity = 280/890 (31.46%), Postives = 355/890 (39.89%), Query Frame = 1
Query: 2074 GEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEA---------EKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHG------------KVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGIL-AIGEKGPKG---------FQGNIGERGNPGIKGYKG-----------------------NSGFPDITLKGYKGIPGEI-----------------------------GPKGFQGLPGEKG------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGS---------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGD-------------------KGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G  G RG  G  G +G  G  G KG  G  G +G +GI+G++GD GLPG +             PGD G+ G  G  GD+G +G +G         +   G     GV G+ G  GFPG KG +G  G + I G  G              G    + E   +  K E+G  G RG QG    KG  GL+G+KGD GF    G        GVP                          G+ G  G  G +G  G  G RG+ G  G +G  G PG++  +G  GPKG          QG  G+RG+ G +G++G                         GFP    KG  G+PGE                              G  G QGLPG KG        G  GP+G  G  G  G +G +G  G  GQ G  G  GE GS          G  G  GE+G  G  G  G+ G  G +G  GL G++G  GD      G  G QG +G +G+KG  G +G  G KG  GK  ++G KGE+G+ G  G++G  G  G  GP G+ G  G  G  G  G+ G                             G  G +G  G  G   K+   G KG  G  G +G KG  G+ G++G     GPKG KG  G  G  G                                    I G+ GI G  GL+GI G  S G+ G  G  G  GEKG++G  G  G   P+ P  +     L +KG++G  G  G  G  GP+G KG+                   KG S   PGP G  G++G  G  GS G TG PG  GE G +GI G  G  G  G  GL G+ 
Sbjct:  296 GLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGP--------SGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTI-GAAGLPGRDGLPGPPGPPGPPSPEFETETLHNK-ESGFPGLRGEQGP---KGNLGLKGIKGDSGFCACDG--------GVPNTGPP---------------------GEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPG--EKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHP---------------------------GKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPG------------------------------------IPGLPGIPGTRGLKGIPG--STGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSN-----LWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSG-KPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDN 1070          

HSP 6 Score: 125.946 bits (315), Expect = 4.731e-28
Identity = 296/997 (29.69%), Postives = 378/997 (37.91%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPK------------------GIKGERGDTGLPGK--------------------EAEKIPGD-KGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYK---------------------GDNGEKGVKGSQGTA---------------GFP-GNKGSKGETGLSGIPGKHGKVGN-----------------SGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE--------------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSG--------------------FPDITL----KGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSG---------------------LRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG---------------PAGDGIKGMKGLIGPQGQ--------------------------KGESGYKGVQGLAGDK------------GPKGFPGKN----IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQG-IGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G +GP+G +G  G  G  GL+G  G+ G  G  G  GDKG  G+ GF G                    G  G +G  G PG                     +    PG  KG++GD G  G  G  G +G       +                          G  GEKGVKG  G                 GFP G KGSKGE G  G PG  G  G                   G  G +G MG +G  G  G++G++G +G  G+ G +G++G +G IG PG                GD GV G+PG                                     GD+G  GLRG SG  G   L G PG L     GP+GF G  G++GNPG +   G +G                    F   TL     G+ G+ GE GPKG  GL   KG KG+ G     G                     L G KG +G +G  G QG  G  G++G +G  G KG  GE     IQG  G++G+ GS G +G+ G  G                 G G  G KGL G  G+                          KG+ G  G QGL G K            GP GFPG        GS+G  G  G+ G  G KG  G  G + LP   GF G  G++GL G                                          ++    E+G +G  G KG +G+ G  G +G+ G+ G  GPKG +G  G  G  G  G  G +G  G++G+ GL G  G  G  G+ G KG +G +G  G +  +G+ G      +G  G  G  G KG  G  G AG     GP G++G +G +G  G  G P   G  G RG KG  G  G      GP G  G  G KG+ G+ GP GIP  +       ++GD G +G  G  G  G R
Sbjct:   55 GIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLK-----------------------------------GDEGIQGLRGPSGVPGLPALSGVPGAL-----GPQGFPGLKGDQGNPG-RTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGL---KGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFP----------GLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGL-----KGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLP---GIPGTRGLKGIPGSTGKM----GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPR 985          

HSP 7 Score: 122.479 bits (306), Expect = 5.335e-27
Identity = 163/450 (36.22%), Postives = 200/450 (44.44%), Query Frame = 1
Query: 2035 KGPSGERGDPGEVGEQGLRGL------DGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNV-NVLLTKYKGDNGEKGVKGS---QGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGN-----MGRKGENGLDGRRGRQGNMGI----KGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGF------------EGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFP-----DITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQ---GYQGEKGNQGSLGLKGLKGNQ 3264
            KG SG+ G PG +G +GL GL       G+ G  GESG  G +G  GL G SG  G+KG+ G T     E    PG KG      + G+ GFKG KG++  + N+     KG++G+ GV G     G  GFPG  G +GE GL G  G  G +G  G  G  G       G  G  GL G +G +G  GI     G  GL G KGDRGF   PG +G  G+ G PG S+                               GQ GD G  GL GE G  G             +G  GDPG   I G KGPKG QG  G  G PG  G KG+SG         T +  +  PG +G  G  G+P               GL G  G QGP G +G +G  GI G  G  G  G  G  G+ G  G+Q   G++G  G QG  G+ G+ G  
Sbjct: 1010 KGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQT----VEISGSPGPKG------QPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGF---PGLQGPAGLPGAPGISLP--------------------------SLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIP---------------GLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQS 1405          

HSP 8 Score: 98.9821 bits (245), Expect = 7.198e-20
Identity = 173/492 (35.16%), Postives = 210/492 (42.68%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGE--------PVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXX----AKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNV-----TGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGD-------TGDAGEAGPIGEKGDIGDVGTS----IPGA 1686
            G LG  G  G  G  GKPG  G KG+RG PG  G+ G  G  G  GP G+ G  G+ G  G  G  G PG KG +G  G  G   K         +G  G++G+PG  G  G KG  G   P    LPA  G KG KG  G  G  G  G  G PG +G+ G  G  G +G  G  G  GE        PV + S  +    +  KGDKG   +            KG+ G  GPPG  G  G  G      G  G  G  G  GL G++G  G  G  G PGE+GS G  G                       G  G SGL G KG  G T++ISG+       G  G +G KG  G+ G+ G PG++G  G  G+ G +G  G  G   GV+           G+RG  G  G  G QG  G  G  G+ G       G  G  GL GPKG+        G  G+ G  G+KGD G  G      +PGA
Sbjct:  773 GFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVK---------KGLPGLKGLPGNPGLVGLKGSPGS--PGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSP---------------------GLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFP-GVA-----------GMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGA 1220          

HSP 9 Score: 95.5153 bits (236), Expect = 8.733e-19
Identity = 190/525 (36.19%), Postives = 233/525 (44.38%), Query Frame = 1
Query:  298 LLGPKGE---MGFGGHEGKPGFRGVKGDR------------GPPGALGEKGNEGYKGDQGPKGMI------------GDKGVQGNSGINXXXXXXXXXXXXXYTGE-------------EGCCGKPGQ------KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVLPAERGDKGA----------------KGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGR-AGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKG 1650
            L GPKGE   +GF G  G PG  G+ G R            GP G  G  G +G +G+ GP G+             GDKG QG++G NG  G  G KG  G  G              +G  GKPG       +G  GL+G  G+ G PGM GE G +G +G   LP    LP  +GD G                  GF G KG  G  G++G PGNKG  G  G  GD+G  G  G  G       +   RGE G  G  G+        +   +  KG   I G PGP G  G  G KGY G   G+ G  GL+G +GD G  G  G  G  G+PG      I GQ G PG  G  G  G  G AG  G  G    +GDT D      G+ G +G KG++GI G  G+PG+ G +G SGLQ   G+ G    +  V      GP G  G+ G+ G TG  G QG  GL+G KG+ G+             G  G  G+ GL GP G  G  G+ GP G  G
Sbjct:  891 LSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPG-------VAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPS-ITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDP--GFPGIPGPKGPKGDQGIPGFSGLPGELGLKGSSGLQ---GDPGQTPTAEAVQ--VPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPG 1400          

HSP 10 Score: 92.0485 bits (227), Expect = 1.041e-17
Identity = 199/585 (34.02%), Postives = 252/585 (43.08%), Query Frame = 1
Query:  262 NRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGN------------EGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGE------IGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMI---------SLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGD---LGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTG--------VRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGR--SRGVSXXXXXXXXXXXXLRGLDGKTGKRGE-QGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS----IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDA---GNRGDKGFPGI----PGERGIDG 1860
            ++     C   G  GP G  G  G  G  G RG+ G  G PG+ G KG              G+ G +G KG+ G  G+ G  G+                G  G  G PG KGA G   +    G PG QG +G  G KGF    +  LP  +G  G  G  G KGE       G+ G  G PG+ G  G +G  G  G  GF G  G P K           S+ K +G  G KG  G      L  +     + G   + GP G  G +G  G  G  G  G  G  GLKGI G    +GP G+ G PGE G  G PG  GIP  R P      +G +G  G+AG++G  G +G KG+                  ++G  G+ G  G  G RG+PG +GS G +G  G  GE G++G   S G+         G  GL GL G  G+  E  G  G KG  G  G      KG KG +GL G  G  G+ GE G +G  GD+G  G      + G +G  G+ G  G  G  G  G  G IG KG       G A   G +G+KG+PGI    PG+ G+ G
Sbjct:  649 SKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGL---------------PGMIGSPGLPGSKGATG-DIFGAENGAPGEQGLQGLTGHKGFL--GDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVK-KGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLP--------GASGLPGLKGDNGQTVEISGSPGPKGQPGESGF-----KGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRG 1201          

HSP 11 Score: 87.4261 bits (215), Expect = 2.909e-16
Identity = 163/499 (32.67%), Postives = 205/499 (41.08%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGI---NXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQG---IPGMQGEKGRKGPKGFS----LPQEGVLPAERGDKGAKGFSGLKGEIGE--------------FGDVGEPGNKGMIGYQGDKGDIGEL--------------GFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGI---RXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------------------MIGTKGRKGVNGLTGPKGDTGDAGEA------GPIGEKGDIGDVGTS-IPG 1683
            E G  G +G+QGPKG +G KG++G+SG    +G     G  G  G  G  G  G PG KGA G +G  G QG    PG+ G  G  GPKG      L     +P +RGD G++GF G+ GE G+               G  G PG KG+ G  G+KG  G                G  G+KG+       D   G+ G  G KG +    +  +       G  G    +G  G  G  G  G+ G +G  GS G   L  + G  GP G+ G PG  G PGK G+                      G  G+ GL G KG  GD         G +G +G  G KG  GD G+PG +G  G  GL GP GE+G+ G    V +             G  G +G  G +G  GL G  G  G+                       + G KG  G  GL G KG  G  G A      GP GEKG +G VG   IPG
Sbjct:  453 ESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGK-------DGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLP---------------------GMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQ------------PGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPG 911          

HSP 12 Score: 86.6557 bits (213), Expect = 4.624e-16
Identity = 211/662 (31.87%), Postives = 264/662 (39.88%), Query Frame = 1
Query: 2101 GYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPG---------------NKGSKGETGLSGIPGKH-GKVGNSGKDGEKGNMGRKGENGLDGR------------------RGRQGNMGIKGVKGLEGVKGDRG---------------FIGFP----GEKGDIGVTGVPGDSITGPX-----------XXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGF--------QGNIGERGNPGIKGYKGNSGFPDIT-------LKGYKGIPGEIGPKGFQGLPGEKGFKGE--IGPTGT-----------------------------SGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGS---------------------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGV-----------------------QGLAGDKGPKGFPGKNIM------------------GSKGEKGNKGRIGEMGVKGFK---------GDIGPIGLPGSIGFQGQEGQRGLKG 3540
            G  G+ G  GI G  G +G  G +G  G+KGERG  GL G    K        GD G +G  GF G  G   +        +G  G  G  G+QG  GFPG                KGSKG+  L+  PG   G  G+ G  G  G  G +G  G  G                    G  GNMG+ G +G +GVKGD G               F+GFP    G KG+ G  G PG  I+GP            G+KG+KG  G+ G +G  G  G++G  GQ G KG  G  G +G +G EG  GD     IG  GP  F         GN G+ G PG+ G KG+ G   +        L    G+PG +GP+GF GL G++G  G   IG  G                              SG  G +G+QGP+G  G++G KG  G     G                       G KG  G+RGS G QG  G  G  G LG  G KG +G P    I+GM G    +G  G  G++GV                       QG  G+KG  G PG+                     G  G+KG  G  G+ G+ G K         G  GP G PG+ GF G +G RGL G
Sbjct:   46 GARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPK--------GDKGPMGVPGFLGINGIPGHPGQ--PGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLA--PGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGL-GFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPG--ISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGD-----IGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGD---RGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPG 684          

HSP 13 Score: 82.4185 bits (202), Expect = 9.611e-15
Identity = 185/580 (31.90%), Postives = 234/580 (40.34%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIP------------GMQGEKGRKGPKGFSLPQ------------------------EGVL--PAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKG------YKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIP---------------GDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKG--VKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGE 1845
            KG  G  G  G PG  G+KG  G PG  G     G KG++G  G +G  G+ G  GI G +G  G+ G  G  G  G  G PG+KG    +G  G  GIP            G +G +G  G  GF  P+                        +GV   P   G  G +G  GLKG  G  G  G PG  G  G +G  G  G  G  G KG+  + + +  S G  G  G+ G+  T         +   G KG  G  G  GD+G  GA G+ G AG +G  GL G  G  G IG  G PG  G  G            P        P   IGA G  GL+G      + GL+G         I +   + G  GD    G  G+DG+RG P               GD G  G  G+ GP G KG++G                  + G  G  G+ G +G  GL+GD G       +    G  G+ G+ G  G TGD G  GP+G +G  G     +PG  G  G  G PG  G  G PG  G  G  G      +G  G +G  G PG+PG+
Sbjct:  859 KGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGD---RGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGD---PGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQG------------------IPGFSGLPGELGLKGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKG-----LPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGF-----EGAPGQQGPFGMPGMPGQ 1404          

HSP 14 Score: 78.5666 bits (192), Expect = 1.184e-13
Identity = 116/353 (32.86%), Postives = 149/353 (42.21%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLD---GYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFK----GEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDR---GFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPG---------IKGYKGNSGFPDIT-LKGYKGIPGEIGPKGFQGLPGEK 3021
            T+G  G  G  G PG  GE G  G+    G  G  G  G+ G +GE GL G SG +G  G  G  GL G +   I G  G  G  G  G+KG+     G  GK           +G  G++G  G QG AG PG  G    + ++G PG  G+ G  G+ G  G  G  G  G    +G  G+ G  G+ G +G KGD+   GF G PGE G  G +G+ GD    P  +                                  G  G  G  G  GL GDP     G +GP G QG+ G  G PG           G  G+ G P +    G++G PG+ GP G  G+PG+ 
Sbjct: 1094 TKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGK--------PGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGSSGLQGDPGQTPTAEAVQVP----------------------------PGPLGLPGIDGIPGLTGDP-----GAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQS 1405          

HSP 15 Score: 76.2554 bits (186), Expect = 7.246e-13
Identity = 143/424 (33.73%), Postives = 184/424 (43.40%), Query Frame = 1
Query: 2344 KGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVT---------GVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGI---------------------LAIGEKGPKGFQGNIGERGNPGIKGYKGN---SGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKG--------EIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQG-----------YQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGR--IGEMGV 3453
            KG  G  G  G QG  G  G  GS G +GL G  G  G +G  G  G+KG MG  G  G++G  G  G  G +G  GL+G  G +G +GFPG  G  G+          G  GD +  P   KG K                        GD G  GL G +G +G  G  G  G                      + +G +G KG +G++G  G  G     G     GFP    KG KG  GE GPKGF G+ G  GF G        E G  G  GL G +G  G +G +G  GQ+G  G +G  G  G +G  G++G IG+ G             G  G+ G  GL GLKG+     +GI+G++      G  G  G   + G+ G  GP+GFPG      KG++GN GR  IG  G+
Sbjct:   45 KGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMK------------------------GDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFP----KGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGD-----EGIQGLR------GPSGVPGLPALSGVPGALGPQGFPGL-----KGDQGNPGRTTIGAAGL 424          

HSP 16 Score: 65.855 bits (159), Expect = 8.797e-10
Identity = 164/531 (30.89%), Postives = 199/531 (37.48%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXX--------XXXXXYTGEEGCCGKPGQ---KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGF---KGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGD-----------------EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMI----GTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
             KG +G KG+ GPKG  G  G  G  G+                  GP+G  G EG  G PGQ   KG  G  G +G QGI G +G+ G  GP  F      V+    GD G  G  GLKG+ G  G  G  G  G+    G  G +G  GF   KG++G P +                              E +   + G                 G  G  G KG  GLKGI+GD G     G     G PG+PG  G  G  G PG +G +G  G  GA G +G  G  G  G +         I   + G+ GDRG+ G +G  G  G PG                  +G  G+ GL G  GEKG+ G            P      RGL G  GK G  G +GL G KG+    +I    G  G  G  G  GPKG  G  G  G  G  G  G+ G+  PG                                     G  G RG+KG PG PG  G DGL
Sbjct:  253 PKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGF---------------PGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGP----RGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGS--PGLVH-----------------------------LPELPGFPGPRGEKGLPGFPGLPGKDGL 733          

HSP 17 Score: 61.6178 bits (148), Expect = 1.635e-8
Identity = 192/626 (30.67%), Postives = 240/626 (38.34%), Query Frame = 1
Query:  259 CNRSNCT-ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGE--------------LGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEV----MIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGA--------EGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT--------IDISGNVT-------GVRGDRGEKGEKGIDGDRG------------IPGDEGSRGDSGLQGPIGEKGNKGRSR----------------------GVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG----SCFNCSDGDAGNRGDKGFPGIPGERGID 1857
            C   +C+  C C    G +G  G  G +G  G +G  G  G  G  GE+G  G  G  GPKG  G  GV G  GING  G PG  GP+G  G +GC G    +GA G  G DG  G+ G  G  G+KG KG  +   G     +GD G  G  G+ G        G PG  G +G  G  G  G               LGF+GEKG                 KGD G         +T E+      KG+KG +G PGP G  G +G  G+ G   +            GL G RG +G  G  G PG+ G  G                         +G  G +G +G +G KGD         IDI G V        GV G  G KG++GI G RG            +PG  G +G  GL+G   ++GN GR+                             E     E G  GL G+ G +G  G KG+KGD G    D               G  G  G+ GL G +GD G  G  GP G  G +G +G S P                           G+KG    S      GD G+ G +GF G+ GE G D
Sbjct:   30 CGGQDCSGSCQCFPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGT---QGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGP------QGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGV----------------KGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGT------------------------LGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKG---DQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP--------------------------KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKD 577          

HSP 18 Score: 60.4622 bits (145), Expect = 3.993e-8
Identity = 103/318 (32.39%), Postives = 131/318 (41.19%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPG------ALGEKGNEGYKGDQGPK--------GMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSG------------LKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMI-KGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKG------------IRGDLGPIGKHGKPGENGSPGK 1128
            +G +G  G++G  G  G PG  G++G+ G PG      A+G  G+ G  G +GP         G+ G KG +G  GI                         G  G  GL+G  G +G PG+QG  G  G  G SLP   ++  + GD G  G  G              G     GD G+PG  G+ G +G KGD G  GF G  GE    + L  S G  GD G          T T   V +  G  G+ G  G  G  GD GA+G  G  GSKG  G+ G              GD G  G  G PG  G+PG+
Sbjct: 1113 DGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGI-----------------------GAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPS--LIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGE----LGLKGSSGLQGDPGQ---------TPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQ 1392          

HSP 19 Score: 53.1434 bits (126), Expect = 7.906e-6
Identity = 77/236 (32.63%), Postives = 101/236 (42.80%), Query Frame = 1
Query: 3016 EKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQ---------------GYQGEKGNQGSLGLKGLKGNQGPAGDGI----KGMKG--LIGP---QGQKGESGYKGVQGLAGDKGPKGFPGK-----------------------NI-MGSKGEKGNKGRI------------GEMGVKGF-KGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            EKG +G  GP G  G  G +G  G  G  G++G++G  G++G  G +GDKG  G  G +GI                G  G  G QG++G  G  G  G  G       KG KG  ++ P   +G KG+ G  G+ G+ G +G  GFPG                        N+ +G +GEKG KG +            GE+   GF KG  G  G PG  GF G  G  G  G
Sbjct:   44 EKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPG 279          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 268.085 bits (684), Expect = 6.227e-72
Identity = 186/485 (38.35%), Postives = 238/485 (49.07%), Query Frame = 1
Query: 4003 GERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFS--ILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRNQ 5448
            GERG  G  G  G  G  G  G  G  G  G  GD   G  G  G  G PG +GY G+RG  G  G +G S    YPG  G+ G+KGP+G+ G  G  G+ G  G  G  G+ G +    VR P G  GE G  G KG                                 PG  GD GL G  G  G  G PG  G  G  G  G  G  G+  F+G  G  G  GL G PG               +PG+ G    + G  FA HSQ+T +P CP     LW+GYS L + G+ RA   DL  PGSCL  F+ +PF+FC     C  S RND ++WLS+   M   M+ +  T ++ Y+SRC VCE P++  A HSQ T  P+CP GW+ +W+G SF+M+T  GA G GQ L SPGSCL  F+   F+EC  +G C YY  +  FWL   D  K F+  M   +K    +D +++C VC++N+
Sbjct: 1325 GERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGD--CGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMA-MAVRNPPGQPGENGYPGEKG--------------------------------YPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPG---------------YPGSPGGWAPSRGFTFAKHSQTTAVPQCPPGASQLWEGYSLLYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNSVCHVSSRNDYSFWLSTDEPMTPMMNPVTGTAIRPYISRCAVCEVPTQIIAVHSQDTSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHGRGTCNYYATNHGFWLSIVDQDKQFRKPMSQTLKAGGLKDRVSRCQVCLKNR 1759          

HSP 2 Score: 204.912 bits (520), Expect = 1.719e-52
Identity = 365/1190 (30.67%), Postives = 463/1190 (38.91%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGM-QGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQG-----DKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEK------GIDGDRGIPG------------DEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGH-----------KGLKGDKGVKGMDMIGTKGRKGVNG------------LTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSG---PKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT----------LKGYKGIPGEIGPKGFQGLPG---EKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQG---------------QKGIIGMIGEMGSQGDK--GDTGERGSIGIQGYQG---------------EKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQ------KGESGYKGVQGLAGDKGPKGFPGKN----IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            +G +GP G +G  G  G PG +G KGD G  G  G++G +G  G+ G KG  G++G+ G  G               Y G +G  G+PG  G  G +G  G +G  G   GE G  G +GF    +GV    +G KG  G  GL G +G  G VG PG  G  G  G     +KGD GE G+ G  GEP          G  G+ GD GY     L        I+G  G+                      G  G +G  GI GD   IG  G  GE G PG                         +G  G +GL G  G+ G  I + G   G  G+ GE+GE       G+ G+ G PG              G  GD G+ G  G+ G+ G S G+S            L G+ G  G +GE G             GLKGD G+ G+      GR G +G              G +G+ G AG  G  G +G +G     IPG QG  G                  F G+ G+      G  G RG  G PG+PG +G  G+                                               +   N+  G  G  G  G PG+ G  GL GL G  G  G  G  G++G  GL GF G     G++G++G+ G             GI GD GE G  G+ G  G           + G  G  G  G  G AG PG  G  G  GL G PG  G+ G +G+DG  G  G +GE+GL         +GI G KG +G  G RG  G PG  G+ G  G                                           G  G  G  GD+G+ G  G       G  GP G  G  G  G PG++G  G++G P +           L G  G PGE G  G  GLPG   + GF GE G  GT G RG+ G+ G   Y G  G               Q G+ G+ GE G  GD   G+ G  G  G  GY G                 G +G  GL GL G QG   DGI G  GL G  G+       G+ GY G QG  G+KG  G PG+N    + G  G+ G KG  G  G  G+ G  G +G PG +G+ G  G+ G  G++
Sbjct:  272 DGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPG---------------YPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGF----DGV----QGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEP----------GLPGEPGDCGYPGEDGLPGYD----IQGPPGLD---------------------GQSGRDGFPGIPGD---IGDPGYSGEKGFPGTGVNK--------------------VGPPGMTGLPGEPGMPG-RIGVDG-YPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAG-SDGLSGSPG--------LPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGL-----PGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLG-----IPGLQGPPGDS----------------FPGQPGT-----PGYKGERGADGLPGLPGAQGPRGI--------------------------------------------PAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGF-----------NGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGL---------VGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPG-----------------------------------------QNGMDGYPGAPGDQGYPGSPGQ-----DGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQG--NDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQ 1226          

HSP 3 Score: 154.451 bits (389), Expect = 4.453e-37
Identity = 195/547 (35.65%), Postives = 240/547 (43.88%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGF------------SGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETG---LSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGD---------------PGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEI---------GPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            T+G  G  G  G PG VGE G  G  GY G+ GE G     G+ G  G+             G  G+ GERGD G      +  PG+ G+ G  G+ G  G  G  G      +  +   KG++G  G+ G QG  G PG  G +GE G     G PG+ G  G  G++GEKG  G  GENGL G RG+ G  G+KG  GL+G  G  G  G  G  GD+G  G PG++                             G+ G  G  G  GLRGESG  G  GL G                PG       GP    G  G+ G PG+ G  G  G     L G  G PG+          G  G  G PGE+G  G  G  G  GL G  G  G +G  G++G  G  G  G  G+ G  G  GERG  G+ G QG  G+ G  G  G  G +GP G DG  G  GL G  G+ G  G  G   +A  + P G PG+N  G  GEKG  G  G+ G+ G  G  G  G PG+ G+ G  G  G+ G
Sbjct:  998 TDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNG------DSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGEN-----------------------------GDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPP---GQAGQDGYPGLDGLPGAPG-----LNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMA-VRNPPGQPGEN--GYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPG 1498          

HSP 4 Score: 150.599 bits (379), Expect = 6.160e-36
Identity = 265/795 (33.33%), Postives = 331/795 (41.64%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----------IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILA-IGEKGPKGFQGNIGERGNPGIKGYKGNSGFP-DITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKG----LKGNQGPAGDGIKGMKG--LIGPQGQKGESGYKGVQGLAGDKGPKGFPGK-------NIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPK---GYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERG 4329
            G+ G +G+ G PG+ G +G  GL G  GKKG  G  G +G+ G  G+SG  G  G+ G  G PG   ++           PG  GI G+ G +G  G +GE G N      L   +G+ GE+G +G  G  G+PG  G+ G  GL G  G+ G VG +G+ G  G  G+ GE G     G+ G++G  G  G  G+ G  G  G  GE+GD       GDS  G                          G  GQ GD G+ GL G  G  G+ G+ G PG+    G  G  G QGN G  G PG++G  G  GFP      GY G  G  G KG+ G+PGE G  G  G  G  GL+G  G  G  GY G  GQ G  G +G  G+ G+ GD G +G  G  G +GE G  G  GL G          P  DG  G  G  + GP GQ G+ GY G+ GL G  G  G PG         + G  GE G  G  GE G+ G  G  G  GLPG+ G  G EG  GL+GD                               G+ G  G  G        G++G  G  G+ G  GD G  G  GQ G +GP+   G+ G++G +G+ G                                            G  GL G    +     GQ G  G  GEKG  G  GD G  GP G A     G  G  G  G PGP G  G     G  GD+GF                +G  G  G  G+PG+ G  G  G
Sbjct:  865 GEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNG-----LPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDN------GDSYPG------------------------NPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGD------------------------------CGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRP------------------------------------------GREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKA-----GYPGAPGTDGYPGPPGLSGM---PGHGGDQGF----------------QGAAGRTGNPGLPGTPGYPGSPG 1528          

HSP 5 Score: 142.51 bits (358), Expect = 1.904e-33
Identity = 187/511 (36.59%), Postives = 239/511 (46.77%), Query Frame = 1
Query: 2131 IHGDKGEKGLAGFSGPKGIKGERGDTGLPGKE----AEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL----LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKG--NMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFP----------DITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGP-------TGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG----------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGR-IGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
              G KGE+G  GF       GE G  G PG++    A   PG  G +GD G++G KG +G++G   +        L    G  GE+G+ G  GT GFPG  G  G  G SG  G  G+ G SG  GE G  + GRKG  G  GR G  G  G  G  GL+G KGD G  G PG  G  G+ G  G   +G  G+KG  G  G  G+ G         E   L  +G  G  G  G+KG +G VG PG+L + G  G  G +G  G+ G+ G +G +G  G P          +  L G  G PG  G  G  G PG  GF+G+ GP       TG +G  G +G  G QG KG+ G  G+ G +G  G  G  G  G+ G  G+ GY  EKG++G  G  G  G  G          P  DG+ G   + GP G  G+SG  G  G+ GD G  G+         GEKG  G  + ++G  G  G  G  G+PG IG  G  G  G  G++
Sbjct:   41 CPGTKGERGNPGFG------GEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVL--QGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYD-IQGPPGLDGQSGRDGFPGIPGDIGDPGY--------SGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGER 533          

HSP 6 Score: 139.428 bits (350), Expect = 1.396e-32
Identity = 204/617 (33.06%), Postives = 251/617 (40.68%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----IP------------GDKGIQGDVGELGDKGFKGEKGKNQNVNVL-------LTKYKGDNGEKGVKGSQGTA------------------GFPGNKGSKGETGLS--GIPGKHGKVGNSGKDGE------------KGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE---------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLK-------------GYKGIPGE--IGP---------KGFQGLPGEKGFKGEIGPTG---------------TSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD----GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSK---GEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            T G +G  G  G  GE G  G  G+DGY G  G+ G  G  G+ G   + GP GI GE G  G PG   E     +P            G  G+ G  GE G  G  G  G +     +          Y+G  GE G     G                    G PG  G +G+ G S  G PG  G+ G++G DG              G  G KGE+GL G  GRQGN GI G  GLEG  G+ GF G PG+         +G+ G  G+PG++                       G  G++G+ GQ G KG  GL G+ G  G  G +G PG +   G  G  G  GN G  G PG++G  G  G P +  +             GY G PG+   GP          G  GLPG  G  GE G  G                 G  G +G  G  G +G  G  G  G+ G  G  G +GD GE G  G  G  G  G  G  GL G+ G QG +GD    G  G  G+ GP+G  G  G  G+ GL G  G +G PG   M  +   G+ G  G  GE G  G  GD G  G PG  G+ G  G  G  G
Sbjct:  899 TPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDG---YPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGEN-----------------------GLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPG 1489          

HSP 7 Score: 134.035 bits (336), Expect = 6.835e-31
Identity = 259/796 (32.54%), Postives = 319/796 (40.08%), Query Frame = 1
Query: 2158 LAGFSGPKGIKGERGDTGLPGKEA----EKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGN-MGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPG----EIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQ-GY--KGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKG-LIGP-QGQKGESGYKGVQGLAGDKGPKG---------------FPG----KNIMGSKGEKGNKGRIGEMGVKG-----FKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRG------PQGPAGDQGIGL---LGVKGERGD------PGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAG 4383
            L G  GP G+KGE+G  G  G       +  PG  G++G  G+LGD G +G++GK+           G+ GEKG +G QG  G PG  G+KG  G  G PG+ G  G+ G +G  G   G  G +G  G  G QG  G+ G  GL G  G RG +G PG  G  G+ G+PG +  G                         +GE G  G  G  GL GE GD G+ G  G PG      +GP G  G  G  G PGI G  G+ G+      G KG PG    ++GP G  GLPGE G  G IG  G  G  G  G++G   GY   GV G  G  G  G  G  G  G  G+ G  G+ G  G+ G+ GS GL G  G  G P   G+KG  G ++GP +   G  G KG  GL G  G  G               FPG      + G  G++G +G +G  G++G     F G  G  G  G  G  G  G  G +G +G                                                  G+ G  G  G  GD+G  GL G  G  GP GY G  GE GM G                                                L G  G   +GE G RG QG  G  G  G+ G+ G  G        G  G+ G G    +G  G  GD      PGPDGY G+ G  G  G       YPG  G  G  G  G+ GS G +G+ G  G+KG  G  G  G  G  G  G AG
Sbjct:  256 LQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKD--------GVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKG------------------------DRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDI---QGPPGLDGQSGRDGFPGIPGDIGDPGY-----SGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQV--------------------------------------AGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDG------------------------------------------------LPGFPGL--HGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPG-------YPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAG 916          

HSP 8 Score: 133.65 bits (335), Expect = 9.030e-31
Identity = 235/760 (30.92%), Postives = 297/760 (39.08%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGI---HGDKGEKGLAGFSGP-----------------------------KGIKGERGDTGLPGKEAEK-IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYK-------------------------------GDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVK---GDRGFIGFPGEKGDIGVTGVPGDSI--TGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGL-----------RGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGE-----RGNPGIKGYKGNSGFP----DITLKGY---KGIPG----EIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQG------PQGYKGVQGQK---------------------GIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSL--------GLKGLKGNQG-------PAGD---------------GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSI-------GFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKG 3828
            G KG  G+RG PG  G  GL+GLDG  G KGE GI   +G  G  G+ G +GP                             KG+KGE G +G+PG       PG KG +GD G  G  GF G  G    + V  +  K                               G  G  GVKG +G  G  G  G  G  G  G PG  G+ G+ G  G++G  G+ G  G  G +G QG  G+ G  G  G K   G+ G+ G PG +GD G  G  G+     GP G +G  G  G  G  G  G  G  G +G +G  G  G            +G+ G+ G+ G  G+PG+   GE G  G+ G  G      +G PG+ G  G  GFP    DI   GY   KG PG    ++GP G  GLPGE G  G IG  G  G  G  G++G      P G  G  G                       G+ G  G+ GS G  G +G  G  GI GY G KG  G +        G+ GLKG+ G       P  D               G++G  GL G  G++G  G  G+ GL      +G PG +  G  G  G KG  G  G+ G  G  GP G+P  +       G  G +G  GL GD+                                            +   G  G +G  G  G  G++G  GL G  G  G  G +GQ GE G  G
Sbjct:   88 GSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGL--PGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGL------QGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDR------------------------------------------GADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNG 797          

HSP 9 Score: 130.568 bits (327), Expect = 8.667e-30
Identity = 219/608 (36.02%), Postives = 273/608 (44.90%), Query Frame = 1
Query:  184 VLGLIVAVFWIIISLVQD--SESAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVL--PAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYS-------------FTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS--RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSI--PGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG-SCFNCSDGDAGNRGDKGF------------------------PGIPGERGIDGLN 1866
            +LGL  AV  ++ S  QD     AAA C +     C C G  G +G  GFGG  G PG  G  G  G PGA G  G EG  GD G KG  GD+G+ G+ G               + G +G  G PG KG  G+ G +G  G PGM G  G  G  G +  P    L  P   G   ++G  G+KGE G  G  G PGN G  G +G KGD G  G  G  G     +S  K R  +   G KG                    ++     +++G  G  G  G  G  G  G  G  G  G  G  GLKG +GDLG  G+ GK G++G PG  G  G  G++G  G  GY G +G  G  G  G  G++G  G    + G  TG  G  G +G  G+ G +G+PG +G  G  G +GP+G  G  G+    G+    EKG +GE G  G  G+ G  GE G  G  G+ G+ G D+ G  G  G +G  G  G  GD G+ G  GEKG  G     +  PG  G  G  G PG +G  G PG  G  GE+G  C  C DG  GN GD GF                        PG PG  G DGL+
Sbjct:    6 LLGLTAAVV-LLSSFCQDRIHVDAAAAC-KGCAPPCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPG---------------HPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPG-----VSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPL-GEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLS 590          

HSP 10 Score: 119.398 bits (298), Expect = 1.855e-26
Identity = 264/881 (29.97%), Postives = 324/881 (36.78%), Query Frame = 1
Query: 2062 PGEVGEQGLRGLDGYSGKKGESGIHGDKGEKG--LAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGEL-------GDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF-----IGFPGEKGDIGVTGVPG-DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILA----IGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT-LKGYKGIPGE---IGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD---------------QGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGN-------QGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS----SNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQG-IGLLGVKGERGDP--------------------------------------GPDGYEGQRG-PKGP--KGDKGFSILY--------------PGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            PG  GE GL G+DG  G++G  GI G +G  G    G  G  G KGERG  GLPG     +PG +G +G    L       G  G  G  G        L   +G +G  G+ G  G  G+PG  G +G  GL G PG HG+ G  G+ GE G       NG+DG  G  G  G  G  G  G  G+ GF     +G+PG  GD G  G+PG D   G                              + G  G  G  GE+G  G +G  G PG       +G  G KG  G  G RG  G  GY G +G P    + GY G PG+    G  G  G PG  G  GE G  G  GLRG  GD               +G  G  G  G+ G  G+ G  G+ G  G  GE G  G  GY+G+ G  G+L   G  G+         P   G  G+ GL G +G  G+S Y G  GL+G  G  G+ G + +               G+ G KG+ G  GLP      G++G  G+                                                    G  G  GE GE G  G  G  G  GQ G EG KGY G  GENG+ G                                                LRG  G+      NG  GQ G  G+ G+ G  G+ G  G  G  G  G+QG  G  G++GE G P                                      G DGY G  G P  P   G+ G    Y              PG  GE G+ G  G+ G  G  G PG  G +G  G+EGD G+ G  G  G  G  
Sbjct:  655 PGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPG-----LPGAQGPRGIPAPLRIVNQVAGQPGVDGMPG--------LPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGF------NGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPG------------------------------RDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDS-YPGNPGLSGQPGDAGYDGLDGVPGPPGYPGI-----TGMPGLKGESGLPGLP------GRQGNDGIP---------------------------------------------------GQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPG------------------------------------------------LRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSN 1375          

HSP 11 Score: 112.079 bits (279), Expect = 2.972e-24
Identity = 202/668 (30.24%), Postives = 253/668 (37.87%), Query Frame = 1
Query: 2470 SGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGE-------------------------RGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFS---ILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGER---------GIEGDLGDKGV 4359
             G  GE+GN G  GE G  G  G+ G  G  G  G+ G +GD G +G  G +GD G+ G PG                                  G  G  G  GL+GE G  G  G  G PG+  +   GP G  G  G  G PG+ G  G  G   +  +G KG+ GE G  G  GLPG  G+ G         L+G KGD GP G  G  G  G+ G +G + + G KG+ G                          +G +G  G +GEKG  G +G  G+ G  GP G  G+KG KG +G  GQ+G+ G  GV G  G+KG           S+GE+G  G  G  G KG  G+ G    PG  GF+G  G  G  G+                                               E G  G  G  G  G KG  G+ GL G VG  GP G  G  G+ G+ G                                                   + G +  G+RG+ G  G  GE G  GE GD G  G  G  G    G  G+ G+ G  G  G  G  G  G  G+KGF    +   GP G TG+ G  G  G +G  G PG  G  GER         G+ G+ GD G 
Sbjct:   42 PGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHP--------------------------------GLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGL--AGPPGQSGQNGNPGRPGLSGPPGEGG---VNSQGRKGVKGESGRSGVPGLPGNSGYPG---------LKGAKGDPGPYGLPGFPGVSGLKGRMG-VRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKG-----------SQGEQGLGGTPGYPGTKGGAGEPG---YPGRPGFEGDCGPEGPLGE--------------------------------------------GTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDG---------------------------------------------------MPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGF 553          

HSP 12 Score: 98.5969 bits (244), Expect = 4.178e-20
Identity = 232/781 (29.71%), Postives = 295/781 (37.77%), Query Frame = 1
Query:  280 ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQ---KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGV------------LPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVK--------------MISLDKSRGEIGDK-----------GDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGE---KGEKGIDGDRGIPGDE---GSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKG------------------DKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDG-----YSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKE-AEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKG 2412
            E   NG  G  G+ G  G  G  G  G KG  G PG  G+ G  GY G+ G  G  G  G  G                    G++G  G PGQ    G +G+ G DG+ G PG++GE G  G     LP                +P   G+ G  G  GL G  G+ G VGE G  G  GY+G  G+ G L + G+ G+                 +  L+  RG+ GD            GD GY     +        I G  G++         G++G  G  GR G+ G  G  G+ G+ G  G  G PG+ G PG+                            G  G KGY G+ G+       + G+RG  G+   KGE G+DG  G PG     G+ GD G  G  GE G+ G                   +G DG+ G RGE G  G  G                    G  G D+ G  G+ G +G  G  G  G  G  G  G  G  G  G                      G  G  G+ GE+G      DG  G+ G  G PG+PG  G+ GL G+ GE G  G  G  G  G+ GE+G  G  G +G  G  G  G           GD G  G  G  G  G  G  GL G          G+ G +G  GEKG  G  G  G+ G  G  G PG    +  PG  G+ G  G  GD+GF+G  G+  N                  G  GT G+PG+ G
Sbjct:  866 EAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGA------------------PGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNG-----LPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLK---------GESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQ---------------------------QGREGEKGYPGIPGEN-----GLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGN------------------QGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPG-----------------GPGESGLPGYPGERG--LPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGN-----------------PGLPGTPGYPGSPG 1528          

HSP 13 Score: 90.8929 bits (224), Expect = 9.827e-18
Identity = 175/506 (34.58%), Postives = 219/506 (43.28%), Query Frame = 1
Query:  289 CNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGD--------------------------KGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVK--------MISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGD---------RGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS 1674
             +GL G  G +G  G+ G PG RG+ G  G PG  GE G  G +G+ G  G+ GD                           G  G  G NG  GA GL GP GY G +G  G PG  G AG+ G DG  G PG +GE G  G           +  ++G  G  G  G  G  G  G+ G PG  GM GY G  GD G  G  G+ G P          ++     RGE GD G         L     E   +G +G+             G  GY G  G+ G  GL G  G  G +G+ G+PG  G  G+PG  G     G PG  GY GP+G  G  G  GL G  G +GD  D      G+ G  G+ G  G+DG           G+PG +G  G  GL G  G  G  G+     E GE G  G  G  G  G+ G+ GE+G+ G+ G+ G+ G+    G  G KG NGL G  G  G AG+   +G  GD+G  G  
Sbjct:  747 ADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVG-----------IDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNG---------LPGLEGECGEEGSRGLD------------GVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQ---LGTPGDVGYPGAP 1217          

HSP 14 Score: 82.8037 bits (203), Expect = 2.554e-15
Identity = 76/205 (37.07%), Postives = 94/205 (45.85%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGL------DGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIP-GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKG----DRGFI 2607
            +G +G  G  G PG  G +G+ GL      DGY G  G  G +G  GE+GL G  G +G  G+ G  G PG+   K P GD G  G  G  G  G  G +G    + + +    G  GE G  G +G  G PG+ G  G  G +G PG  G  G  G  G  G  G  G+ G  G  GR GN G+ G  G  G  G     RGF 
Sbjct: 1333 DGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPGGWAPSRGFT 1537          

HSP 15 Score: 69.3218 bits (168), Expect = 3.558e-11
Identity = 141/448 (31.47%), Postives = 185/448 (41.29%), Query Frame = 1
Query: 3148 GSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS----SNGERGQRGPQGNTGEKGEKGEFGDAGKRG------------PQGPAGDQGIG----LLGVKGERGD---PGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPK---------GEVGSVGPTGIPGSKGEKGERGIEG--DLGDKGVRGPQGLAGE 4386
            G++G++G+ G  G  G  G  G+ G +G+ G  G+ G +G  GD G KG +G  G  G  G  G +G+ GL G KG +G PG N                 G  GF G  G  G PG  G  G  G+ GL G  G  G                                        +  +G KGE G  G  G  G+ G  GL G  GD GP G  G  G +G+KG +G +                               ++ ++G  G  G++G  GR       G  G  GP G  G KG+KG+ GDAG+RG             +G  G+QG+G      G KG  G+   PG  G+EG  GP+GP G+        G QG  GV+G K         G VG  GP G PG+ G+ G  G+ G  + GD+G  G  G AGE
Sbjct:   43 GTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCN-----------------GTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNS-------------------------------------QGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGE 436          

HSP 16 Score: 67.0106 bits (162), Expect = 1.718e-10
Identity = 76/221 (34.39%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGE---IGEFGDVGEPGNKGMIGYQGD------KGDIGELGFKGEKGEPVKMISLDKSRGEIGDKG----DKGYSFTTHLTRTT 933
             G  G  G EG PG  G  G+ G PGA G  G+ GY G+   +G+ G  G QG SG NG            Y G  G  G  G +G  G  G DG+ G+PG  G +G  GP   ++      P E G  G KG+ GL G+    G  G  G PG  G  GY G        G  G+ GF+G  G       L  + G  G  G     +G++F  H   T 
Sbjct: 1342 PGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGE---RGLPGVPGQQGRSGDNG------------YPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGR-TGNPGLPGTPGYPGSPGGWAPSRGFTFAKHSQTTA 1546          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 267.314 bits (682), Expect = 7.442e-72
Identity = 186/485 (38.35%), Postives = 238/485 (49.07%), Query Frame = 1
Query: 4003 GERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFS--ILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRNQ 5448
            GERG  G  G  G  G  G  G  G  G  G  GD   G  G  G  G PG +GY G+RG  G  G +G S    YPG  G+ G+KGP+G+ G  G  G+ G  G  G  G+ G +    VR P G  GE G  G KG                                 PG  GD GL G  G  G  G PG  G  G  G  G  G  G+  F+G  G  G  GL G PG               +PG+ G    + G  FA HSQ+T +P CP     LW+GYS L + G+ RA   DL  PGSCL  F+ +PF+FC     C  S RND ++WLS+   M   M+ +  T ++ Y+SRC VCE P++  A HSQ T  P+CP GW+ +W+G SF+M+T  GA G GQ L SPGSCL  F+   F+EC  +G C YY  +  FWL   D  K F+  M   +K    +D +++C VC++N+
Sbjct: 1068 GERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGD--CGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMA-MAVRNPPGQPGENGYPGEKG--------------------------------YPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPG---------------YPGSPGGWAPSRGFTFAKHSQTTAVPQCPPGASQLWEGYSLLYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNSVCHVSSRNDYSFWLSTDEPMTPMMNPVTGTAIRPYISRCAVCEVPTQIIAVHSQDTSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHGRGTCNYYATNHGFWLSIVDQDKQFRKPMSQTLKAGGLKDRVSRCQVCLKNR 1502          

HSP 2 Score: 157.918 bits (398), Expect = 3.039e-38
Identity = 206/611 (33.72%), Postives = 259/611 (42.39%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTG------LPGKEAEKIPG------DKGIQGDVGELGDKGFKGEKG-KNQNVNVL----------------LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIP--------------GKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-------GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT----------LKGYKGIPGEIGPKGFQGLPG---EKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQG---------------QKGIIGMIGEMGSQGDK--GDTGERGSIGIQGYQG---------------EKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQ------KGESGYKGVQGLAGDKGPKGFPGKN----IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            G  GP G  G PG  G+ G+ G+ GY+ K       GD+GE G  GF+G  G+ GE GD G      LPG + +  PG        G  G  G++GD G+ GEKG     VN +                L  + G +GE G++G QG  GF G  G  GE GL G P              G  G+VG  G +G+ G  G  G +G  GR G  G  G  G  G+ G  G  G  G  GE G +G+ G  G   T                           G +GQ G  G++G  G  G  G +G  G PG           G  GP G  G  G  G PG++G  G++G P +           L G  G PGE G  G  GLPG   + GF GE G  GT G RG+ G+ G   Y G  G               Q G+ G+ GE G  GD   G+ G  G  G  GY G                 G +G  GL GL G QG   DGI G  GL G  G+       G+ GY G QG  G+KG  G PG+N    + G  G+ G KG  G  G  G+ G  G +G PG +G+ G  G+ G  G++
Sbjct:  394 GPVGPRGPVGAPGAPGQPGIDGMPGYTEK-------GDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGT--------------------------PGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQG--NDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQ 969          

HSP 3 Score: 153.68 bits (387), Expect = 5.591e-37
Identity = 195/547 (35.65%), Postives = 240/547 (43.88%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGF------------SGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETG---LSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGD---------------PGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEI---------GPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            T+G  G  G  G PG VGE G  G  GY G+ GE G     G+ G  G+             G  G+ GERGD G      +  PG+ G+ G  G+ G  G  G  G      +  +   KG++G  G+ G QG  G PG  G +GE G     G PG+ G  G  G++GEKG  G  GENGL G RG+ G  G+KG  GL+G  G  G  G  G  GD+G  G PG++                             G+ G  G  G  GLRGESG  G  GL G                PG       GP    G  G+ G PG+ G  G  G     L G  G PG+          G  G  G PGE+G  G  G  G  GL G  G  G +G  G++G  G  G  G  G+ G  G  GERG  G+ G QG  G+ G  G  G  G +GP G DG  G  GL G  G+ G  G  G   +A  + P G PG+N  G  GEKG  G  G+ G+ G  G  G  G PG+ G+ G  G  G+ G
Sbjct:  741 TDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNG------DSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGEN-----------------------------GDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPP---GQAGQDGYPGLDGLPGAPG-----LNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMA-VRNPPGQPGEN--GYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPG 1241          

HSP 4 Score: 150.599 bits (379), Expect = 6.238e-36
Identity = 266/792 (33.59%), Postives = 330/792 (41.67%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----------IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILA-IGEKGPKGFQGNIGERGNPGIKGYKGNSGFP-DITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKG----LKGNQGPAGDGIKGMKG--LIGPQGQKGESGYKGVQGLAGDKGPKGFPGK-------NIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERG 4329
            G+ G +G+ G PG+ G +G  GL G  GKKG  G  G +G+ G  G+SG  G  G+ G  G PG   ++           PG  GI G+ G +G  G +GE G N      L   +G+ GE+G +G  G  G+PG  G+ G  GL G  G+ G VG +G+ G  G  G+ GE G     G+ G++G  G  G  G+ G  G  G  GE+GD       GDS  G                          G  GQ GD G+ GL G  G  G+ G+ G PG+    G  G  G QGN G  G PG++G  G  GFP      GY G  G  G KG+ G+PGE G  G  G  G  GL+G  G  G  GY G  GQ G  G +G  G+ G+ GD G +G  G  G +GE G  G  GL G          P  DG  G  G  + GP GQ G+ GY G+ GL G  G  G PG         + G  GE G  G  GE G+ G  G  G  GLPG+ G  G EG  GL+GD                               G+ G  G  G        G++G  G  G+ G  GD G  G  GQ G +GP+G  G  G +G+ G                                       + G  G  GL G    +     GQ G  G  GEKG  G  GD G  GP G A     G  G  G  G PGP G  G     G  GD+GF                +G  G  G  G+PG+ G  G  G
Sbjct:  608 GEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNG-----LPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDN------GDSYPG------------------------NPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGD------------------------------CGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDG---------------------------------------LPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKA-----GYPGAPGTDGYPGPPGLSGM---PGHGGDQGF----------------QGAAGRTGNPGLPGTPGYPGSPG 1271          

HSP 5 Score: 148.288 bits (373), Expect = 2.697e-35
Identity = 188/534 (35.21%), Postives = 228/534 (42.70%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIP-----------GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPG--NKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGL---RGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKG---------NSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-------------IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRG 3531
            G++GD G+ G++G RG DG  G  GE G  G++G  G  G+ G KG  GE G  G PG E +  P           G  G QG  G  G KG  G  G    V       +G  G  G  G  G  G PG   KG +GE G  G        G  G  GE G+ G  GE+GL G         I+G  GL+G  G  GF G PG+ GD G +G  G   TG                              ++G  G+ G    RG  G  GF GL G+PG+   G++G  GF G  G+ G PG+ GY G          +GF      G  G PG  G  G  GLPG  G+ G  G  GT G  G  G  G  G  G  G +G  G++G  G +G  G  G RG  G  GY GE G  G  G+ G  G  G  G  G  G  G  GP G  GE G  G  GL G+ G  G PG               + G  GE G  G  G  G  G  G +G  G PG+ G++GQ G+ G
Sbjct:  294 GQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGP-----RGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGF------AGEPGLPGEPGDCGYPGEDGLPGYD-------IQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTG----------------------------VNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMR--GQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGF---GFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPG 776          

HSP 6 Score: 146.747 bits (369), Expect = 8.741e-35
Identity = 197/588 (33.50%), Postives = 245/588 (41.67%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFS---------------------------------------------------GPKGIKGERGDTGLPGKEA----EKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGN-MGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPG----EIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGI--------------------IGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG----PAGDGIKGMKGLIGPQGQKGESGYKGVQGL---AGDKGPKGFPGKNIM-GSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            G +G  GE G  G+ GL G SG  G  G  GD G  GL GF                                                    GP G+KGE+G  G  G       +  PG  G++G  G+LGD G +G++GK+           G+ GEKG +G QG  G PG  G+KG  G  G PG+ G  G+ G +G  G   G  G +G  G  G QG  G+ G  GL G  G RG +G PG  G  G+ G+PG +  G                         +GE G  G  G  GL GE GD G+ G  G PG      +GP G  G  G  G PGI G  G+ G+      G KG PG    ++GP G+ G PGE+G  G  G  G  G  G +G QG  G+ G+ G  G                      G  G++G  G  GD G  G  G  GY G  G  G+ G  G  G  G    P   G +G  GL+G  G+KG  G  G +G     G  G  G PG+N M G  G  G++G  G  G  G+    GP G+PG  G  G  G RG  GD 
Sbjct:  168 GRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKD--------GVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKG------------------------DRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDI---QGPPGLDGQSGRDGFPGIPGDIGDPGY-----SGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYP---GPSGIPGEDGLVGFPGLRGEHGDN 712          

HSP 7 Score: 145.206 bits (365), Expect = 2.180e-34
Identity = 192/515 (37.28%), Postives = 241/515 (46.80%), Query Frame = 1
Query: 2131 IHGDKGEKGLAGFSGPKGIKGERGDTGLPGKE----AEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL----LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKG--NMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFP----------DITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGP-------TGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG----------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGD------KGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGD 3543
              G KGE+G  GF G      E G  G PG++    A   PG  G +GD G++G KG +G++G   +        L    G  GE+G+ G  GT GFPG  G  G  G SG  G  G+ G SG  GE G  + GRKG  G  GR G  G  G  G  GL+G KGD G  G PG  G  G+ G  G   +G  G+KG  G  G  G+ G         E   L  +G  G  G  G+KG +G VG PG+L + G  G  G +G  G+ G+ G +G +G  G P          +  L G  G PG  G  G  G PG  GF+G+ GP       TG +G  G +G  G QG KG+ G  G+ G +G  G  G  G  G+ G  G+ GY  EKG++G  G  G  G  G          P  DG+ G   + GP G  G+SG  G  G+ GD       G KGFPG  +    G  G  G  GE G+ G  G  G  G PG  G QG+ G  G+ GD
Sbjct:   41 CPGTKGERGNPGFGG------EPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVL--QGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYD-IQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVN-KVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGD 544          

HSP 8 Score: 145.206 bits (365), Expect = 2.475e-34
Identity = 295/1019 (28.95%), Postives = 378/1019 (37.10%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKG---DQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKG---------------------------PKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTID-------------ISGNVTGVRGDRGEKGEKGI------DGDRGIPGDEGSRGDSGLQGPIGEKGN---KGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGH--------KGLKGDKGVKGMD-------------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTG---------------------LPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKN----------------QNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGL---DGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG-DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT-LKGYKGIPGEIGP-KGF 3000
            GL G  G+ G+ G +G PG+      +GPPG  G+ G +G+ G   D G  G  G+KG  G +G+N               G +G  G PG++G  GL G+ G+ G PGM+G++G  G                             GF  P +   P   GD GA G  G  G  G  G  G PG  G  G  G  G  G+ G +GE G    ++ +D  +G  G  G                   +GQ G                 GY G AG+ G  G+ G  G  G  G  G PG++G PG                          G  G  GL G+ GL+G+  D              S  + GV G  GE G  G+      DG  G  G+ G  G  G +G  GE GN    G+   V  PG  GP G  G  GL G  G+RG+ G          G  GD G  G+D             M G KG  G+ GL G +G+ G  G+ G  GE G+ G  G+                              G+ G       G  G  G+KG+PGIPGE G+ GL G                                                    +G  G  GE G  G+ G  G  G  G  G  G  G  G+ G+ G  G  G  G++GE G  G                      PG   + I G  G  G  G  G  G  G  G N                      L  Y G+ G  G+ G +G  G PG  G  G  G+ G+ G  G+ G  G  G  G+ G  GE GL    G++GR G+ G  G  G  G+KG RG  GFPG  G  G+ G PG + + GP                  +   G  GE G  G+KG+ GL G++G  G  G  G PG     G  GP G  G  G  G+ G +G  G +G P +    GY G PG   P +GF
Sbjct:  438 GLPGEPGDCGYPGEDGLPGYD----IQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPG-TGVNK-------------VGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESG----LVGIDGKKGRDGTPG------------------TRGQDG---------------GPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPS------------------------GIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSP-----------------------------GQPG-----YPGQQGREGEKGYPGIPGENGLPGLRG---------------------------------------------------QDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGP-------------MAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPGGWAPSRGF 1279          

HSP 9 Score: 145.206 bits (365), Expect = 2.670e-34
Identity = 208/611 (34.04%), Postives = 258/611 (42.23%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGI---HGDKGEKGLAGFSGP-----------------------------KGIKGERGDTGLPGKEAEK-IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYK-------------------------------GDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVK---GDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLP---------GEKGFKG----EIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQ--------------------GYQGEKGNQGSLGLKGLKGNQG-------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            G KG  G+RG PG  G  GL+GLDG  G KGE GI   +G  G  G+ G +GP                             KG+KGE G +G+PG       PG KG +GD G  G  GF G  G    + V  +  K                               G  G  GVKG +G  G  G  G  G  G  G PG  G+ G+ G  G++G  G+ G  G  G +G QG  G+ G  G  G K   G+ G+ G PG +GD G  G  G+      G+ G  G  G  G +G KG  G  G  G +G +G  G  G  G  G +G+ G       GE G  GF G  G  G PG  GY G  G P   ++G  G+ G+ G  GF G+P         GEKGF G    ++GP G  G  G +G  G  G+ G+ G+ G+ G  GE+G  G  GD GE G  G                      GY G  G+ G+ GL G  G  G       P   G  GM G  G  GQ G  G  G+ G+ G KG  G P     G++G+ G  G  GE G  G  G  G  G PG  G+ G  GQ G  G
Sbjct:   88 GSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGT----GEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTP-----GTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPG 689          

HSP 10 Score: 139.043 bits (349), Expect = 1.912e-32
Identity = 204/617 (33.06%), Postives = 251/617 (40.68%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----IP------------GDKGIQGDVGELGDKGFKGEKGKNQNVNVL-------LTKYKGDNGEKGVKGSQGTA------------------GFPGNKGSKGETGLS--GIPGKHGKVGNSGKDGE------------KGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE---------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLK-------------GYKGIPGE--IGP---------KGFQGLPGEKGFKGEIGPTG---------------TSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD----GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSK---GEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            T G +G  G  G  GE G  G  G+DGY G  G+ G  G  G+ G   + GP GI GE G  G PG   E     +P            G  G+ G  GE G  G  G  G +     +          Y+G  GE G     G                    G PG  G +G+ G S  G PG  G+ G++G DG              G  G KGE+GL G  GRQGN GI G  GLEG  G+ GF G PG+         +G+ G  G+PG++                       G  G++G+ GQ G KG  GL G+ G  G  G +G PG +   G  G  G  GN G  G PG++G  G  G P +  +             GY G PG+   GP          G  GLPG  G  GE G  G                 G  G +G  G  G +G  G  G  G+ G  G  G +GD GE G  G  G  G  G  G  GL G+ G QG +GD    G  G  G+ GP+G  G  G  G+ GL G  G +G PG   M  +   G+ G  G  GE G  G  GD G  G PG  G+ G  G  G  G
Sbjct:  642 TPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDG---YPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGEN-----------------------GLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPG 1232          

HSP 11 Score: 138.272 bits (347), Expect = 3.019e-32
Identity = 197/566 (34.81%), Postives = 251/566 (44.35%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGP--------KGIKGERGDTGLPGKEAEK-IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYK----------------------------------GDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPG---------EKGFKG----EIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGN-----QGSLGLKGLKGNQGPAGD----GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            GE G PG  G  G  G+ G +G  G+SG +G+ G  GL+G  G         KG+KGE G +G+PG       PG KG +GD G  G  GF G  G    + V  +  K                                  G  G KG KG  G  G PG  G  G  G  G+ G+ G +G++G+ G++G  G  G  G  G +G QG  G  G  G +G  G+ G+ G PG +GD G  G  G+      G+ G  G  G  G +G KG  G  G  G +G +G  G  G  G  G +G+ G       GE G  GF G  G  G PG  GY G  G P   ++G  G+ G+ G  GF G+PG         EKGF G    ++GP G  G  G +G  G  G+ G+ G+ G+ G  GE+G  G  GD GE G   + GY G  G      +   G  G  G  GP GD    G+ G  G  G  G  G  GY G  G+ G  G  G PG +   G  G  G KGR G  G +G  G  G  G  G+ G  G +G  G  GD+
Sbjct:  118 GEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGT----GEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPG---LDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQ 676          

HSP 12 Score: 130.568 bits (327), Expect = 7.350e-30
Identity = 230/740 (31.08%), Postives = 288/740 (38.92%), Query Frame = 1
Query: 2356 GEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKG---------------------------------------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-------PAGDGIKGMKGLIGPQGQ----KGESGYKGVQGLAGDKGPKGFPGKN----IMGSKGEKGNKGRIGEMGVKGF-----KGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQ-VGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGL---LGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGE 4386
            G KG +G+ G  G PG+ G+ G+ G  G PG  G     G +G+ G+MG KG  G  G  G  G+ G++G+ GL G+KG+    G PG  G  G  G+PG  + GP                                     G  G++G+ G  GL G PG   +  +G KG +G  G  G PG+    GNSG+P   LKG KG PG  G  GF G+ G KG                                        +G +GP G  G +GR G  GP G  G+ G  G  G+ G+ G  GD G  G+RG  G+ G  GEKG+QG  GL G  G  G       P   G  G +G  GP+G      GE+G  G QG  G +G KG PG +     +G +G  G  G  G+ G+ G      KGD G  G P   GF G+ G  G  GD                                        G    + + G  G  G  G++G+ G  G +G  G  V   GP GY G  GE GM G                                                L G  G   +GE G RG QG  G  G  G+ G+ G  G  G  G  G       G  G+ G PGP+G  G  G  GP G       YPG  G  G  G  GE G  G  G PG  G +GE G+ G  G KG  G  G  G+
Sbjct:   43 GTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMF---GAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEE---GIPGCNGTDGFPGMPG--LAGP------------------------------------PGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGL---PGNSGYP--GLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYP---GFAGEPGLPGEPGD-------------------------CGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDG------------------------------------------------LPGFPGL--HGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDG-------YPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQ 648          

HSP 13 Score: 129.413 bits (324), Expect = 1.495e-29
Identity = 202/584 (34.59%), Postives = 255/584 (43.66%), Query Frame = 1
Query:  184 VLGLIVAVFWIIISLVQD--SESAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVL--PAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSF-------------TTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKT--GKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNG--LTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNR-GDKGFPGIPGERGIDGL 1863
            +LGL  AV  ++ S  QD     AAA C +     C C G  G +G  GFGG  G PG  G  G  G PGA G  G EG  GD G KG  GD+G+ G+ G               + G +G  G PG KG  G+ G +G  G PGM G  G  G  G +  P    L  P   G   ++G  G+KGE G  G  G PGN G  G +G KGD G  G  G  G     +S  K R  +   G KG                    ++     +++G  G  G  G  G  G  G  G  G  G  G  GLKG +GDLG  G+ GK G++G PG  G  G  G++G  G  GY G +G  G  G  G  G++G  G    + G  TG  G  G +G  G+ G +G+PG +G  G  G +GP+G  G  G+                G+ G+ G T  G RGE G+ G  G+ G+ G     G  G  G+ G  + GP G  G +G  G  G  GDIGD G S                             GEKG       G   N+ G  G+PG PGERG+DGL
Sbjct:    6 LLGLTAAVV-LLSSFCQDRIHVDAAAAC-KGCAPPCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPG---------------HPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPG-----VSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPL-GEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQP---------------GIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYS-----------------------------GEKGF-----PGTGVNKVGPDGYPGTPGERGMDGL 517          

HSP 14 Score: 114.39 bits (285), Expect = 6.487e-25
Identity = 205/670 (30.60%), Postives = 259/670 (38.66%), Query Frame = 1
Query: 2470 SGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGE-------------------------RGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGP--------QGPAGDQGI----GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRG 4365
             G  GE+GN G  GE G  G  G+ G  G  G  G+ G +GD G +G  G +GD G+ G PG                                  G  G  G  GL+GE G  G  G  G PG+  +   GP G  G  G  G PG+ G  G  G   +  +G KG+ GE G  G  GLPG  G+ G         L+G KGD GP G  G  G  G+ G +G + + G KG+ G                          +G +G  G +GEKG  G +G  G+ G  GP G  G+KG KG +G  GQ+G+ G  GV G  G+KG           S+GE+G  G  G  G KG  G+ G    PG  GF+G  G  G  G+                                               E G  G  G  G  G KG  G+ GL G VG  GP G  G  G+ G+ G                                                   + G +  G+RG+ G  G  GE G  GE GD G  G         QGP G  G     G  G+ G+ GDP   GY G++G  G   +K     YPG  GE G+ G  G  G  G  G+ G +GE G  GI+GD G+ G+ G
Sbjct:   42 PGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHP--------------------------------GLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGL--AGPPGQSGQNGNPGRPGLSGPPGEGG---VNSQGRKGVKGESGRSGVPGLPGNSGYPG---------LKGAKGDPGPYGLPGFPGVSGLKGRMG-VRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKG-----------SQGEQGLGGTPGYPGTKGGAGEPG---YPGRPGFEGDCGPEGPLGE--------------------------------------------GTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDG---------------------------------------------------MPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDP---GYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDG 552          

HSP 15 Score: 98.2117 bits (243), Expect = 5.531e-20
Identity = 232/781 (29.71%), Postives = 295/781 (37.77%), Query Frame = 1
Query:  280 ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQ---KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGV------------LPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVK--------------MISLDKSRGEIGDK-----------GDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGE---KGEKGIDGDRGIPGDE---GSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKG------------------DKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDG-----YSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKE-AEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKG 2412
            E   NG  G  G+ G  G  G  G  G KG  G PG  G+ G  GY G+ G  G  G  G  G                    G++G  G PGQ    G +G+ G DG+ G PG++GE G  G     LP                +P   G+ G  G  GL G  G+ G VGE G  G  GY+G  G+ G L + G+ G+                 +  L+  RG+ GD            GD GY     +        I G  G++         G++G  G  GR G+ G  G  G+ G+ G  G  G PG+ G PG+                            G  G KGY G+ G+       + G+RG  G+   KGE G+DG  G PG     G+ GD G  G  GE G+ G                   +G DG+ G RGE G  G  G                    G  G D+ G  G+ G +G  G  G  G  G  G  G  G  G  G                      G  G  G+ GE+G      DG  G+ G  G PG+PG  G+ GL G+ GE G  G  G  G  G+ GE+G  G  G +G  G  G  G           GD G  G  G  G  G  G  GL G          G+ G +G  GEKG  G  G  G+ G  G  G PG    +  PG  G+ G  G  GD+GF+G  G+  N                  G  GT G+PG+ G
Sbjct:  609 EAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGA------------------PGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNG-----LPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLK---------GESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQ---------------------------QGREGEKGYPGIPGEN-----GLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGN------------------QGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPG-----------------GPGESGLPGYPGERG--LPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGN-----------------PGLPGTPGYPGSPG 1271          

HSP 16 Score: 95.5153 bits (236), Expect = 3.309e-19
Identity = 201/579 (34.72%), Postives = 249/579 (43.01%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGK-------PGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLP--------QEGV--LP--AERGDKGAKGFSGLKGEIG---EFGDVGEPGNKGMIGYQGDKGDI-GELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRT-TNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-------------IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNC-SDGDAGNRGDKGFPGIPG---------------ERGIDGLN 1866
            +G +GP G +G  G  G PG +G KGD G  G  G++G +G  G+ G KG  G++G+ G  G  G KG  G  G  G  G EG CG         G+ G  G QG+DG+QG  G+ G  G  GP G   P        Q G+  +P   E+GD+G  G+ G  GE G   E GD G PG  G+ GY     DI G  G  G+ G        D   G  GD GD GYS       T  N+V   G  G  G             +G +G  G  G  G  G+RG  G +G +G  G+ G PG  G  G PG  G PG  G+  P   +G  G +G  G  GL G   D      G+ G  G  GE G++G  G PG  GSRG+SGL G  G+KG  G                 G RG DG  G  GE G  G  G  G  G     G  G  G +G  GP G  G+ G  G  G +G+ GD G               + G  G  G  G  G  G  G  G+ GF+GE G        G  G  G+  +PG PG               + G+ GLN
Sbjct:  272 DGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGY-----DIQGPPGLDGQSGR-------DGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPG------------ERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQ-VGYPGPNGDAGAAGLPGP--DGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTP---------------GTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLN 808          

HSP 17 Score: 66.6254 bits (161), Expect = 2.271e-10
Identity = 76/221 (34.39%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGE---IGEFGDVGEPGNKGMIGYQGD------KGDIGELGFKGEKGEPVKMISLDKSRGEIGDKG----DKGYSFTTHLTRTT 933
             G  G  G EG PG  G  G+ G PGA G  G+ GY G+   +G+ G  G QG SG NG            Y G  G  G  G +G  G  G DG+ G+PG  G +G  GP   ++      P E G  G KG+ GL G+    G  G  G PG  G  GY G        G  G+ GF+G  G       L  + G  G  G     +G++F  H   T 
Sbjct: 1085 PGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGE---RGLPGVPGQQGRSGDNG------------YPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGR-TGNPGLPGTPGYPGSPGGWAPSRGFTFAKHSQTTA 1289          

HSP 18 Score: 65.855 bits (159), Expect = 3.641e-10
Identity = 164/513 (31.97%), Postives = 209/513 (40.74%), Query Frame = 1
Query: 3148 GSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS----SNGERGQRGPQGNTGEKGEKGEFGDAGKRG------------PQGPAGDQGIG-------LLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKG---------EVGSVGPTGIPGSKGEKGERGIEG--DLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGI 4581
            G++G++G+ G  G  G  G  G+ G +G+ G  G+ G +G  GD G KG +G  G  G  G  G +G+ GL G KG +G PG N                 G  GF G  G  G PG  G  G  G+ GL G  G  G                                        +  +G KGE G  G  G  G+ G  GL G  GD GP G  G  G +G+KG +G +                               ++ ++G  G  G++G  GR       G  G  GP G  G KG+KG+ GDAG+RG             +G  G+QG+G         G  GE G PG  G+EG  GP+GP G+        G QG  GV+G KG          VG  GP G PG+ G+ G  G+ G  + GD+G  G  G AGE GL G  GD G+ G+ G  G          G         IPGD GD G        GEKG PG 
Sbjct:   43 GTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCN-----------------GTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNS-------------------------------------QGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGY------SGEKGFPGT 495          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 253.062 bits (645), Expect = 3.008e-67
Identity = 99/224 (44.20%), Postives = 141/224 (62.95%), Query Frame = 1
Query: 4777 GSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRN 5445
            G +   HSQ+T++P CP     LW GYS L + G+E++H  DL   GSCLQ FS +PF+FC+    C Y+ RND++YWLS++  + M M +N  +++ Y+SRC VCEAP+   A HSQ+   P CP GW++LW G SF M+TG GA GGGQ LSSPGSCL  F+   F+EC  A+G C Y+     FWL   D+   F++     +K+      +++C VC+++
Sbjct: 1531 GFVLVKHSQTTEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRNDKSYWLSTSEAIPM-MPVNEREIEPYISRCAVCEAPANTIAVHSQTIQIPNCPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTLKSGNLRTRVSRCQVCVKS 1753          

HSP 2 Score: 197.978 bits (502), Expect = 2.150e-50
Identity = 368/1149 (32.03%), Postives = 478/1149 (41.60%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGP--PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKG---------------DIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSC-FNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAG---------------FPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT----LKGYKGIPGEIGPKGFQGLPGEKG---------------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGN--------------QGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRG 3531
            G+ GP G  G  G +G+PG+RG  G   P  PG  G+ G +G  G +G  G+ G +G  G+S +N                  G  G PGQ+GA G  GYDG  G+ G+ G  G KG +G +       P  +G+KG  G+SG   + G  GD G PG  G +G  GD G                 G  G  G+KGEP ++       G  G KG+ G+     +          G  G  G PG  GD       G  G +G  G +GL G+ G+ G  G +G+PG+ G PG  G  G+PG                    G  GL+G  G       ++    G  G  G  G KG  G  G PG+ G  G  GL G                           ++G  G  G  G  GH G+ GDKG  G+         G+ G+ GPKGD G+ G  G  G+KG+    G  +PG  GS G                  F G KG        G  G  G +GFPG PG +G DGL G                                                     G  G  GE+GD G  G  G  G  G+ G+ G  G+ G KGE GL G  G   + G +GD G PG+         PG  G++G+ G  G  GFKG+ G      +   K     GE GV G  GT G                 G  G KG+ G +G+PG+ G+ G + +DG+KG+ G  G+ GL   RG QG  G+ GV G +G  G  G+ G PG+ G+ G+ G+PG +                       G  G  G  GQ G  GF G++GESG  G +GL G  G+  +      G +G++G+ G PG+ G  G  G P +      KG  G+PG  G +G  G PG+KG                KG  G  G  GL+G  G  G  G  G+ G KG  G  G+ G +G  G +GE+G  G+ G  G+ G               QG  G  GL G +     G  G+ GL G  G KGESG  G  G  GD G  G PGK   G  G  G  GR G+ G+ G KG++G  GLPG  GF G  G +G
Sbjct:  431 GVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDS-LN------------------GLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTC--SACAPGTKGEKGLPGYSG---QPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGD------AGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPG------------------LPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPG---------------------------MKGDSGLPGPPGLPGHPGVPGDKGFGGV--------PGLPGIPGPKGDVGNPGLPGLNGQKGE---PGVGVPGQPGSPG------------------FPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPG---------------------------------------------------LSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPG---VTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPK-----GEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGL---RGPQGPSGLPGVPGFKGETGLPGY-GQPGQPGEKGLPGIPGKA-----------------------GRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGV-----PGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQK-----GESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKR--GEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKG 1376          

HSP 3 Score: 154.066 bits (388), Expect = 5.983e-37
Identity = 198/529 (37.43%), Postives = 249/529 (47.07%), Query Frame = 1
Query: 2065 GEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPG------KHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILA------------IGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQG------EKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGF------PGKNIMGSKGEKGN---KGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            G+ G  GL G  G  G++G  G  G KG  GL G SG  G  GE+GD GLPG     +PG +G  G  G+ G  G  G KG++    +  +T  KGD G  G  G+ G  G PG  G KG  G+ G+PG        G  G +G  GE G  G  G  G+ G  G  G  G  G+ G+ G+KGDRGF G PGEKG+ G     G                                   Q GD G  G  G  G +G  GL G PG                GEKG  G  G  G +G PG  G  G  GFP   +KG  G PG+ G  G  GLPG  G KG++G +G  GL G  G  G  G  G++G KG  G+ G  G +G  G  G++G  G  G  G      EKG  G+ G  GLKG+ G P  DG+ G+ GL G  G  G+ G +G+ GL+G+KG  G       PG++I G  G  G    +G+ G  G+ G KG+ G  GLPG+ G +G+ G  G  G K
Sbjct:  835 GDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPG-----VPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDG-----------------------------------QKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPG--MKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAK 1321          

HSP 4 Score: 150.984 bits (380), Expect = 4.392e-36
Identity = 303/928 (32.65%), Postives = 378/928 (40.73%), Query Frame = 1
Query: 1012 KGYEGRAGSKGAEGLKGIRGDLGPI--GKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTG-------KRGEQGHKGLKGDKGVKGMD----------------------------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGT----------SIPGAQXXXXXXXXXXXXXXXXXXXX--XXFIGEKGSCFNCSDGDAGNRGDKGFPGIP---------------------GERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG----DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPK---GFQGNIGERGNPGIKGYKGNSGFPDIT-------LKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
             G +G  G KG  GL G+RG  G    G  G PG+ G+PG                          G  G  G+ G  G  G   D  G  +      G KGEKG+ G  G PG +G RG  G+ GP+G+ G+ G       PG  GP G+ G  GL G+ G       + G  G+ GLKG+ G  G                              + G  G+ G +GL G  G+ G+AG     G+ G  G  G             PG QG  G       +           G  G KG       G  G  G  GFPG+P                     G++G  G+ G                                                     G  GP G+ G+P         GL G +G+KGE G+       G+ G  G  G  G +GD GLPG     +PG  G++G  G  G  G KG                GD    G+ G  G  G+PG K   G+ GL G+PG+ G  G  G+DG  G  G KGE+GL G  G  G  G  G  G  G  G  G  G+PG KG+ G+ GVPG      + G  G  G KG+ GV G  G  G  G  G  G  G  G +G+ G  GD+GF GL G+      GE GP    G +G+ G  G PG++G +G SG P +        L GY G PG+ G KG  G+PG+ G +G  G  G  GL G  G +G  GY    GQ G+ G  G  G  G KGD G+ G  G+ G  G  G  G  G++G KG  G    GI G +G+ G  GQKGE+GY G  GL G  G KGF G     G KG  G  G+ G  G+ G KGD          GF GQ GQ GL G
Sbjct:  468 PGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPN------------------------GYDGRDGVNGLPGAPGTKGDRGGTCSACA--PGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG----YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGE--GGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPG---------------------------------------------------LPGIPGPKGDVGNP---------GLPGLNGQKGEPGV-------GVPGQPGSPGFPGLKGDAGLPG-----LPGTPGLEGQRGFPGAPGLKG----------------GD----GLPGLSGQPGYPGEK---GDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGE-----KGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGY-GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYP---GQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGG--LPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGD---------SGFPGQPGQEGLPG 1248          

HSP 5 Score: 148.288 bits (373), Expect = 2.864e-35
Identity = 219/614 (35.67%), Postives = 270/614 (43.97%), Query Frame = 1
Query: 2077 EQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKV---------GNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLE-----GVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT-LKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQE---GQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGN------------KGDKGNRGLSGQVGDEGPKGYKGQNGENGM 3822
            E+G  GL G SGK G+ G+ G  G KG AG+          G  G PG      PG KG  G  G  G  G +G  G+    N +     G  G  G+ G++G  G+PG  G  G+ G  G+PG  G           G+ G  G+KG  G  G  G+ G +G  GN G+ G+ G +     GV G  G  GFPG KGD G+ G+PG                         G  G +G  G  G KG  GL G SG  G+ G  GD G+  + G +G  GF G  G  G PG+KG  G  G P +T LKG  G PG+ G  G  G PG  G KG  G  G  G +G  G  G  G  G +G+ G+ GM G  G +G+ G  G  G  G+ G  G KG++G  GL G KG  GPA  DG KG  GL G  G +G  G  G+ G+ G KG  G PG    G  GEKG  G  G+ G +G  G  G  GLPG  G +G+    GQ GL G                                         G      ++GD G+ G+ G  G             +GDKG  GL G  GD G  GY GQ GENG 
Sbjct:  653 EKGDAGLPGLSGKPGQDGLPGLPGNKGEAGY----------GQPGQPG-----FPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTP-----------------------GLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRD---------------------------------------GLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGY 1189          

HSP 6 Score: 138.272 bits (347), Expect = 3.165e-32
Identity = 190/519 (36.61%), Postives = 235/519 (45.28%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGF------SGPKGIKGERGDTGLPGKEAEKIPGD----KGIQGDVGELGDKGFKGEKG-KNQNVNVLLTKYKGDN---GEKGVKGSQGTAGFPGNKGSKGETGLSGI--PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD--------------------------QGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGD 3471
            G+ G PG+ G  GL G  GY G KG +GI G  G KG  G       +GPKG  G  G  G PG +            G+ G  G  GD+GF G  G K +         KGD    G+ G++G QG +G PG  G KGETGL G   PG+ G+ G  G  G+ G  G  G  G DG  G  G  G  G  G +G+ G  G  G PG+KGD+G +G PG S                             G  G  G  G  G+RG+ G  G  G+ GD G+    G+KG  G+ G  G  G  G KG+ G  GFP   LKG  G PG+ G  G  GL G+ GF G+ G  G  GL G KG                           QG  G+ G+ GQKG  G+ G  G+ G KG++G  G  G +G  G  G  G  G  GL G  G  G  GI G+KG +G  G  G+ G+ G+ GL G+ G  GFPG         KG  G  G  GV G+ G+
Sbjct:  925 GDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLS-----------------------------GAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPG--LKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGA--------KGEAGFPGTPGVPGYAGE 1404          

HSP 7 Score: 137.502 bits (345), Expect = 5.714e-32
Identity = 301/837 (35.96%), Postives = 362/837 (43.25%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDR-------GFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGF------------------QGNIGERG-----NPGIKGYKGNSGFPDITLKG-YKGIPGEIGPKGFQGLPGEKGF------------------KGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGI--IGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI-GLLGVKGERGDPGPDGYEG---------QRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLG 4347
              G  GPSG  G PG  GE G RG  G S       I G  G+ G  G  G  G KGE G  G+ G   + + G  G  G  G  G  G+ G  G    VN L     G  G KG +G   +A  PG KG KG  G SG PG  G  G  G  G  G+ G  G  G  GR G  G  G  G  GL G KG+        G  G+PG KG+ G  G PG                   G  G  G  G  G  G+ GD G  GL G+ G  G  GL G+ G    G+ G  GF                  QG  GE       NP   G  G  G P    +G Y G PGE+G  GF GLPG KG                   KG  G  G  G+ G KGD G  G  G+ GQKG   +G+ G+ GS G  G  G+ G  G+ G  G +G +G  G  GLKG     GDG+ G+ G  G  G+KG++G  GV G  G  G   FPG++ + G  G KG  G  G  GV G KGD+G    PG  G  G  G  G  G KG+ G PG PG +G  G  G  G +GP G PG  G  G  G        G  G  G  G  G KGD+G  GL G+ G+ GP    GQ G+ G+ G                                G++G +G  G+ G  G +G +G    G+ GQ       GEKG  G  G AG++G  G  G  G+ G  G+KGE G PG DG  G         Q+G  G  G  G S   PG  G+ GV G +G+ G  G  GIPG +G  G  G +G+ G
Sbjct:  429 APGVSGPSGIPGLPGPKGEPGYRGTPGQS-------IPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDG----VNGL----PGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGL--------------PGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKG-----GDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPG---FPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLG---APGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQ------------------------------PGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQ------PGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGA-PGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENG 1188          

HSP 8 Score: 137.117 bits (344), Expect = 8.284e-32
Identity = 208/597 (34.84%), Postives = 254/597 (42.55%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPG----------------KEAEKIPG------------------DKGIQGDVGELGDKGFKGEKG-KNQNVNVLLTKYKGDNG---EKGVKGSQGTAGFPGNKGSKGETGLSGI--PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD--------------------------QGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGL--------------------PGSIGFQGQEGQRGLKGDK 3546
            + G  G  G  G PG  GE GL GL G +G KG+ G  G  G  GL G  G  G+KG  G  G+PG                K    +PG                    G+ G  G  GD+GF G  G K +         KGD G   + G++G QG +G PG  G KGETGL G   PG+ G+ G  G  G+ G  G  G  G DG  G  G  G  G  G +G+ G  G  G PG+KGD+G +G PG S                             G  G  G  G  G+RG+ G  G  G+ GD G+    G+KG  G+ G  G  G  G KG+ G  GFP   LKG  G PG+ G  G  GL G+ GF G+ G  G  GL G KG                           QG  G+ G+ GQKG  G+ G  G+ G KG++G  G  G +G  G  G  G  G  GL G  G  G  GI G+KG +G  G  G+ G+ G+ GL G+ G  GFPG K   G  G  G  G  GE G  G  G  G  GL                    PG  G  G  G  GL+G+K
Sbjct:  893 SPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLS-----------------------------GAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPG--LKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEK 1458          

HSP 9 Score: 131.339 bits (329), Expect = 4.965e-30
Identity = 195/546 (35.71%), Postives = 240/546 (43.96%), Query Frame = 1
Query: 2131 IHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEK--GVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRG---------------------FIGFPGEKGD-------IGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGF------------------QGNIGERG-----NPGIKGYKGNSGFPDITLK-GYKGIPGEIGPKGFQGLPGEKG------------------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGI--IGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGD 3543
            I G  G  G +G  G  G KGE G  G PG   + IPG  G  G  G  G  G KGE G        L   +G  G+   G+ G+ G  G PG  G  G  G++G+PG  G  G+ G        G KGE GL G  G+ G  G +G+ G+ G  GD G                     F G PG+KG+        G  G PG  + G  G  G  G  G+ G  G  G  G  G  G+ GD G  GL G+ G  G  GL G+ G    G+ G  GF                  QG  GE       NP   G  G  G P    + GY G PGE+G  GF GLPG KG                   KG  G  G  G+ G KGD G  G  G+ GQKG   +G+ G+ GS G  G  G+ G  G+ G  G +G +G  G  GLKG     GDG+ G+ G  G  G+KG++G  GV G  G     GFPG++ + G  G KG  G  G  GV G KGD+G  G  G+ G  G  G  G+KG+
Sbjct:  426 IPGAPGVSGPSGIPGLPGPKGEPGYRGTPG---QSIPGLPGKDGKPGLDGAPGRKGENG--------LPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPG--LKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKG-----GDGLPGLSGQPGYPGEKGDAGLPGVPGREGS---PGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGN 950          

HSP 10 Score: 127.102 bits (318), Expect = 7.771e-29
Identity = 199/586 (33.96%), Postives = 252/586 (43.00%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLR------------GLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKG------KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKG------LEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYK-----------------------------GNSGFPDIT----LKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG----------------DGI-----------------------KGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQ 3516
            GE G PG  G  G++            GL G  G KG+ G +G  GEKG AG   P    G++GD GLPG+     PG +G QG  G  G  GFKGE G        Q     L    G  G +G  GS G  G PG  G KGE+G  G  G  G+ G  G  G+KG++G+ G+ GL G  G  G  G+ G++G      L G+ GDRG  G+PG+KG+ G                            G  G  G+ GEKG  G  GF GL+G  G  G +GL G PG+     KG  GF G  G+ G PG+ G K                             G  GFP +       G  G+PG  G KG  G+PG  G KG++G    +G+ G++G+ G  G  G  GQ GI G+ GE+G  G  G  G  G  G++G  G  G  G+ G  G  G  G  G                DG+                       KG+ GL G  G +GE G  G+ G  G+ GP         G  G++GN G  G  G+ G KG +G  GLPG  G  GQ
Sbjct:  976 GEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAG---PAARDGQKGDAGLPGQ-----PGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYP--------------------------GQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGL-----KGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLG---ANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPP--------GLPGQRGNDGYPGAPGLSGEKG-MG--GLPGFPGLDGQ 1508          

HSP 11 Score: 119.398 bits (298), Expect = 2.052e-26
Identity = 284/769 (36.93%), Postives = 346/769 (44.99%), Query Frame = 1
Query: 2362 KGVKGSQGTAGFPGNKGSKGETGLSGIPGKH--GKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLV------------------------GDPGILAIGEKGPKGFQGNIGERGNPGIKGY---------------------KGNSGFPDITLK----GYKGIPGEIGPKGFQGLPGEKGFKGE------IGPTGTSGLRGRKGDQGP--QGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSN-------GERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI------------------------GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSIL--YPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
             G  G  G +G PG  G KGE G  G PG+   G  G  GK G  G  GRKGENGL G RG  G+     + GL G  G RG  G  G  G  GV G+PG   T   GD+G        G KG+KG  G  G+ G  GD+G  G+ G  GD G +GL                         G+P  L +   GP G+ G  GE G PG  G                      KG++G P ++ K    G  G+PG  G  G+ G PG+ GF G        G  GT GL+G  G+  P  Q      GQ G+ G+ G  G  G  G  GE G  G  G  G KG+ G  G  GL G+ G  GD G  G+ GL G  G KG+ G  G+ GL G KG  G             G  G+ G  G  G KGD G  GLPG+ G +GQ G  G  G KG  G PG  G  G  G KG  G  G PG  G  G  G  G       +G+ G  G  G  G KGD G  G SG  G  G  GY G  G  G+ G  G KG+ GL GL G  G  GE G+ G  G  G+KG  G+ G+ G  GL G+ G   +       GE+G+ GP    G+KG+ G  G  G RGPQGP+G  G+                        G+ G  G +G PG  G +G  G  G KG+ G+      PG  G  GV G KG++G  G  G+ G+ G  G+ G+ G  GDKG  G  G+ G+R
Sbjct:  427 PGAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDS----LNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGT--KGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTL-RPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGY-GQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV------------GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDR 1175          

HSP 12 Score: 114.775 bits (286), Expect = 5.014e-25
Identity = 332/941 (35.28%), Postives = 399/941 (42.40%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPG-KEAEKIPGDKGIQGDVGELGDKGFKGEK-----------GKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGK------------DGEKGNMGRKGENGLDGRRGRQGNMGIKG--VKGLEGVKGDRGFIGFPGEKGDIGVTGV---PGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGI----------LAIGEKGPKGFQGNIGE------RGNPGIKGYKGNSG---------------------FPDITLKGYKGIPGEI----GPKGFQGLPGEKGFKGEIG------------PTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERG---------------SIGIQGYQGEKGNQ--------GSLGLKGLKGNQG----PAGDGIKGMKGLIGPQGQKGES------------------GYKGVQGLAGDKGPK------GFPGKNIMGSKGEK--GNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG----RSSNG---ERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI------------GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G +G  GE+GD GE GE G RG  G  G  G+ G+ G KGEKGL+G +GP+G +G  G+ G PG K    + G  GI G  G+ G+ G+ G                   N       G  G  G  G  GT G+PG  G  G  G +G PG  G  GN G              G  G  G  G  GL G +G  G  G  G  + GL G  G  G  G PG KG+ G+ GV   PGDS+ G                             G  G +G  G  G  G  G  GL G PG            A G KG KG  G  G+      RG PG+ G  G++G                     FP   L G KG P ++    GP G+ GL GE GF G+ G            P G  G  G KGD G  G  G  GQ G+ G+ G  G  G  G  G+ G               + G+QG  GE   +        G  GL GL G +G    P   G  G  G  G  G KG+S                  G+ GV GL G  GPK      G PG N  G KGE   G  G+ G  G  G KGD G  GLPG+ G +GQ G  G  G KG  G PG  G  G  G KG  G  G PG  G  G  G  G       +G+ G  G  G  G KGD G  G SG  G  G  GY G  G  G+ G  G KG+ GL GL G  G  GE G+ G  G  G+KG  G+ G+ G  GL G+ G    R  NG   E+G+ GP    G+KG+ G  G  G RGPQGP+G  G+            G  G  GE+G PG  G  G++G  G  G  G    +PG +GE+G  G  G  G  G  G+PG KG+ G+ G  G  G  G+ G  G+ G R
Sbjct:  253 GPRGNPGEKGDKGEPGEGGQRGYPGNGGLSGQPGLPGMKGEKGLSGPAGPRGKEGRPGNAGPPGFKGDRGLDGLGGIPGLPGQKGEAGYPGRDGPKGNSGPPGPPGGGTFNDGAPGPPGLPGRPGNPGPPGTDGYPGAPGPAGPIGNTGGPGLPGYPGNEGLPGPKGDKGDGGIPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNG---------------------------LPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPG--LPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLN--GQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPG-FPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIR 1160          

HSP 13 Score: 110.923 bits (276), Expect = 7.141e-24
Identity = 169/491 (34.42%), Postives = 203/491 (41.34%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGL-----------RGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDS----ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLK-GYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGM-----------------------------------IGEMGSQGDKGDTGERGSIGIQGYQG------------EKGNQGSLGLKGLKGNQG----PAGDGIKGMK 3297
             G +GPSG  G PG  GE GL           +GL G  GK G  G  G  G+ GL GF G KG  G  G  GLPG++   +PG  G +GD+G+ G  G  G  G +                       G  G PG +G KG+ GL GIPG  G  G  G+ GE G  G+ G  GL G +G  G  G  G+KG  G  G  G  G PG KGD G  G PG      ++G  G  G  G  G  G+              Q G  GF GL G+ G+ G  GL G PG+   GE G  GF G  G+ G  GI G +G  G P +  + G  GIPG  G  G  GLPG+ GF G  G  G  GL G  G +G  G+ G  G  G  G                                     GE G  G  G  G RG  G+ G  G            ++GN G  G  GL G +G    P   G+ G  
Sbjct: 1047 RGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDG--LPGVPGQKGDLGQSGQPGLSGAPGLD-----------------------GQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQ-GKDGFPGLPGQKGESGLSGLPGAPGL--KGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQP 1509          

HSP 14 Score: 98.5969 bits (244), Expect = 4.622e-20
Identity = 212/602 (35.22%), Postives = 262/602 (43.52%), Query Frame = 1
Query:  295 GLLGPKGEMGFG--GHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQ---KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS----LPQEGVLPAERGDKGAKGFSGLK---------------GEIGEFGDVGEPGNK------------GMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGL------------QGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDK--------------------------GVKGMD----MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
            GL G KGE G G  G  G PGF G+KGD G PG  G  G EG +G  G  G+ G  G+ G SG  G  G  G  G  G  G EG  G PGQ    G  G++G DG+ G+PG+ G KG  G  G S    LP     P  +G+ G  G  G K               GE G  G  G PG K            G+ G  G KGD G  G  GEKGE     + D  +G+ G  G  G       +        KG+ G+                GY G+ G  G +GL GI G  G  G  G PG++G PG PG+ G  G  G  G  G  G  G  G  G+ G  G  GL G   +D    V G+RGD+G+ G  GI GDRG+ G  G +G++G             +G  G  G  G       PG+ G  G  GL+G  G  G+ G++G  GL G+K                          G++G D    + G KG  G++GL G  G  G++G  G  G KGD+G  G  IPG +      G  G  G  G  G+ G  G KG       G AG  G  GFPGIPG +G  GL
Sbjct:  809 GLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGE-AGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGL---------------PGY-GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANG--IPGKR------GEDGLPGVPGRDGQPGIPGLKGEV-----GGAGLPGQPGFPGIPGLKGEGGL 1380          

HSP 15 Score: 92.8189 bits (229), Expect = 2.120e-18
Identity = 205/570 (35.96%), Postives = 253/570 (44.39%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQG---PKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQ------------------GIPGMQGEKGRKGPKGFSLP--QEGV--LPAERGDKGAKGFSGLKGEIG------EFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT----------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS--------------RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG-SCFNCSDGDAGNRGDKGFPGIPGER 1848
            KG  G  G  G+PG+ G KGD G PG  G +G+ G+ G  G     GM G+ G+ G  G+ G KG  G  G  G  G  G  G PG KG AG+ G  G +                  G+PGM G  G KG  G      ++G+  +P  +GD+G  G  G KGE G      + GD G PG  G+ G QG  G  G  GFKGE G P          G+ G  G+KG                 GQ G+ G PG  G        GY G+ G  G +GL G+ G  G +G+ G+PG +G+PG  G  G+PG RG  G  G        G  G+ G+ GY G KG+           +       G  G  G KG  G  G  G+PG  G +GDSG  G  G++G  G S               G S  G  GP G  GL+G DG  G  G++G  GL G  G  G+     KG  G+ G  G KGD G  G  G  GE G  G  G    PG  G KG  G  G  G+ G PG  G  GE G   F  + G+AG  G  G PG  GE+
Sbjct:  861 KGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLP--------GYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKG------ESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLP------GIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGL-----KGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEK 1405          

HSP 16 Score: 75.0998 bits (183), Expect = 6.195e-13
Identity = 152/452 (33.63%), Postives = 187/452 (41.37%), Query Frame = 1
Query:  349 GFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGY-----DGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGY---------EGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXI--------------------GAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRG------IPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMI-GTKGRKGV 1581
            G  G+KGDRG  G  GEKG  G     G KG   D G+ G  G+ G              G  G  G PG KG  GL GY      G +G+PG+ G+ GR+G            P   G  G  GF G+KGE G  G  G PG  G+ G  G KGD+G+ G  G  G P     LD   G  G +GDKG      +          GQKG  G PG  G  G  G KG+         +G  G  G +GL GI G  G  G  G+PG+ G PG  G  G+ G  G PG  G                            G +G SGL G  GLKG++      + G  G +G+ G  GI G RG      +PG +G  G  GL+G +G  G  G+                G  G+ G  G+ G  G  G KG+ G  G   + G  G KG 
Sbjct: 1006 GVPGMKGDRGFNGLPGEKGEAGPAARDGQKG---DAGLPGQPGLRGP------------QGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQG-----------APGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAP----GLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGES-----GMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQP---------------GFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGD 1407          

HSP 17 Score: 68.9366 bits (167), Expect = 4.002e-11
Identity = 151/467 (32.33%), Postives = 197/467 (42.18%), Query Frame = 1
Query:  295 GLLGPKGEMG------FGGHEGKPGF--RGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGE---------------FGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRG-----EQGHKGLKGDKGVKGMDMIGTKGRKGVNGL 1590
            GL GP+G  G      F G  G PG+   G  G++G PG  G+ G +G  G  G  G+ G  G++G SG  G+ G PG  G  G  G++G  G+ GQ G +G  G DG  G+PG++G+KG+ G           LP   GD+G  G+ G KGE G                 G  G PG KG  GY G  G  G  G KG+ G P       +  +S +K  G +     +                ++G+ G  G PG  G+ G +G  G  G  G  G  G  G +GDLG  G  GK GE+G PG                             G  G  G  GLKG+         G+ G  G  G  G+ G+ G+PG  G++G++G  G  G  G  G       PG  G  G  G  G  G  G  G     E G KGL G  G  G+     +G KG+ GL
Sbjct: 1045 GLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGG-----------LPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPG---------------------------VPGRDGQPGIPGLKGEV-----GGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGL-----RGEKGMPGL 1463          

HSP 18 Score: 65.855 bits (159), Expect = 3.695e-10
Identity = 190/643 (29.55%), Postives = 242/643 (37.64%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGP------------KGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPG---------------------QKGAAGLQGY------DGMQGIPGMQGEK--GRKGPKGF------------------------SLPQEGVLPAERGDKGAKGFSGLKGE---IGEFGDVGEPGNKGMIGYQGD---------------------------------KGDIGELGFK---GEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKG-DTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDA------GEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDG 1860
             C+ C+     G KGE G  G+ G+PG +G +G  G PG +G+ G++G  G  G              G+ G KG      +                GE G  G+PG                     +KG AGL G       DG+ G+PG +GE   G+ G  GF                          P+  V PA  G  G  G  G KGE    G  G+VG+PG  G+ G +GD                                 KGD+G  G     G+KGEP V +     S G  G KGD G      L        ++GQ                  +G+ G  G KG +GL G+ G  G  G+ G  G  G PG+ G                       G  G  GL G  G+KG D +     VTG++GD G  G+ G  G  G PG  G +G++G+ G  G KG+ G        G KG  G  G+ G  G  G  G  G  G  G  GV GM     KG +G NGL G KG+ G A      G+AG  G+ G  G  G S +PG                       GF GE G       G  G  G+KG PGIPG+ G  G
Sbjct:  533 TCSACAP----GTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPG-----LKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAG------LPGLPGTPGLEGQ------------------RGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSP---------------------GFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGM-----KGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVP---------------------GFKGETGL---PGYGQPGQPGEKGLPGIPGKAGRQG 1092          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 253.062 bits (645), Expect = 3.008e-67
Identity = 99/224 (44.20%), Postives = 141/224 (62.95%), Query Frame = 1
Query: 4777 GSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRN 5445
            G +   HSQ+T++P CP     LW GYS L + G+E++H  DL   GSCLQ FS +PF+FC+    C Y+ RND++YWLS++  + M M +N  +++ Y+SRC VCEAP+   A HSQ+   P CP GW++LW G SF M+TG GA GGGQ LSSPGSCL  F+   F+EC  A+G C Y+     FWL   D+   F++     +K+      +++C VC+++
Sbjct: 1531 GFVLVKHSQTTEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRNDKSYWLSTSEAIPM-MPVNEREIEPYISRCAVCEAPANTIAVHSQTIQIPNCPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTLKSGNLRTRVSRCQVCVKS 1753          

HSP 2 Score: 197.978 bits (502), Expect = 2.150e-50
Identity = 368/1149 (32.03%), Postives = 478/1149 (41.60%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGP--PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKG---------------DIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSC-FNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAG---------------FPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT----LKGYKGIPGEIGPKGFQGLPGEKG---------------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGN--------------QGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRG 3531
            G+ GP G  G  G +G+PG+RG  G   P  PG  G+ G +G  G +G  G+ G +G  G+S +N                  G  G PGQ+GA G  GYDG  G+ G+ G  G KG +G +       P  +G+KG  G+SG   + G  GD G PG  G +G  GD G                 G  G  G+KGEP ++       G  G KG+ G+     +          G  G  G PG  GD       G  G +G  G +GL G+ G+ G  G +G+PG+ G PG  G  G+PG                    G  GL+G  G       ++    G  G  G  G KG  G  G PG+ G  G  GL G                           ++G  G  G  G  GH G+ GDKG  G+         G+ G+ GPKGD G+ G  G  G+KG+    G  +PG  GS G                  F G KG        G  G  G +GFPG PG +G DGL G                                                     G  G  GE+GD G  G  G  G  G+ G+ G  G+ G KGE GL G  G   + G +GD G PG+         PG  G++G+ G  G  GFKG+ G      +   K     GE GV G  GT G                 G  G KG+ G +G+PG+ G+ G + +DG+KG+ G  G+ GL   RG QG  G+ GV G +G  G  G+ G PG+ G+ G+ G+PG +                       G  G  G  GQ G  GF G++GESG  G +GL G  G+  +      G +G++G+ G PG+ G  G  G P +      KG  G+PG  G +G  G PG+KG                KG  G  G  GL+G  G  G  G  G+ G KG  G  G+ G +G  G +GE+G  G+ G  G+ G               QG  G  GL G +     G  G+ GL G  G KGESG  G  G  GD G  G PGK   G  G  G  GR G+ G+ G KG++G  GLPG  GF G  G +G
Sbjct:  431 GVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDS-LN------------------GLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTC--SACAPGTKGEKGLPGYSG---QPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGD------AGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPG------------------LPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPG---------------------------MKGDSGLPGPPGLPGHPGVPGDKGFGGV--------PGLPGIPGPKGDVGNPGLPGLNGQKGE---PGVGVPGQPGSPG------------------FPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPG---------------------------------------------------LSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPG---VTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPK-----GEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGL---RGPQGPSGLPGVPGFKGETGLPGY-GQPGQPGEKGLPGIPGKA-----------------------GRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGV-----PGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQK-----GESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKR--GEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKG 1376          

HSP 3 Score: 154.066 bits (388), Expect = 5.983e-37
Identity = 198/529 (37.43%), Postives = 249/529 (47.07%), Query Frame = 1
Query: 2065 GEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPG------KHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILA------------IGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQG------EKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGF------PGKNIMGSKGEKGN---KGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            G+ G  GL G  G  G++G  G  G KG  GL G SG  G  GE+GD GLPG     +PG +G  G  G+ G  G  G KG++    +  +T  KGD G  G  G+ G  G PG  G KG  G+ G+PG        G  G +G  GE G  G  G  G+ G  G  G  G  G+ G+ G+KGDRGF G PGEKG+ G     G                                   Q GD G  G  G  G +G  GL G PG                GEKG  G  G  G +G PG  G  G  GFP   +KG  G PG+ G  G  GLPG  G KG++G +G  GL G  G  G  G  G++G KG  G+ G  G +G  G  G++G  G  G  G      EKG  G+ G  GLKG+ G P  DG+ G+ GL G  G  G+ G +G+ GL+G+KG  G       PG++I G  G  G    +G+ G  G+ G KG+ G  GLPG+ G +G+ G  G  G K
Sbjct:  835 GDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPG-----VPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDG-----------------------------------QKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPG--MKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAK 1321          

HSP 4 Score: 150.984 bits (380), Expect = 4.392e-36
Identity = 303/928 (32.65%), Postives = 378/928 (40.73%), Query Frame = 1
Query: 1012 KGYEGRAGSKGAEGLKGIRGDLGPI--GKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTG-------KRGEQGHKGLKGDKGVKGMD----------------------------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGT----------SIPGAQXXXXXXXXXXXXXXXXXXXX--XXFIGEKGSCFNCSDGDAGNRGDKGFPGIP---------------------GERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG----DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPK---GFQGNIGERGNPGIKGYKGNSGFPDIT-------LKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
             G +G  G KG  GL G+RG  G    G  G PG+ G+PG                          G  G  G+ G  G  G   D  G  +      G KGEKG+ G  G PG +G RG  G+ GP+G+ G+ G       PG  GP G+ G  GL G+ G       + G  G+ GLKG+ G  G                              + G  G+ G +GL G  G+ G+AG     G+ G  G  G             PG QG  G       +           G  G KG       G  G  G  GFPG+P                     G++G  G+ G                                                     G  GP G+ G+P         GL G +G+KGE G+       G+ G  G  G  G +GD GLPG     +PG  G++G  G  G  G KG                GD    G+ G  G  G+PG K   G+ GL G+PG+ G  G  G+DG  G  G KGE+GL G  G  G  G  G  G  G  G  G  G+PG KG+ G+ GVPG      + G  G  G KG+ GV G  G  G  G  G  G  G  G +G+ G  GD+GF GL G+      GE GP    G +G+ G  G PG++G +G SG P +        L GY G PG+ G KG  G+PG+ G +G  G  G  GL G  G +G  GY    GQ G+ G  G  G  G KGD G+ G  G+ G  G  G  G  G++G KG  G    GI G +G+ G  GQKGE+GY G  GL G  G KGF G     G KG  G  G+ G  G+ G KGD          GF GQ GQ GL G
Sbjct:  468 PGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPN------------------------GYDGRDGVNGLPGAPGTKGDRGGTCSACA--PGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG----YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGE--GGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPG---------------------------------------------------LPGIPGPKGDVGNP---------GLPGLNGQKGEPGV-------GVPGQPGSPGFPGLKGDAGLPG-----LPGTPGLEGQRGFPGAPGLKG----------------GD----GLPGLSGQPGYPGEK---GDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGE-----KGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGY-GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYP---GQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGG--LPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGD---------SGFPGQPGQEGLPG 1248          

HSP 5 Score: 148.288 bits (373), Expect = 2.864e-35
Identity = 219/614 (35.67%), Postives = 270/614 (43.97%), Query Frame = 1
Query: 2077 EQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKV---------GNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLE-----GVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT-LKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQE---GQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGN------------KGDKGNRGLSGQVGDEGPKGYKGQNGENGM 3822
            E+G  GL G SGK G+ G+ G  G KG AG+          G  G PG      PG KG  G  G  G  G +G  G+    N +     G  G  G+ G++G  G+PG  G  G+ G  G+PG  G           G+ G  G+KG  G  G  G+ G +G  GN G+ G+ G +     GV G  G  GFPG KGD G+ G+PG                         G  G +G  G  G KG  GL G SG  G+ G  GD G+  + G +G  GF G  G  G PG+KG  G  G P +T LKG  G PG+ G  G  G PG  G KG  G  G  G +G  G  G  G  G +G+ G+ GM G  G +G+ G  G  G  G+ G  G KG++G  GL G KG  GPA  DG KG  GL G  G +G  G  G+ G+ G KG  G PG    G  GEKG  G  G+ G +G  G  G  GLPG  G +G+    GQ GL G                                         G      ++GD G+ G+ G  G             +GDKG  GL G  GD G  GY GQ GENG 
Sbjct:  653 EKGDAGLPGLSGKPGQDGLPGLPGNKGEAGY----------GQPGQPG-----FPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTP-----------------------GLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRD---------------------------------------GLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGY 1189          

HSP 6 Score: 138.272 bits (347), Expect = 3.165e-32
Identity = 190/519 (36.61%), Postives = 235/519 (45.28%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGF------SGPKGIKGERGDTGLPGKEAEKIPGD----KGIQGDVGELGDKGFKGEKG-KNQNVNVLLTKYKGDN---GEKGVKGSQGTAGFPGNKGSKGETGLSGI--PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD--------------------------QGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGD 3471
            G+ G PG+ G  GL G  GY G KG +GI G  G KG  G       +GPKG  G  G  G PG +            G+ G  G  GD+GF G  G K +         KGD    G+ G++G QG +G PG  G KGETGL G   PG+ G+ G  G  G+ G  G  G  G DG  G  G  G  G  G +G+ G  G  G PG+KGD+G +G PG S                             G  G  G  G  G+RG+ G  G  G+ GD G+    G+KG  G+ G  G  G  G KG+ G  GFP   LKG  G PG+ G  G  GL G+ GF G+ G  G  GL G KG                           QG  G+ G+ GQKG  G+ G  G+ G KG++G  G  G +G  G  G  G  G  GL G  G  G  GI G+KG +G  G  G+ G+ G+ GL G+ G  GFPG         KG  G  G  GV G+ G+
Sbjct:  925 GDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLS-----------------------------GAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPG--LKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGA--------KGEAGFPGTPGVPGYAGE 1404          

HSP 7 Score: 137.502 bits (345), Expect = 5.714e-32
Identity = 301/837 (35.96%), Postives = 362/837 (43.25%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDR-------GFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGF------------------QGNIGERG-----NPGIKGYKGNSGFPDITLKG-YKGIPGEIGPKGFQGLPGEKGF------------------KGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGI--IGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI-GLLGVKGERGDPGPDGYEG---------QRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLG 4347
              G  GPSG  G PG  GE G RG  G S       I G  G+ G  G  G  G KGE G  G+ G   + + G  G  G  G  G  G+ G  G    VN L     G  G KG +G   +A  PG KG KG  G SG PG  G  G  G  G  G+ G  G  G  GR G  G  G  G  GL G KG+        G  G+PG KG+ G  G PG                   G  G  G  G  G  G+ GD G  GL G+ G  G  GL G+ G    G+ G  GF                  QG  GE       NP   G  G  G P    +G Y G PGE+G  GF GLPG KG                   KG  G  G  G+ G KGD G  G  G+ GQKG   +G+ G+ GS G  G  G+ G  G+ G  G +G +G  G  GLKG     GDG+ G+ G  G  G+KG++G  GV G  G  G   FPG++ + G  G KG  G  G  GV G KGD+G    PG  G  G  G  G  G KG+ G PG PG +G  G  G  G +GP G PG  G  G  G        G  G  G  G  G KGD+G  GL G+ G+ GP    GQ G+ G+ G                                G++G +G  G+ G  G +G +G    G+ GQ       GEKG  G  G AG++G  G  G  G+ G  G+KGE G PG DG  G         Q+G  G  G  G S   PG  G+ GV G +G+ G  G  GIPG +G  G  G +G+ G
Sbjct:  429 APGVSGPSGIPGLPGPKGEPGYRGTPGQS-------IPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDG----VNGL----PGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGL--------------PGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKG-----GDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPG---FPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLG---APGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQ------------------------------PGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQ------PGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGA-PGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENG 1188          

HSP 8 Score: 137.117 bits (344), Expect = 8.284e-32
Identity = 208/597 (34.84%), Postives = 254/597 (42.55%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPG----------------KEAEKIPG------------------DKGIQGDVGELGDKGFKGEKG-KNQNVNVLLTKYKGDNG---EKGVKGSQGTAGFPGNKGSKGETGLSGI--PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD--------------------------QGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGL--------------------PGSIGFQGQEGQRGLKGDK 3546
            + G  G  G  G PG  GE GL GL G +G KG+ G  G  G  GL G  G  G+KG  G  G+PG                K    +PG                    G+ G  G  GD+GF G  G K +         KGD G   + G++G QG +G PG  G KGETGL G   PG+ G+ G  G  G+ G  G  G  G DG  G  G  G  G  G +G+ G  G  G PG+KGD+G +G PG S                             G  G  G  G  G+RG+ G  G  G+ GD G+    G+KG  G+ G  G  G  G KG+ G  GFP   LKG  G PG+ G  G  GL G+ GF G+ G  G  GL G KG                           QG  G+ G+ GQKG  G+ G  G+ G KG++G  G  G +G  G  G  G  G  GL G  G  G  GI G+KG +G  G  G+ G+ G+ GL G+ G  GFPG K   G  G  G  G  GE G  G  G  G  GL                    PG  G  G  G  GL+G+K
Sbjct:  893 SPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLS-----------------------------GAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPG--LKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEK 1458          

HSP 9 Score: 131.339 bits (329), Expect = 4.965e-30
Identity = 195/546 (35.71%), Postives = 240/546 (43.96%), Query Frame = 1
Query: 2131 IHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEK--GVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRG---------------------FIGFPGEKGD-------IGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGF------------------QGNIGERG-----NPGIKGYKGNSGFPDITLK-GYKGIPGEIGPKGFQGLPGEKG------------------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGI--IGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGD 3543
            I G  G  G +G  G  G KGE G  G PG   + IPG  G  G  G  G  G KGE G        L   +G  G+   G+ G+ G  G PG  G  G  G++G+PG  G  G+ G        G KGE GL G  G+ G  G +G+ G+ G  GD G                     F G PG+KG+        G  G PG  + G  G  G  G  G+ G  G  G  G  G  G+ GD G  GL G+ G  G  GL G+ G    G+ G  GF                  QG  GE       NP   G  G  G P    + GY G PGE+G  GF GLPG KG                   KG  G  G  G+ G KGD G  G  G+ GQKG   +G+ G+ GS G  G  G+ G  G+ G  G +G +G  G  GLKG     GDG+ G+ G  G  G+KG++G  GV G  G     GFPG++ + G  G KG  G  G  GV G KGD+G  G  G+ G  G  G  G+KG+
Sbjct:  426 IPGAPGVSGPSGIPGLPGPKGEPGYRGTPG---QSIPGLPGKDGKPGLDGAPGRKGENG--------LPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPG--LKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKG-----GDGLPGLSGQPGYPGEKGDAGLPGVPGREGS---PGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGN 950          

HSP 10 Score: 127.102 bits (318), Expect = 7.771e-29
Identity = 199/586 (33.96%), Postives = 252/586 (43.00%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLR------------GLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKG------KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKG------LEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYK-----------------------------GNSGFPDIT----LKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG----------------DGI-----------------------KGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQ 3516
            GE G PG  G  G++            GL G  G KG+ G +G  GEKG AG   P    G++GD GLPG+     PG +G QG  G  G  GFKGE G        Q     L    G  G +G  GS G  G PG  G KGE+G  G  G  G+ G  G  G+KG++G+ G+ GL G  G  G  G+ G++G      L G+ GDRG  G+PG+KG+ G                            G  G  G+ GEKG  G  GF GL+G  G  G +GL G PG+     KG  GF G  G+ G PG+ G K                             G  GFP +       G  G+PG  G KG  G+PG  G KG++G    +G+ G++G+ G  G  G  GQ GI G+ GE+G  G  G  G  G  G++G  G  G  G+ G  G  G  G  G                DG+                       KG+ GL G  G +GE G  G+ G  G+ GP         G  G++GN G  G  G+ G KG +G  GLPG  G  GQ
Sbjct:  976 GEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAG---PAARDGQKGDAGLPGQ-----PGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYP--------------------------GQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGL-----KGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLG---ANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPP--------GLPGQRGNDGYPGAPGLSGEKG-MG--GLPGFPGLDGQ 1508          

HSP 11 Score: 119.398 bits (298), Expect = 2.052e-26
Identity = 284/769 (36.93%), Postives = 346/769 (44.99%), Query Frame = 1
Query: 2362 KGVKGSQGTAGFPGNKGSKGETGLSGIPGKH--GKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLV------------------------GDPGILAIGEKGPKGFQGNIGERGNPGIKGY---------------------KGNSGFPDITLK----GYKGIPGEIGPKGFQGLPGEKGFKGE------IGPTGTSGLRGRKGDQGP--QGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSN-------GERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI------------------------GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSIL--YPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
             G  G  G +G PG  G KGE G  G PG+   G  G  GK G  G  GRKGENGL G RG  G+     + GL G  G RG  G  G  G  GV G+PG   T   GD+G        G KG+KG  G  G+ G  GD+G  G+ G  GD G +GL                         G+P  L +   GP G+ G  GE G PG  G                      KG++G P ++ K    G  G+PG  G  G+ G PG+ GF G        G  GT GL+G  G+  P  Q      GQ G+ G+ G  G  G  G  GE G  G  G  G KG+ G  G  GL G+ G  GD G  G+ GL G  G KG+ G  G+ GL G KG  G             G  G+ G  G  G KGD G  GLPG+ G +GQ G  G  G KG  G PG  G  G  G KG  G  G PG  G  G  G  G       +G+ G  G  G  G KGD G  G SG  G  G  GY G  G  G+ G  G KG+ GL GL G  G  GE G+ G  G  G+KG  G+ G+ G  GL G+ G   +       GE+G+ GP    G+KG+ G  G  G RGPQGP+G  G+                        G+ G  G +G PG  G +G  G  G KG+ G+      PG  G  GV G KG++G  G  G+ G+ G  G+ G+ G  GDKG  G  G+ G+R
Sbjct:  427 PGAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDS----LNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGT--KGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTL-RPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGY-GQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV------------GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDR 1175          

HSP 12 Score: 114.775 bits (286), Expect = 5.014e-25
Identity = 332/941 (35.28%), Postives = 399/941 (42.40%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPG-KEAEKIPGDKGIQGDVGELGDKGFKGEK-----------GKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGK------------DGEKGNMGRKGENGLDGRRGRQGNMGIKG--VKGLEGVKGDRGFIGFPGEKGDIGVTGV---PGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGI----------LAIGEKGPKGFQGNIGE------RGNPGIKGYKGNSG---------------------FPDITLKGYKGIPGEI----GPKGFQGLPGEKGFKGEIG------------PTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERG---------------SIGIQGYQGEKGNQ--------GSLGLKGLKGNQG----PAGDGIKGMKGLIGPQGQKGES------------------GYKGVQGLAGDKGPK------GFPGKNIMGSKGEK--GNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG----RSSNG---ERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI------------GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G +G  GE+GD GE GE G RG  G  G  G+ G+ G KGEKGL+G +GP+G +G  G+ G PG K    + G  GI G  G+ G+ G+ G                   N       G  G  G  G  GT G+PG  G  G  G +G PG  G  GN G              G  G  G  G  GL G +G  G  G  G  + GL G  G  G  G PG KG+ G+ GV   PGDS+ G                             G  G +G  G  G  G  G  GL G PG            A G KG KG  G  G+      RG PG+ G  G++G                     FP   L G KG P ++    GP G+ GL GE GF G+ G            P G  G  G KGD G  G  G  GQ G+ G+ G  G  G  G  G+ G               + G+QG  GE   +        G  GL GL G +G    P   G  G  G  G  G KG+S                  G+ GV GL G  GPK      G PG N  G KGE   G  G+ G  G  G KGD G  GLPG+ G +GQ G  G  G KG  G PG  G  G  G KG  G  G PG  G  G  G  G       +G+ G  G  G  G KGD G  G SG  G  G  GY G  G  G+ G  G KG+ GL GL G  G  GE G+ G  G  G+KG  G+ G+ G  GL G+ G    R  NG   E+G+ GP    G+KG+ G  G  G RGPQGP+G  G+            G  G  GE+G PG  G  G++G  G  G  G    +PG +GE+G  G  G  G  G  G+PG KG+ G+ G  G  G  G+ G  G+ G R
Sbjct:  253 GPRGNPGEKGDKGEPGEGGQRGYPGNGGLSGQPGLPGMKGEKGLSGPAGPRGKEGRPGNAGPPGFKGDRGLDGLGGIPGLPGQKGEAGYPGRDGPKGNSGPPGPPGGGTFNDGAPGPPGLPGRPGNPGPPGTDGYPGAPGPAGPIGNTGGPGLPGYPGNEGLPGPKGDKGDGGIPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNG---------------------------LPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPG--LPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLN--GQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPG-FPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIR 1160          

HSP 13 Score: 110.923 bits (276), Expect = 7.141e-24
Identity = 169/491 (34.42%), Postives = 203/491 (41.34%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGL-----------RGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDS----ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLK-GYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGM-----------------------------------IGEMGSQGDKGDTGERGSIGIQGYQG------------EKGNQGSLGLKGLKGNQG----PAGDGIKGMK 3297
             G +GPSG  G PG  GE GL           +GL G  GK G  G  G  G+ GL GF G KG  G  G  GLPG++   +PG  G +GD+G+ G  G  G  G +                       G  G PG +G KG+ GL GIPG  G  G  G+ GE G  G+ G  GL G +G  G  G  G+KG  G  G  G  G PG KGD G  G PG      ++G  G  G  G  G  G+              Q G  GF GL G+ G+ G  GL G PG+   GE G  GF G  G+ G  GI G +G  G P +  + G  GIPG  G  G  GLPG+ GF G  G  G  GL G  G +G  G+ G  G  G  G                                     GE G  G  G  G RG  G+ G  G            ++GN G  G  GL G +G    P   G+ G  
Sbjct: 1047 RGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDG--LPGVPGQKGDLGQSGQPGLSGAPGLD-----------------------GQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQ-GKDGFPGLPGQKGESGLSGLPGAPGL--KGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQP 1509          

HSP 14 Score: 98.5969 bits (244), Expect = 4.622e-20
Identity = 212/602 (35.22%), Postives = 262/602 (43.52%), Query Frame = 1
Query:  295 GLLGPKGEMGFG--GHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQ---KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS----LPQEGVLPAERGDKGAKGFSGLK---------------GEIGEFGDVGEPGNK------------GMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGL------------QGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDK--------------------------GVKGMD----MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
            GL G KGE G G  G  G PGF G+KGD G PG  G  G EG +G  G  G+ G  G+ G SG  G  G  G  G  G  G EG  G PGQ    G  G++G DG+ G+PG+ G KG  G  G S    LP     P  +G+ G  G  G K               GE G  G  G PG K            G+ G  G KGD G  G  GEKGE     + D  +G+ G  G  G       +        KG+ G+                GY G+ G  G +GL GI G  G  G  G PG++G PG PG+ G  G  G  G  G  G  G  G  G+ G  G  GL G   +D    V G+RGD+G+ G  GI GDRG+ G  G +G++G             +G  G  G  G       PG+ G  G  GL+G  G  G+ G++G  GL G+K                          G++G D    + G KG  G++GL G  G  G++G  G  G KGD+G  G  IPG +      G  G  G  G  G+ G  G KG       G AG  G  GFPGIPG +G  GL
Sbjct:  809 GLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGE-AGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGL---------------PGY-GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANG--IPGKR------GEDGLPGVPGRDGQPGIPGLKGEV-----GGAGLPGQPGFPGIPGLKGEGGL 1380          

HSP 15 Score: 92.8189 bits (229), Expect = 2.120e-18
Identity = 205/570 (35.96%), Postives = 253/570 (44.39%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQG---PKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQ------------------GIPGMQGEKGRKGPKGFSLP--QEGV--LPAERGDKGAKGFSGLKGEIG------EFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT----------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS--------------RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG-SCFNCSDGDAGNRGDKGFPGIPGER 1848
            KG  G  G  G+PG+ G KGD G PG  G +G+ G+ G  G     GM G+ G+ G  G+ G KG  G  G  G  G  G  G PG KG AG+ G  G +                  G+PGM G  G KG  G      ++G+  +P  +GD+G  G  G KGE G      + GD G PG  G+ G QG  G  G  GFKGE G P          G+ G  G+KG                 GQ G+ G PG  G        GY G+ G  G +GL G+ G  G +G+ G+PG +G+PG  G  G+PG RG  G  G        G  G+ G+ GY G KG+           +       G  G  G KG  G  G  G+PG  G +GDSG  G  G++G  G S               G S  G  GP G  GL+G DG  G  G++G  GL G  G  G+     KG  G+ G  G KGD G  G  G  GE G  G  G    PG  G KG  G  G  G+ G PG  G  GE G   F  + G+AG  G  G PG  GE+
Sbjct:  861 KGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLP--------GYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKG------ESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLP------GIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGL-----KGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEK 1405          

HSP 16 Score: 75.0998 bits (183), Expect = 6.195e-13
Identity = 152/452 (33.63%), Postives = 187/452 (41.37%), Query Frame = 1
Query:  349 GFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGY-----DGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGY---------EGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXI--------------------GAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRG------IPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMI-GTKGRKGV 1581
            G  G+KGDRG  G  GEKG  G     G KG   D G+ G  G+ G              G  G  G PG KG  GL GY      G +G+PG+ G+ GR+G            P   G  G  GF G+KGE G  G  G PG  G+ G  G KGD+G+ G  G  G P     LD   G  G +GDKG      +          GQKG  G PG  G  G  G KG+         +G  G  G +GL GI G  G  G  G+PG+ G PG  G  G+ G  G PG  G                            G +G SGL G  GLKG++      + G  G +G+ G  GI G RG      +PG +G  G  GL+G +G  G  G+                G  G+ G  G+ G  G  G KG+ G  G   + G  G KG 
Sbjct: 1006 GVPGMKGDRGFNGLPGEKGEAGPAARDGQKG---DAGLPGQPGLRGP------------QGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQG-----------APGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAP----GLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGES-----GMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQP---------------GFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGD 1407          

HSP 17 Score: 68.9366 bits (167), Expect = 4.002e-11
Identity = 151/467 (32.33%), Postives = 197/467 (42.18%), Query Frame = 1
Query:  295 GLLGPKGEMG------FGGHEGKPGF--RGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGE---------------FGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRG-----EQGHKGLKGDKGVKGMDMIGTKGRKGVNGL 1590
            GL GP+G  G      F G  G PG+   G  G++G PG  G+ G +G  G  G  G+ G  G++G SG  G+ G PG  G  G  G++G  G+ GQ G +G  G DG  G+PG++G+KG+ G           LP   GD+G  G+ G KGE G                 G  G PG KG  GY G  G  G  G KG+ G P       +  +S +K  G +     +                ++G+ G  G PG  G+ G +G  G  G  G  G  G  G +GDLG  G  GK GE+G PG                             G  G  G  GLKG+         G+ G  G  G  G+ G+ G+PG  G++G++G  G  G  G  G       PG  G  G  G  G  G  G  G     E G KGL G  G  G+     +G KG+ GL
Sbjct: 1045 GLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGG-----------LPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPG---------------------------VPGRDGQPGIPGLKGEV-----GGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGL-----RGEKGMPGL 1463          

HSP 18 Score: 65.855 bits (159), Expect = 3.695e-10
Identity = 190/643 (29.55%), Postives = 242/643 (37.64%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGP------------KGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPG---------------------QKGAAGLQGY------DGMQGIPGMQGEK--GRKGPKGF------------------------SLPQEGVLPAERGDKGAKGFSGLKGE---IGEFGDVGEPGNKGMIGYQGD---------------------------------KGDIGELGFK---GEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKG-DTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDA------GEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDG 1860
             C+ C+     G KGE G  G+ G+PG +G +G  G PG +G+ G++G  G  G              G+ G KG      +                GE G  G+PG                     +KG AGL G       DG+ G+PG +GE   G+ G  GF                          P+  V PA  G  G  G  G KGE    G  G+VG+PG  G+ G +GD                                 KGD+G  G     G+KGEP V +     S G  G KGD G      L        ++GQ                  +G+ G  G KG +GL G+ G  G  G+ G  G  G PG+ G                       G  G  GL G  G+KG D +     VTG++GD G  G+ G  G  G PG  G +G++G+ G  G KG+ G        G KG  G  G+ G  G  G  G  G  G  G  GV GM     KG +G NGL G KG+ G A      G+AG  G+ G  G  G S +PG                       GF GE G       G  G  G+KG PGIPG+ G  G
Sbjct:  533 TCSACAP----GTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPG-----LKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAG------LPGLPGTPGLEGQ------------------RGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSP---------------------GFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGM-----KGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVP---------------------GFKGETGL---PGYGQPGQPGEKGLPGIPGKAGRQG 1092          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 252.677 bits (644), Expect = 3.695e-67
Identity = 99/224 (44.20%), Postives = 141/224 (62.95%), Query Frame = 1
Query: 4777 GSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRN 5445
            G +   HSQ+T++P CP     LW GYS L + G+E++H  DL   GSCLQ FS +PF+FC+    C Y+ RND++YWLS++  + M M +N  +++ Y+SRC VCEAP+   A HSQ+   P CP GW++LW G SF M+TG GA GGGQ LSSPGSCL  F+   F+EC  A+G C Y+     FWL   D+   F++     +K+      +++C VC+++
Sbjct: 1532 GFVLVKHSQTTEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRNDKSYWLSTSEAIPM-MPVNEREIEPYISRCAVCEAPANTIAVHSQTIQIPNCPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTLKSGNLRTRVSRCQVCVKS 1754          

HSP 2 Score: 200.29 bits (508), Expect = 4.526e-51
Identity = 368/1149 (32.03%), Postives = 478/1149 (41.60%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGP--PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKG---------------DIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSC-FNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAG---------------FPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT----LKGYKGIPGEIGPKGFQGLPGEKG---------------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGN--------------QGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRG 3531
            G+ GP G  G  G +G+PG+RG  G   P  PG  G+ G +G  G +G  G+ G +G  G+S +N                  G  G PGQ+GA G  GYDG  G+ G+ G  G KG +G +       P  +G+KG  G+SG   + G  GD G PG  G +G  GD G                 G  G  G+KGEP ++       G  G KG+ G+     +          G  G  G PG  GD       G  G +G  G +GL G+ G+ G  G +G+PG+ G PG  G  G+PG                    G  GL+G  G       ++    G  G  G  G KG  G  G PG+ G  G  GL G                           ++G  G  G  G  GH G+ GDKG  G+         G+ G+ GPKGD G+ G  G  G+KG+    G  +PG  GS G                  F G KG        G  G  G +GFPG PG +G DGL G                                                     G  G  GE+GD G  G  G  G  G+ G+ G  G+ G KGE GL G  G   + G +GD G PG+         PG  G++G+ G  G  GFKG+ G      +   K     GE GV G  GT G                 G  G KG+ G +G+PG+ G+ G + +DG+KG+ G  G+ GL   RG QG  G+ GV G +G  G  G+ G PG+ G+ G+ G+PG +                       G  G  G  GQ G  GF G++GESG  G +GL G  G+  +      G +G++G+ G PG+ G  G  G P +      KG  G+PG  G +G  G PG+KG                KG  G  G  GL+G  G  G  G  G+ G KG  G  G+ G +G  G +GE+G  G+ G  G+ G               QG  G  GL G +     G  G+ GL G  G KGESG  G  G  GD G  G PGK   G  G  G  GR G+ G+ G KG++G  GLPG  GF G  G +G
Sbjct:  432 GVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDS-LN------------------GLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTC--SACAPGTKGEKGLPGYSG---QPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGD------AGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPG------------------LPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPG---------------------------MKGDSGLPGPPGLPGHPGVPGDKGFGGV--------PGLPGIPGPKGDVGNPGLPGLNGQKGE---PGVGVPGQPGSPG------------------FPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPG---------------------------------------------------LSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPG---VTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPK-----GEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGL---RGPQGPSGLPGVPGFKGETGLPGY-GQPGQPGEKGLPGIPGKA-----------------------GRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGV-----PGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQK-----GESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKR--GEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKG 1377          

HSP 3 Score: 155.221 bits (391), Expect = 2.363e-37
Identity = 202/539 (37.48%), Postives = 253/539 (46.94%), Query Frame = 1
Query: 2044 SGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKG---LAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPG------KHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILA------------IGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQG------EKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGF------PGKNIMGSKGEKGN---KGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
             G  G PG  G+ GL GL G  G +G+ G  G  G KG   L G SG  G  GE+GD GLPG     +PG +G  G  G+ G  G  G KG++    +  +T  KGD G  G  G+ G  G PG  G KG  G+ G+PG        G  G +G  GE G  G  G  G+ G  G  G  G  G+ G+ G+KGDRGF G PGEKG+ G     G                                   Q GD G  G  G  G +G  GL G PG                GEKG  G  G  G +G PG  G  G  GFP   +KG  G PG+ G  G  GLPG  G KG++G +G  GL G  G  G  G  G++G KG  G+ G  G +G  G  G++G  G  G  G      EKG  G+ G  GLKG+ G P  DG+ G+ GL G  G  G+ G +G+ GL+G+KG  G       PG++I G  G  G    +G+ G  G+ G KG+ G  GLPG+ G +G+ G  G  G K
Sbjct:  826 PGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPG-----VPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDG-----------------------------------QKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPG--MKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAK 1322          

HSP 4 Score: 149.828 bits (377), Expect = 1.190e-35
Identity = 219/614 (35.67%), Postives = 270/614 (43.97%), Query Frame = 1
Query: 2077 EQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKV---------GNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLE-----GVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT-LKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQE---GQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGN------------KGDKGNRGLSGQVGDEGPKGYKGQNGENGM 3822
            E+G  GL G SGK G+ G+ G  G KG AG+          G  G PG      PG KG  G  G  G  G +G  G+    N +     G  G  G+ G++G  G+PG  G  G+ G  G+PG  G           G+ G  G+KG  G  G  G+ G +G  GN G+ G+ G +     GV G  G  GFPG KGD G+ G+PG                         G  G +G  G  G KG  GL G SG  G+ G  GD G+  + G +G  GF G  G  G PG+KG  G  G P +T LKG  G PG+ G  G  G PG  G KG  G  G  G +G  G  G  G  G +G+ G+ GM G  G +G+ G  G  G  G+ G  G KG++G  GL G KG  GPA  DG KG  GL G  G +G  G  G+ G+ G KG  G PG    G  GEKG  G  G+ G +G  G  G  GLPG  G +G+    GQ GL G                                         G      ++GD G+ G+ G  G             +GDKG  GL G  GD G  GY GQ GENG 
Sbjct:  654 EKGDAGLPGLSGKPGQDGLPGLPGNKGEAGY----------GQPGQPG-----FPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTP-----------------------GLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRD---------------------------------------GLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGY 1190          

HSP 5 Score: 139.813 bits (351), Expect = 1.262e-32
Identity = 190/519 (36.61%), Postives = 235/519 (45.28%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGF------SGPKGIKGERGDTGLPGKEAEKIPGD----KGIQGDVGELGDKGFKGEKG-KNQNVNVLLTKYKGDN---GEKGVKGSQGTAGFPGNKGSKGETGLSGI--PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD--------------------------QGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGD 3471
            G+ G PG+ G  GL G  GY G KG +GI G  G KG  G       +GPKG  G  G  G PG +            G+ G  G  GD+GF G  G K +         KGD    G+ G++G QG +G PG  G KGETGL G   PG+ G+ G  G  G+ G  G  G  G DG  G  G  G  G  G +G+ G  G  G PG+KGD+G +G PG S                             G  G  G  G  G+RG+ G  G  G+ GD G+    G+KG  G+ G  G  G  G KG+ G  GFP   LKG  G PG+ G  G  GL G+ GF G+ G  G  GL G KG                           QG  G+ G+ GQKG  G+ G  G+ G KG++G  G  G +G  G  G  G  G  GL G  G  G  GI G+KG +G  G  G+ G+ G+ GL G+ G  GFPG         KG  G  G  GV G+ G+
Sbjct:  926 GDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLS-----------------------------GAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPG--LKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGA--------KGEAGFPGTPGVPGYAGE 1405          

HSP 6 Score: 139.428 bits (350), Expect = 1.598e-32
Identity = 300/847 (35.42%), Postives = 352/847 (41.56%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDR-------GFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGF------------------QGNIGERG-----NPGIKGYKGNSGFPDITLKG-YKGIPGEIGPKGFQGLPGEKGF------------------KGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGI--IGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSS-------NGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQG----IGLLGVKGERGDPGPDGYEG---------QRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLG 4347
              G  GPSG  G PG  GE G RG  G S       I G  G+ G  G  G  G KGE G  G+ G   + + G  G  G  G  G  G+ G  G N           G  G KG +G   +A  PG KG KG  G SG PG  G  G  G  G  G+ G  G  G  GR G  G  G  G  GL G KG+        G  G+PG KG+ G  G PG                   G  G  G  G  G  G+ GD G  GL G+ G  G  GL G+ G    G+ G  GF                  QG  GE       NP   G  G  G P    +G Y G PGE+G  GF GLPG KG                   KG  G  G  G+ G KGD G  G  G+ GQKG   +G+ G+ GS G  G  G+ G  G+ G  G +G +G  G  GLKG     GDG+ G+ G  G  G+KG++G  GV G  G  G   FPG++ + G  G KG  G  G  GV G KGD+G    PG  G  G  G  G  G KG+ G PG PG +G  G  G  G +GP G PG  G  G  G        G  G  G  G  G KGD+G  GL G+ G+ GP    GQ G+ G+ G                                               GLRG  G S         GE G  G  G  G+ GEKG  G  GK G QG  G  G     G  G+KGE G PG DG  G         Q+G  G  G  G S   PG  G+ GV G +G+ G  G  GIPG +G  G  G +G+ G
Sbjct:  430 APGVSGPSGIPGLPGPKGEPGYRGTPGQS-------IPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVN--------GLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGL--------------PGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKG-----GDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPG---FPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLG---APGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQ---------------------------------------------PGLRGPQGPSGLPGVPGFKGETGLPG-YGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGA-PGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENG 1189          

HSP 7 Score: 138.272 bits (347), Expect = 3.139e-32
Identity = 208/597 (34.84%), Postives = 254/597 (42.55%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPG----------------KEAEKIPG------------------DKGIQGDVGELGDKGFKGEKG-KNQNVNVLLTKYKGDNG---EKGVKGSQGTAGFPGNKGSKGETGLSGI--PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD--------------------------QGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGL--------------------PGSIGFQGQEGQRGLKGDK 3546
            + G  G  G  G PG  GE GL GL G +G KG+ G  G  G  GL G  G  G+KG  G  G+PG                K    +PG                    G+ G  G  GD+GF G  G K +         KGD G   + G++G QG +G PG  G KGETGL G   PG+ G+ G  G  G+ G  G  G  G DG  G  G  G  G  G +G+ G  G  G PG+KGD+G +G PG S                             G  G  G  G  G+RG+ G  G  G+ GD G+    G+KG  G+ G  G  G  G KG+ G  GFP   LKG  G PG+ G  G  GL G+ GF G+ G  G  GL G KG                           QG  G+ G+ GQKG  G+ G  G+ G KG++G  G  G +G  G  G  G  G  GL G  G  G  GI G+KG +G  G  G+ G+ G+ GL G+ G  GFPG K   G  G  G  G  GE G  G  G  G  GL                    PG  G  G  G  GL+G+K
Sbjct:  894 SPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLS-----------------------------GAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPG--LKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEK 1459          

HSP 8 Score: 132.494 bits (332), Expect = 1.963e-30
Identity = 195/546 (35.71%), Postives = 240/546 (43.96%), Query Frame = 1
Query: 2131 IHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEK--GVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRG---------------------FIGFPGEKGD-------IGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGF------------------QGNIGERG-----NPGIKGYKGNSGFPDITLK-GYKGIPGEIGPKGFQGLPGEKG------------------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGI--IGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGD 3543
            I G  G  G +G  G  G KGE G  G PG   + IPG  G  G  G  G  G KGE G        L   +G  G+   G+ G+ G  G PG  G  G  G++G+PG  G  G+ G        G KGE GL G  G+ G  G +G+ G+ G  GD G                     F G PG+KG+        G  G PG  + G  G  G  G  G+ G  G  G  G  G  G+ GD G  GL G+ G  G  GL G+ G    G+ G  GF                  QG  GE       NP   G  G  G P    + GY G PGE+G  GF GLPG KG                   KG  G  G  G+ G KGD G  G  G+ GQKG   +G+ G+ GS G  G  G+ G  G+ G  G +G +G  G  GLKG     GDG+ G+ G  G  G+KG++G  GV G  G     GFPG++ + G  G KG  G  G  GV G KGD+G  G  G+ G  G  G  G+KG+
Sbjct:  427 IPGAPGVSGPSGIPGLPGPKGEPGYRGTPG---QSIPGLPGKDGKPGLDGAPGRKGENG--------LPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPG--LKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKG-----GDGLPGLSGQPGYPGEKGDAGLPGVPGREGS---PGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGN 951          

HSP 9 Score: 128.642 bits (322), Expect = 3.125e-29
Identity = 199/586 (33.96%), Postives = 252/586 (43.00%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLR------------GLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKG------KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKG------LEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYK-----------------------------GNSGFPDIT----LKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG----------------DGI-----------------------KGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQ 3516
            GE G PG  G  G++            GL G  G KG+ G +G  GEKG AG   P    G++GD GLPG+     PG +G QG  G  G  GFKGE G        Q     L    G  G +G  GS G  G PG  G KGE+G  G  G  G+ G  G  G+KG++G+ G+ GL G  G  G  G+ G++G      L G+ GDRG  G+PG+KG+ G                            G  G  G+ GEKG  G  GF GL+G  G  G +GL G PG+     KG  GF G  G+ G PG+ G K                             G  GFP +       G  G+PG  G KG  G+PG  G KG++G    +G+ G++G+ G  G  G  GQ GI G+ GE+G  G  G  G  G  G++G  G  G  G+ G  G  G  G  G                DG+                       KG+ GL G  G +GE G  G+ G  G+ GP         G  G++GN G  G  G+ G KG +G  GLPG  G  GQ
Sbjct:  977 GEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAG---PAARDGQKGDAGLPGQ-----PGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYP--------------------------GQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGL-----KGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLG---ANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPP--------GLPGQRGNDGYPGAPGLSGEKG-MG--GLPGFPGLDGQ 1509          

HSP 10 Score: 120.553 bits (301), Expect = 8.322e-27
Identity = 284/769 (36.93%), Postives = 346/769 (44.99%), Query Frame = 1
Query: 2362 KGVKGSQGTAGFPGNKGSKGETGLSGIPGKH--GKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLV------------------------GDPGILAIGEKGPKGFQGNIGERGNPGIKGY---------------------KGNSGFPDITLK----GYKGIPGEIGPKGFQGLPGEKGFKGE------IGPTGTSGLRGRKGDQGP--QGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSN-------GERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI------------------------GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSIL--YPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
             G  G  G +G PG  G KGE G  G PG+   G  G  GK G  G  GRKGENGL G RG  G+     + GL G  G RG  G  G  G  GV G+PG   T   GD+G        G KG+KG  G  G+ G  GD+G  G+ G  GD G +GL                         G+P  L +   GP G+ G  GE G PG  G                      KG++G P ++ K    G  G+PG  G  G+ G PG+ GF G        G  GT GL+G  G+  P  Q      GQ G+ G+ G  G  G  G  GE G  G  G  G KG+ G  G  GL G+ G  GD G  G+ GL G  G KG+ G  G+ GL G KG  G             G  G+ G  G  G KGD G  GLPG+ G +GQ G  G  G KG  G PG  G  G  G KG  G  G PG  G  G  G  G       +G+ G  G  G  G KGD G  G SG  G  G  GY G  G  G+ G  G KG+ GL GL G  G  GE G+ G  G  G+KG  G+ G+ G  GL G+ G   +       GE+G+ GP    G+KG+ G  G  G RGPQGP+G  G+                        G+ G  G +G PG  G +G  G  G KG+ G+      PG  G  GV G KG++G  G  G+ G+ G  G+ G+ G  GDKG  G  G+ G+R
Sbjct:  428 PGAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDS----LNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGT--KGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTL-RPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGY-GQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV------------GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDR 1176          

HSP 11 Score: 112.079 bits (279), Expect = 3.344e-24
Identity = 169/491 (34.42%), Postives = 203/491 (41.34%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGL-----------RGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDS----ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLK-GYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGM-----------------------------------IGEMGSQGDKGDTGERGSIGIQGYQG------------EKGNQGSLGLKGLKGNQG----PAGDGIKGMK 3297
             G +GPSG  G PG  GE GL           +GL G  GK G  G  G  G+ GL GF G KG  G  G  GLPG++   +PG  G +GD+G+ G  G  G  G +                       G  G PG +G KG+ GL GIPG  G  G  G+ GE G  G+ G  GL G +G  G  G  G+KG  G  G  G  G PG KGD G  G PG      ++G  G  G  G  G  G+              Q G  GF GL G+ G+ G  GL G PG+   GE G  GF G  G+ G  GI G +G  G P +  + G  GIPG  G  G  GLPG+ GF G  G  G  GL G  G +G  G+ G  G  G  G                                     GE G  G  G  G RG  G+ G  G            ++GN G  G  GL G +G    P   G+ G  
Sbjct: 1048 RGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDG--LPGVPGQKGDLGQSGQPGLSGAPGLD-----------------------GQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQ-GKDGFPGLPGQKGESGLSGLPGAPGL--KGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQP 1510          

HSP 12 Score: 100.908 bits (250), Expect = 7.550e-21
Identity = 320/921 (34.74%), Postives = 385/921 (41.80%), Query Frame = 1
Query: 2089 RGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPG-KEAEKIPGDKGIQGDVGELGDKGFKGEK-----------GKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGK------------DGEKGNMGRKGENGLDGRRGRQGNMGIKG--VKGLEGVKGDRGFIGFPGEKGDIGVTGV---PGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGI----------LAIGEKGPKGFQGNIGE------RGNPGIKGYKGNSG---------------------FPDITLKGYKGIPGEI----GPKGFQGLPGEKGFKGEIG------------PTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERG---------------SIGIQGYQGEKGNQ--------GSLGLKGLKGNQG----PAGDGIKGMKGLIGPQGQKGES------------------GYKGVQGLAGDKGPK------GFPGKNIMGSKGEK--GNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG----RSSNGERGQR---GPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI------------GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            RG  G  G  G+ G+ G KGEKGL+G +GP+G +G  G+ G PG K    + G  GI G  G+ G+ G+ G                   N       G  G  G  G  GT G+PG  G  G  G +G PG  G  GN G              G  G  G  G  GL G +G  G  G  G  + GL G  G  G  G PG KG+ G+ GV   PGDS+ G                             G  G +G  G  G  G  G  GL G PG            A G KG KG  G  G+      RG PG+ G  G++G                     FP   L G KG P ++    GP G+ GL GE GF G+ G            P G  G  G KGD G  G  G  GQ G+ G+ G  G  G  G  G+ G               + G+QG  GE   +        G  GL GL G +G    P   G  G  G  G  G KG+S                  G+ GV GL G  GPK      G PG N  G KGE   G  G+ G  G  G KGD G  GLPG+ G +GQ G  G  G KG  G PG  G  G  G KG  G  G PG  G  G  G  G       +G+ G  G  G  G KGD G  G SG  G  G  GY G  G  G+ G  G KG+ GL GL G  G  GE G+ G  G  G+KG  G+ G+ G  GL G+ G    R  NG  G++   GP    G+KG+ G  G  G RGPQGP+G  G+            G  G  GE+G PG  G  G++G  G  G  G    +PG +GE+G  G  G  G  G  G+PG KG+ G+ G  G  G  G+ G  G+ G R
Sbjct:  274 RGYPGNGGLSGQPGLPGMKGEKGLSGPAGPRGKEGRPGNAGPPGFKGDRGLDGLGGIPGLPGQKGEAGYPGRDGPKGNSGPPGPPGGGTFNDGAPGPPGLPGRPGNPGPPGTDGYPGAPGPAGPIGNTGGPGLPGYPGNEGLPGPKGDKGDGGIPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNG---------------------------LPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPG--LPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLN--GQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPG-FPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIR 1161          

HSP 13 Score: 99.3673 bits (246), Expect = 2.718e-20
Identity = 212/602 (35.22%), Postives = 262/602 (43.52%), Query Frame = 1
Query:  295 GLLGPKGEMGFG--GHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQ---KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS----LPQEGVLPAERGDKGAKGFSGLK---------------GEIGEFGDVGEPGNK------------GMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGL------------QGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDK--------------------------GVKGMD----MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
            GL G KGE G G  G  G PGF G+KGD G PG  G  G EG +G  G  G+ G  G+ G SG  G  G  G  G  G  G EG  G PGQ    G  G++G DG+ G+PG+ G KG  G  G S    LP     P  +G+ G  G  G K               GE G  G  G PG K            G+ G  G KGD G  G  GEKGE     + D  +G+ G  G  G       +        KG+ G+                GY G+ G  G +GL GI G  G  G  G PG++G PG PG+ G  G  G  G  G  G  G  G  G+ G  G  GL G   +D    V G+RGD+G+ G  GI GDRG+ G  G +G++G             +G  G  G  G       PG+ G  G  GL+G  G  G+ G++G  GL G+K                          G++G D    + G KG  G++GL G  G  G++G  G  G KGD+G  G  IPG +      G  G  G  G  G+ G  G KG       G AG  G  GFPGIPG +G  GL
Sbjct:  810 GLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGE-AGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGL---------------PGY-GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANG--IPGKR------GEDGLPGVPGRDGQPGIPGLKGEV-----GGAGLPGQPGFPGIPGLKGEGGL 1381          

HSP 14 Score: 93.9745 bits (232), Expect = 1.118e-18
Identity = 205/570 (35.96%), Postives = 253/570 (44.39%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQG---PKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQ------------------GIPGMQGEKGRKGPKGFSLP--QEGV--LPAERGDKGAKGFSGLKGEIG------EFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT----------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS--------------RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG-SCFNCSDGDAGNRGDKGFPGIPGER 1848
            KG  G  G  G+PG+ G KGD G PG  G +G+ G+ G  G     GM G+ G+ G  G+ G KG  G  G  G  G  G  G PG KG AG+ G  G +                  G+PGM G  G KG  G      ++G+  +P  +GD+G  G  G KGE G      + GD G PG  G+ G QG  G  G  GFKGE G P          G+ G  G+KG                 GQ G+ G PG  G        GY G+ G  G +GL G+ G  G +G+ G+PG +G+PG  G  G+PG RG  G  G        G  G+ G+ GY G KG+           +       G  G  G KG  G  G  G+PG  G +GDSG  G  G++G  G S               G S  G  GP G  GL+G DG  G  G++G  GL G  G  G+     KG  G+ G  G KGD G  G  G  GE G  G  G    PG  G KG  G  G  G+ G PG  G  GE G   F  + G+AG  G  G PG  GE+
Sbjct:  862 KGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLP--------GYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKG------ESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLP------GIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGL-----KGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEK 1406          

HSP 15 Score: 75.8702 bits (185), Expect = 3.212e-13
Identity = 153/457 (33.48%), Postives = 189/457 (41.36%), Query Frame = 1
Query:  334 HEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGY-----DGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGY---------EGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXI--------------------GAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRG------IPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMI-GTKGRKGV 1581
             +G  G  G+KGDRG  G  GEKG  G     G KG   D G+ G  G+ G              G  G  G PG KG  GL GY      G +G+PG+ G+ GR+G            P   G  G  GF G+KGE G  G  G PG  G+ G  G KGD+G+ G  G  G P     LD   G  G +GDKG      +          GQKG  G PG  G  G  G KG+         +G  G  G +GL GI G  G  G  G+PG+ G PG  G  G+ G  G PG  G                            G +G SGL G  GLKG++      + G  G +G+ G  GI G RG      +PG +G  G  GL+G +G  G  G+                G  G+ G  G+ G  G  G KG+ G  G   + G  G KG 
Sbjct: 1002 RDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKG---DAGLPGQPGLRGP------------QGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQG-----------APGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAP----GLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGES-----GMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQP---------------GFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGD 1408          

HSP 16 Score: 69.707 bits (169), Expect = 2.355e-11
Identity = 151/467 (32.33%), Postives = 197/467 (42.18%), Query Frame = 1
Query:  295 GLLGPKGEMG------FGGHEGKPGF--RGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGE---------------FGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRG-----EQGHKGLKGDKGVKGMDMIGTKGRKGVNGL 1590
            GL GP+G  G      F G  G PG+   G  G++G PG  G+ G +G  G  G  G+ G  G++G SG  G+ G PG  G  G  G++G  G+ GQ G +G  G DG  G+PG++G+KG+ G           LP   GD+G  G+ G KGE G                 G  G PG KG  GY G  G  G  G KG+ G P       +  +S +K  G +     +                ++G+ G  G PG  G+ G +G  G  G  G  G  G  G +GDLG  G  GK GE+G PG                             G  G  G  GLKG+         G+ G  G  G  G+ G+ G+PG  G++G++G  G  G  G  G       PG  G  G  G  G  G  G  G     E G KGL G  G  G+     +G KG+ GL
Sbjct: 1046 GLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGG-----------LPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPG---------------------------VPGRDGQPGIPGLKGEV-----GGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGL-----RGEKGMPGL 1464          

HSP 17 Score: 66.6254 bits (161), Expect = 1.884e-10
Identity = 190/643 (29.55%), Postives = 242/643 (37.64%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGP------------KGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPG---------------------QKGAAGLQGY------DGMQGIPGMQGEK--GRKGPKGF------------------------SLPQEGVLPAERGDKGAKGFSGLKGE---IGEFGDVGEPGNKGMIGYQGD---------------------------------KGDIGELGFK---GEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKG-DTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDA------GEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDG 1860
             C+ C+     G KGE G  G+ G+PG +G +G  G PG +G+ G++G  G  G              G+ G KG      +                GE G  G+PG                     +KG AGL G       DG+ G+PG +GE   G+ G  GF                          P+  V PA  G  G  G  G KGE    G  G+VG+PG  G+ G +GD                                 KGD+G  G     G+KGEP V +     S G  G KGD G      L        ++GQ                  +G+ G  G KG +GL G+ G  G  G+ G  G  G PG+ G                       G  G  GL G  G+KG D +     VTG++GD G  G+ G  G  G PG  G +G++G+ G  G KG+ G        G KG  G  G+ G  G  G  G  G  G  G  GV GM     KG +G NGL G KG+ G A      G+AG  G+ G  G  G S +PG                       GF GE G       G  G  G+KG PGIPG+ G  G
Sbjct:  534 TCSACAP----GTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPG-----LKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAG------LPGLPGTPGLEGQ------------------RGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSP---------------------GFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGM-----KGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVP---------------------GFKGETGL---PGYGQPGQPGEKGLPGIPGKAGRQG 1093          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079003)

HSP 1 Score: 493.426 bits (1269), Expect = 2.053e-144
Identity = 656/1902 (34.49%), Postives = 827/1902 (43.48%), Query Frame = 1
Query:  232 QDSESAAAICNRSNCTECSCNGLLGP------KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVL-------PAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGD----------IGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXX----------IGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGE--------KGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGF---KGEKGKNQNVNVLLTKY-----KGDNGEKGVKGSQGTAGFPGNKGS---KGETGLSGIPGKHGKVGNSGKDGEKGNMGR---------------KGENGLDGRRG-----RQGNMGIKGVKGLEGVKGDRGF---IGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD------------------------QGPQGYKGVQGQKGIIGMIGEMGSQG---------------DKGDTGERGSIGIQGYQGEKGNQGSLGLKGL-----KGNQGPAGD----GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG----------------KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGE---KGEFGDAGKRGPQGPAGDQG-------------IGLLGVKGERGDPGPDGYEGQRG------PKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRNQ 5448
            ++  +  A C      E    GL GP      KGEMGF G EG  G +G KGD GP G  G+KG  G  G  G  G+ G +G  GN G              G  G++GC G   Q G  GL+G  GM G  G  G+ G KG KG    + G         P  RG  G  G  G  GE GE GD G  G KG  G  G KG+           G  G KGEKGEP     +  +   +G +GD G      L     E   +G  G+ G  G  G  G  G +G +G  G  G+ G KG RG+ G  G  G PG+ G PG+ G  G PG  GPPGP G                 +GA G  GL G  GL G          G  G +G  G  G  G+ G PG +G +G +GL GP G                +G +     G +G KG  G+ G  G +G +G +G KG+ G  G   +G  G  G  G  G KGD G  G  G  G+ G  GDVG                                  G C +C    AG +GDKG  G+PG  G DG  G  GE+G  GE+G DG  G  G  G+KG+ G  G  G  G  G+  + + +  E  KG  G  G PG  G QG +G +G  G  G  G  G KGEKGL+G  G  G  G  G  G PG   + I G+ G  G  G  GDKG     GEKG+  +  +   K      KG+ G+ G+ G  G  G PG +G    KG TG  G PG  G  G +G  GEKGN G                 G NG  G RG     R G MG  G+ GL+G KGDRG    IGFPG  G +G  G  GD+                             G  G  G  G  G +G+ G  G  G+ G PG+  I   G +G  G  GE G+PG+ G  GN        KG +G PG  GPKGF G+ G  G +G  G  G SG +G KG                         +G QG  G  GQ+G+ GM GE G+QG               +KG  GE G  G++G  G  G  G  G KGL      G  GP G+    G  G+ G  G  G+KGE G +GV G  G+KG  G PG                   +G  G++G+KG  G  G+ G KG+ GP+GL G  G  G +G+RG++G  G                +                            E+G++GE G  G  G  G KG+RGL G  G  G  G  G  G+ G +G IG  G                                           +G+ GR   NG +G  G  G  GE+G     GE G  G  GP GPAG +G              G  G  G +GD GP G++G+RG       KG KGD+G      GP G  G+ G KG+ G  G  G  G  G  GERG  G  G  G  G  GL G++G  G     G KG+ G  G  G +G  G  GE+G IG  I G++G+KG  G  G+ G  G PG  G +G+ G+ G  G  G    KGE G   P  L                               TG +   HSQS  +P C +    LW GYS L + G++ AH  DL SPGSC+  FS +P + C +   C Y+ RND+T+WL++   + M M +   +++ Y+SRCVVCEAP+   A HSQ+   P CPNGW  LW G SFLM+T  G  GGGQ L SPGSCL  F+   F+EC  AKG C +YE    FW+   +S + F+      IK  + +  +++C VCM+N 
Sbjct:   71 KNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGA------------PGINGKDGCDG---QDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQ--------GYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVG----------------------------------GKCSSCR---AGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDA-----------------------------GLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGI--DGVRGRDGAKGEPGSPGLVGMPGN--------KGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGY-----------------------TGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGE-------------------------------------KGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQ----GPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIG--IQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYL----------------------------TGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIPM-MPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKAGERQSHVSRCQVCMKNS 1778          

HSP 2 Score: 297.36 bits (760), Expect = 8.949e-81
Identity = 494/1513 (32.65%), Postives = 622/1513 (41.11%), Query Frame = 1
Query:  220 ISLVQDSESAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGF-----SLPQEGVLPAERGD-----------------KGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKG-------DIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXX----------IGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGE--------KGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGI---------------PGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQG------------LRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAG--------FP--GNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDR---GFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGIL-AIGEKGPKGFQGNIGERGNPGIKGYKGN------------SGFPDIT-LKGYKGIPGEIGPKGFQGLPGEKGFKGEI---GPTGTSGLRGRKGDQGPQGYKGV---QGQKGIIGMIGE---------------MGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
              +V  +  A       NCT      +     E G  G  G  G  G+KG+ G PG  G  G++G KGD GP G  GDKG +G+ G++         G  G  G +G  G PG  G  G  G DG  GIPG++G  G  GP+G+     S  ++G    E GD                  G +GF G KGE G+ G  G  G +G  G +G+KG         G  G KGEKGEP     +  +   +G +GD G      L     E   +G  G+ G  G  G  G  G +G +G  G  G+ G KG RG+ G  G  G PG+ G PG+ G  G PG  GPPGP G                 +GA G  GL G  GL G          G  G +G  G  G  G+ G PG +G +G +GL GP G                +G +     G +G KG  G+ G  G +G +G +G KG+ G  G   +G  G  G  G  G KGD G  G  G  G+ G  GDVG                                  G C +C  G  G++G  G PGI               PGERG DG+NG+ G                                                  G+KG  G  G PG  GE G            L+G  GY G  G  G+ G KG +GL G  GPKG  G +G+ GL G      PG+ G  G  G  G  G  G+  K +         KGD G  G  G +G  G         P  GNKG  G+TG+ G PG+ G  G  G  G KGN G +G  G++G RG  G  G KG +G  GV G+    G  G PG  G  G  G PG S  GP                              +G  G  GL+GE GD+G  G +G PG   ++G  G +G  G  G  G PGI G KG+             G P I  ++G  G  GE G  G  G+PG KG +G     GP G +G+ G  G +GP G  GV   +G KG  G+ G                MG +GD+G  G  G  G+ G  GEKGNQG  GL G  G  G A +  KG KG  GP G +G++G  G  G  G+KG  G       G  GEKG++GR G  G  G  G+ G  GL G  G  G++G  G  G                          G PG+ G  G+ G  G      +RGDKGE G  G  G KG+ G  GL G  G  GPKG +G  G+ G+   +     +     E                                   RG++G +   G +G RG QG  G  G  G  G  G  GP+G  G  G+ + G KG  G PG +G +G  G  G  G++G   L  G  G  G+ GP G  GS G  G+ GS G+ G+ G  G  G KG  GPQG  GER
Sbjct:   55 YDIVDSAGVARGDLPPKNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLH---------GQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGP--------QGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVG----------------------------------GKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTG------------------------------------------------PPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSG-----APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGP------------------------------MGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASE--KGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPG------------------------IPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGE-----------------------RGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLA-GEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGER 1383          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079002)

HSP 1 Score: 493.426 bits (1269), Expect = 2.053e-144
Identity = 656/1902 (34.49%), Postives = 827/1902 (43.48%), Query Frame = 1
Query:  232 QDSESAAAICNRSNCTECSCNGLLGP------KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVL-------PAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGD----------IGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXX----------IGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGE--------KGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGF---KGEKGKNQNVNVLLTKY-----KGDNGEKGVKGSQGTAGFPGNKGS---KGETGLSGIPGKHGKVGNSGKDGEKGNMGR---------------KGENGLDGRRG-----RQGNMGIKGVKGLEGVKGDRGF---IGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD------------------------QGPQGYKGVQGQKGIIGMIGEMGSQG---------------DKGDTGERGSIGIQGYQGEKGNQGSLGLKGL-----KGNQGPAGD----GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG----------------KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGE---KGEFGDAGKRGPQGPAGDQG-------------IGLLGVKGERGDPGPDGYEGQRG------PKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRNQ 5448
            ++  +  A C      E    GL GP      KGEMGF G EG  G +G KGD GP G  G+KG  G  G  G  G+ G +G  GN G              G  G++GC G   Q G  GL+G  GM G  G  G+ G KG KG    + G         P  RG  G  G  G  GE GE GD G  G KG  G  G KG+           G  G KGEKGEP     +  +   +G +GD G      L     E   +G  G+ G  G  G  G  G +G +G  G  G+ G KG RG+ G  G  G PG+ G PG+ G  G PG  GPPGP G                 +GA G  GL G  GL G          G  G +G  G  G  G+ G PG +G +G +GL GP G                +G +     G +G KG  G+ G  G +G +G +G KG+ G  G   +G  G  G  G  G KGD G  G  G  G+ G  GDVG                                  G C +C    AG +GDKG  G+PG  G DG  G  GE+G  GE+G DG  G  G  G+KG+ G  G  G  G  G+  + + +  E  KG  G  G PG  G QG +G +G  G  G  G  G KGEKGL+G  G  G  G  G  G PG   + I G+ G  G  G  GDKG     GEKG+  +  +   K      KG+ G+ G+ G  G  G PG +G    KG TG  G PG  G  G +G  GEKGN G                 G NG  G RG     R G MG  G+ GL+G KGDRG    IGFPG  G +G  G  GD+                             G  G  G  G  G +G+ G  G  G+ G PG+  I   G +G  G  GE G+PG+ G  GN        KG +G PG  GPKGF G+ G  G +G  G  G SG +G KG                         +G QG  G  GQ+G+ GM GE G+QG               +KG  GE G  G++G  G  G  G  G KGL      G  GP G+    G  G+ G  G  G+KGE G +GV G  G+KG  G PG                   +G  G++G+KG  G  G+ G KG+ GP+GL G  G  G +G+RG++G  G                +                            E+G++GE G  G  G  G KG+RGL G  G  G  G  G  G+ G +G IG  G                                           +G+ GR   NG +G  G  G  GE+G     GE G  G  GP GPAG +G              G  G  G +GD GP G++G+RG       KG KGD+G      GP G  G+ G KG+ G  G  G  G  G  GERG  G  G  G  G  GL G++G  G     G KG+ G  G  G +G  G  GE+G IG  I G++G+KG  G  G+ G  G PG  G +G+ G+ G  G  G    KGE G   P  L                               TG +   HSQS  +P C +    LW GYS L + G++ AH  DL SPGSC+  FS +P + C +   C Y+ RND+T+WL++   + M M +   +++ Y+SRCVVCEAP+   A HSQ+   P CPNGW  LW G SFLM+T  G  GGGQ L SPGSCL  F+   F+EC  AKG C +YE    FW+   +S + F+      IK  + +  +++C VCM+N 
Sbjct:   71 KNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGA------------PGINGKDGCDG---QDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQ--------GYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVG----------------------------------GKCSSCR---AGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDA-----------------------------GLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGI--DGVRGRDGAKGEPGSPGLVGMPGN--------KGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGY-----------------------TGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGE-------------------------------------KGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQ----GPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIG--IQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYL----------------------------TGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIPM-MPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKAGERQSHVSRCQVCMKNS 1778          

HSP 2 Score: 297.36 bits (760), Expect = 8.949e-81
Identity = 494/1513 (32.65%), Postives = 622/1513 (41.11%), Query Frame = 1
Query:  220 ISLVQDSESAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGF-----SLPQEGVLPAERGD-----------------KGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKG-------DIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXX----------IGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGE--------KGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGI---------------PGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQG------------LRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAG--------FP--GNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDR---GFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGIL-AIGEKGPKGFQGNIGERGNPGIKGYKGN------------SGFPDIT-LKGYKGIPGEIGPKGFQGLPGEKGFKGEI---GPTGTSGLRGRKGDQGPQGYKGV---QGQKGIIGMIGE---------------MGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
              +V  +  A       NCT      +     E G  G  G  G  G+KG+ G PG  G  G++G KGD GP G  GDKG +G+ G++         G  G  G +G  G PG  G  G  G DG  GIPG++G  G  GP+G+     S  ++G    E GD                  G +GF G KGE G+ G  G  G +G  G +G+KG         G  G KGEKGEP     +  +   +G +GD G      L     E   +G  G+ G  G  G  G  G +G +G  G  G+ G KG RG+ G  G  G PG+ G PG+ G  G PG  GPPGP G                 +GA G  GL G  GL G          G  G +G  G  G  G+ G PG +G +G +GL GP G                +G +     G +G KG  G+ G  G +G +G +G KG+ G  G   +G  G  G  G  G KGD G  G  G  G+ G  GDVG                                  G C +C  G  G++G  G PGI               PGERG DG+NG+ G                                                  G+KG  G  G PG  GE G            L+G  GY G  G  G+ G KG +GL G  GPKG  G +G+ GL G      PG+ G  G  G  G  G  G+  K +         KGD G  G  G +G  G         P  GNKG  G+TG+ G PG+ G  G  G  G KGN G +G  G++G RG  G  G KG +G  GV G+    G  G PG  G  G  G PG S  GP                              +G  G  GL+GE GD+G  G +G PG   ++G  G +G  G  G  G PGI G KG+             G P I  ++G  G  GE G  G  G+PG KG +G     GP G +G+ G  G +GP G  GV   +G KG  G+ G                MG +GD+G  G  G  G+ G  GEKGNQG  GL G  G  G A +  KG KG  GP G +G++G  G  G  G+KG  G       G  GEKG++GR G  G  G  G+ G  GL G  G  G++G  G  G                          G PG+ G  G+ G  G      +RGDKGE G  G  G KG+ G  GL G  G  GPKG +G  G+ G+   +     +     E                                   RG++G +   G +G RG QG  G  G  G  G  G  GP+G  G  G+ + G KG  G PG +G +G  G  G  G++G   L  G  G  G+ GP G  GS G  G+ GS G+ G+ G  G  G KG  GPQG  GER
Sbjct:   55 YDIVDSAGVARGDLPPKNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLH---------GQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGP--------QGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVG----------------------------------GKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTG------------------------------------------------PPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSG-----APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGP------------------------------MGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASE--KGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPG------------------------IPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGE-----------------------RGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLA-GEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGER 1383          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079001)

HSP 1 Score: 493.426 bits (1269), Expect = 2.053e-144
Identity = 656/1902 (34.49%), Postives = 827/1902 (43.48%), Query Frame = 1
Query:  232 QDSESAAAICNRSNCTECSCNGLLGP------KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVL-------PAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGD----------IGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXX----------IGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGE--------KGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGF---KGEKGKNQNVNVLLTKY-----KGDNGEKGVKGSQGTAGFPGNKGS---KGETGLSGIPGKHGKVGNSGKDGEKGNMGR---------------KGENGLDGRRG-----RQGNMGIKGVKGLEGVKGDRGF---IGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD------------------------QGPQGYKGVQGQKGIIGMIGEMGSQG---------------DKGDTGERGSIGIQGYQGEKGNQGSLGLKGL-----KGNQGPAGD----GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG----------------KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGE---KGEFGDAGKRGPQGPAGDQG-------------IGLLGVKGERGDPGPDGYEGQRG------PKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRNQ 5448
            ++  +  A C      E    GL GP      KGEMGF G EG  G +G KGD GP G  G+KG  G  G  G  G+ G +G  GN G              G  G++GC G   Q G  GL+G  GM G  G  G+ G KG KG    + G         P  RG  G  G  G  GE GE GD G  G KG  G  G KG+           G  G KGEKGEP     +  +   +G +GD G      L     E   +G  G+ G  G  G  G  G +G +G  G  G+ G KG RG+ G  G  G PG+ G PG+ G  G PG  GPPGP G                 +GA G  GL G  GL G          G  G +G  G  G  G+ G PG +G +G +GL GP G                +G +     G +G KG  G+ G  G +G +G +G KG+ G  G   +G  G  G  G  G KGD G  G  G  G+ G  GDVG                                  G C +C    AG +GDKG  G+PG  G DG  G  GE+G  GE+G DG  G  G  G+KG+ G  G  G  G  G+  + + +  E  KG  G  G PG  G QG +G +G  G  G  G  G KGEKGL+G  G  G  G  G  G PG   + I G+ G  G  G  GDKG     GEKG+  +  +   K      KG+ G+ G+ G  G  G PG +G    KG TG  G PG  G  G +G  GEKGN G                 G NG  G RG     R G MG  G+ GL+G KGDRG    IGFPG  G +G  G  GD+                             G  G  G  G  G +G+ G  G  G+ G PG+  I   G +G  G  GE G+PG+ G  GN        KG +G PG  GPKGF G+ G  G +G  G  G SG +G KG                         +G QG  G  GQ+G+ GM GE G+QG               +KG  GE G  G++G  G  G  G  G KGL      G  GP G+    G  G+ G  G  G+KGE G +GV G  G+KG  G PG                   +G  G++G+KG  G  G+ G KG+ GP+GL G  G  G +G+RG++G  G                +                            E+G++GE G  G  G  G KG+RGL G  G  G  G  G  G+ G +G IG  G                                           +G+ GR   NG +G  G  G  GE+G     GE G  G  GP GPAG +G              G  G  G +GD GP G++G+RG       KG KGD+G      GP G  G+ G KG+ G  G  G  G  G  GERG  G  G  G  G  GL G++G  G     G KG+ G  G  G +G  G  GE+G IG  I G++G+KG  G  G+ G  G PG  G +G+ G+ G  G  G    KGE G   P  L                               TG +   HSQS  +P C +    LW GYS L + G++ AH  DL SPGSC+  FS +P + C +   C Y+ RND+T+WL++   + M M +   +++ Y+SRCVVCEAP+   A HSQ+   P CPNGW  LW G SFLM+T  G  GGGQ L SPGSCL  F+   F+EC  AKG C +YE    FW+   +S + F+      IK  + +  +++C VCM+N 
Sbjct:   71 KNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGA------------PGINGKDGCDG---QDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQ--------GYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVG----------------------------------GKCSSCR---AGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDA-----------------------------GLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGI--DGVRGRDGAKGEPGSPGLVGMPGN--------KGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGY-----------------------TGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGE-------------------------------------KGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQ----GPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIG--IQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYL----------------------------TGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIPM-MPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKAGERQSHVSRCQVCMKNS 1778          

HSP 2 Score: 297.36 bits (760), Expect = 8.949e-81
Identity = 494/1513 (32.65%), Postives = 622/1513 (41.11%), Query Frame = 1
Query:  220 ISLVQDSESAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGF-----SLPQEGVLPAERGD-----------------KGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKG-------DIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXX----------IGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGE--------KGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGI---------------PGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQG------------LRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAG--------FP--GNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDR---GFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGIL-AIGEKGPKGFQGNIGERGNPGIKGYKGN------------SGFPDIT-LKGYKGIPGEIGPKGFQGLPGEKGFKGEI---GPTGTSGLRGRKGDQGPQGYKGV---QGQKGIIGMIGE---------------MGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
              +V  +  A       NCT      +     E G  G  G  G  G+KG+ G PG  G  G++G KGD GP G  GDKG +G+ G++         G  G  G +G  G PG  G  G  G DG  GIPG++G  G  GP+G+     S  ++G    E GD                  G +GF G KGE G+ G  G  G +G  G +G+KG         G  G KGEKGEP     +  +   +G +GD G      L     E   +G  G+ G  G  G  G  G +G +G  G  G+ G KG RG+ G  G  G PG+ G PG+ G  G PG  GPPGP G                 +GA G  GL G  GL G          G  G +G  G  G  G+ G PG +G +G +GL GP G                +G +     G +G KG  G+ G  G +G +G +G KG+ G  G   +G  G  G  G  G KGD G  G  G  G+ G  GDVG                                  G C +C  G  G++G  G PGI               PGERG DG+NG+ G                                                  G+KG  G  G PG  GE G            L+G  GY G  G  G+ G KG +GL G  GPKG  G +G+ GL G      PG+ G  G  G  G  G  G+  K +         KGD G  G  G +G  G         P  GNKG  G+TG+ G PG+ G  G  G  G KGN G +G  G++G RG  G  G KG +G  GV G+    G  G PG  G  G  G PG S  GP                              +G  G  GL+GE GD+G  G +G PG   ++G  G +G  G  G  G PGI G KG+             G P I  ++G  G  GE G  G  G+PG KG +G     GP G +G+ G  G +GP G  GV   +G KG  G+ G                MG +GD+G  G  G  G+ G  GEKGNQG  GL G  G  G A +  KG KG  GP G +G++G  G  G  G+KG  G       G  GEKG++GR G  G  G  G+ G  GL G  G  G++G  G  G                          G PG+ G  G+ G  G      +RGDKGE G  G  G KG+ G  GL G  G  GPKG +G  G+ G+   +     +     E                                   RG++G +   G +G RG QG  G  G  G  G  G  GP+G  G  G+ + G KG  G PG +G +G  G  G  G++G   L  G  G  G+ GP G  GS G  G+ GS G+ G+ G  G  G KG  GPQG  GER
Sbjct:   55 YDIVDSAGVARGDLPPKNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLH---------GQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGP--------QGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVG----------------------------------GKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTG------------------------------------------------PPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSG-----APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGP------------------------------MGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASE--KGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPG------------------------IPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGE-----------------------RGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLA-GEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGER 1383          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0333541)

HSP 1 Score: 388.267 bits (996), Expect = 4.873e-109
Identity = 434/1254 (34.61%), Postives = 558/1254 (44.50%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKI-------PGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTK-------YKGDNGEKGVKGSQGTAG-----------------------FPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKG---------DIGVTGVPG------DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKG------FTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQG------LPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIG--------IQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGP------------------IGLPGSIG-------FQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSN-GERGQRGPQGNTGEKGEKGEFGDAGKR--GPQGPAGDQGI-GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSIL-------YPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRG------NTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMR 5442
            GD G SG RGD G+ GE+G  G DG  G++GE+G  GD G+   AG+ G  G  G  G  G PG+ A          PG  GI+G+ G+ GD GFKG KG+     +           Y G  G KG KG QG  G                       +PG  G  G+ G  G+PG+ G+ G  G  G KG  G  G+  + G  G  G  GIKG  G  G  G  G  G PG KG          +G TG+PG      D + GP G KG  G  G     G KG  G  G  GQ G  G      F+G RG  G+ G +GL G PGI  +      G  G IGERG  G  G +G     DI   G +G  GE GPKG  G       PG  G  G  G TG  G  GR G +G   Y G++G  G  G+ G +G  G  G  G+RG +G        + G +GE G+ G  GL G  G +G  GD G+ G +G  G  G KG  GY G  G+ G KG  GFPG    G KG +G  G +G  G  G  GD GP                  +G+PG +        ++G  G +GL+G++                                              E+GD G IG  G  G KG++G+ G +GQ+G +G +G KG  G+ G +G                                       +   KGD G+ G+ GR+   G  GQ+G  G  GE G  G  G  G +  GP GP GD G  G  G  G  G  GP G  G  G +G +G+ G++I+         G QGE G  G KGE G  G  G  G  G  G RG  GD G  G+ G  GL G +G  G                                    PGD+G+ GL G +G++G+ G PG+ G QG +G VG RG+      +GE G+ G  G  G+ G KG  G  G PG+RG PG QGE         + G IFA HSQS  +P CP+ T +LW+GYS  G   + RA   DL   GSC+  F+ +P++ C+    C ++  ND + WLS+A  M M+M  I    +  Y+SRCVVCE  ++  A HSQS   P CP GW  +W+G S+ M+T     G GQ L SPGSCL  F+    +EC   G C YY+    FWL   +    F       +K   +   I++C VC R
Sbjct:  614 GDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGD---AGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGL-----PGMIGEIGERGEIGYNGRQG-----DI---GPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGP--QGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGER---------------------------------------------GEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRG----------------------------------PPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMAR---------------------------PGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGD------QGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRGFIFARHSQSVHVPQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDSLWLSTAEPMPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIECHGHGRCNYYDALASFWLTVIEEQDQFVQPRQQTLKADFTSK-ISRCTVCRR 1736          

HSP 2 Score: 243.047 bits (619), Expect = 5.195e-64
Identity = 442/1343 (32.91%), Postives = 560/1343 (41.70%), Query Frame = 1
Query:  169 RLMKLVLGLIVAVFWIIISLVQDSESAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPG---ALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGE---------FGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGE----PVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSG---------LQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTG--------------KRGEQG---------------HKGLKGDKGVK---GMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG----SCFNCSDGDAGNR---GDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGK------VGNSGKDGEKGNMGRKGENGLDGRR------------GRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLV---GDPGIL-AIGEKGPKG------FQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRG--------------RKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVK------GFKGDIGPIGLPGSIGF---QGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPK------GYKGQNGENGMKG 3828
            R ++ + GL+  V +++ SLV  + +   ICN    T C C G+   KG MG  G  G PG  G  GD GPPG    LGEKG+ G  G+QG KG  GD G +G  G              G  G+ G  G PG +G  G  G  GMQG  G  G+ G +GP G    Q     A  G   +KG  G +GE G+          GD G  G+ G  G  G+KGD G  G KG+ G     P  +I    ++GE GD      S +  L         KG  G++         GD G +G  G  G+ G  GL G RG++G  G+ GKPG++G PG+                            G+ G+KG  G            TG  G  G  GE+G DG  G+PG +G  G  G         L GPIG +G+ G       PG  G  G +G  GL G++G              +RGE G                 GL G  G+    G +++G KG  G+NG  G +G  GD GE G  G+KG  G+ G +I G  GS+G  G  G  G  G  G RG  GEKG     C  C+ G  G R   GD G+PG  G RG  GL G                                                     G +G  G  G  G  G  G  G+ G  GK G +G  G   E G          KGE GDT           GD G +GD G+ G+KG  G  G            KG+ GE G +G  G AG+ G  G  G  G  G PG++        +G  G DG KG  G  G+ G  G +            G  G  G  G KG++G KG++G IG    +G+IG  G  G+ I GP                              +G KG+ G  G+ G +G  GL    G+PG+   IG KG +G       QG IG  G  GIKG+ G+ G P     G  G+ G  GPKG +G  G  G  G+ G  G  G RG              R G Q P G KG +G+ G +G  G+ G++G  G +G RG +G  G QG  G+ G  GL G+ G  G  G+ G  G +G IGP+G  GE G K   GL+GD GP G+PG N + G KGE GN G  G  G K      G KGD G  GL G IG+    G +GQRG  GD                                        G + ++ E G  G  G  G  G KG +G+RGL GQ G  G        GY G+NG NG+KG
Sbjct:    4 RDLRHLSGLL-GVVYLLGSLVSVTLADGKICN---TTLCDCKGI---KGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGY------------PGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGD------SLSGVLKPDDTLKGYKGYVGLQ---------GDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGR---------------------------FGDKGMKGAPGW-----------TGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGE-GYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTG---------------------------------------------------PRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSL-------RKGEIGDT-----------GDSGHRGDTGDDGEKGRDGSDGS-----------KGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGL---RGEIGDRGPAGEVIPGP------------------------------VGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAP-----GQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPK---GLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDS----------------------------------QPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKG 1118          

HSP 3 Score: 190.274 bits (482), Expect = 6.726e-48
Identity = 210/546 (38.46%), Postives = 262/546 (47.99%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGE---KGLAGFSGPKGI---------KGERGDTGLPGKEAEK-------IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGF---PDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQ-----------GYKGVQGQKGIIGMIGEMGSQGDKGDTGERGS-----IGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            +G  G  G  G PG +GE G RG  GY+G++G+ G  G  GE   KGL+G  GP G          KGE G+ G PG+   K       I GD G  G  G +G  G  G KG+   V        G  G KG  GS G  G PG  G KG+ G  G+PG+ G+ G  G  G  G  GR G NGL      +G  G  G +G +G +G+ G +G  G  G IG  G P   I           +  V      +        +G  GD+G  G RGE GD G  G +G PG  A GE+G  G+ G +G  G  G+KG++G+ G    P ITL   KG  G  G  G  G PG  G KG  GP G +G  G  G +GPQ           G+ G  G  G  G+IG  G  GD G  GERG      +G QG  G+ G QG  G  G KG QG P   G  G  G  GP+G  G++G+ G+ G+ G  GPKG PG     S    G++   GE G+ GF+G+ G  G PG IGFQGQ G  G +GD+
Sbjct:  932 QGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGL------KGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQG-PRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPG--AKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDR---GEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQ 1465          

HSP 4 Score: 161.77 bits (408), Expect = 3.726e-39
Identity = 289/949 (30.45%), Postives = 382/949 (40.25%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIP---------------------------------------GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKG---------VKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG-------DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPK--------------------------------GFQGNIGERGNPGIKGYKGNSGFPDITLKG----------------------YKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQG--------------------------YQGEKGNQGSLGLKGLKGNQGPAG----DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIM----------GSKGEKGNKGRIGEMGVKGFKGDIGP------IGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGN-----KGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYP----------GPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRG 4365
            G++G  G RGD G  GE G  G+ G SG+ G  G  G  G  G  G  GP G  G+ G  G PGK  ++ P                                       GD G  G  GE GD G  G KG    V+ L     G  G KG         +K      G+ G  G +G+ G  G  G+ G VG +G  G +G +G  GE G  G+ G  G  G KG+KG  G  G  G  G PGE+G+ G TG+PG         I  P   K   G +G  G+ G  G+ G  G  G+ G +G  GL G+SGD G  G  G PG    GE G                                  G +G  G  G PG++GY+G+ G  ++ L G                      ++G+PG+ G  G +GLPGEKG +G+  P   +G RG +G +G  GY G  G +G IG+ G  G QG +G+ G  G  G+ G                           +GE G+ G  G +G  G+ G  G    DG KG +G  G +G  G++GY+G  G  G  G  G PG+N            G  G KG +G  G+ G KG KG+  P       G PG  G+ G +G +G KG+                                             +   G +GEIG++G  G       G KG  G +G  G +G  G  G++GE G+ G IG KG+                                          RG+ G+     +G+ GP G +G KG  G+ G  G+ G  G  G +     GVKGE+   GPDG  GQ G  G KG +G  ++ P          G Q   G KG KGEVGS+G  G  G+KG  G  G  G LG+ G++G
Sbjct:   84 GEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRG--EVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGE---------------------------------------------QGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQ------------------------------------------RGVPGQEV--IQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPK-----GVKGEQ---GPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQG 933          

HSP 5 Score: 110.153 bits (274), Expect = 1.597e-23
Identity = 215/609 (35.30%), Postives = 270/609 (44.33%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAA---GLQGYDGMQGI------PGMQGEKGRKGPKGFSLPQ-EGV--------------------LPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGY--------------------SFTTHLTRT-----TNEVMIKGQKGIRXXXXXXXXXXXXXAKG------YEGRAGSKGAEGLKGIRGDLGPIGKHG--KPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEK--GEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS--RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGE---------AGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSC----------FNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
            GLLG  G  G  G  G PG  G+ G+ G  G +G  G +G  G +GP G  G KG+ G+ G +G  GA GL G KG TG  G  G+PG KG A   G++G DG  G+      PG  G KG++GP G S P  +GV                    L  +RGD+G  G  G  GE G  G  G PG  G+ G +G  G  G  G KG +GE   ++ LD   G+IGD+G +G                            R+     T +  ++G++G +G  GP G +G  GAKG      Y G+ G  GAEGLKG +GD GP G  G   P E G  G  G+D                     G AG  G  G KG  G   +   N  G  G RG +  G  G  GD G PG  G  G  GL GP GE G+ GR   RG S            + G  G  G  G QG  G  G KG +G    G  G+ G  G  GP+G TGDAG           GP G+ G       + PG +G  G+ G  G  G  G PG  GF G++G+           +  +DG  G RGDKG+ G+ G  G+ GL
Sbjct:  924 GLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGE-SGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLD---------------------GRAGRPGHFGQKGAPGPPGENGPN--GAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYA---------IVGRQGDIGDIGFQGEPGWDGAKGEQGYP--GLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGL 1497          

HSP 6 Score: 106.301 bits (264), Expect = 2.489e-22
Identity = 175/500 (35.00%), Postives = 213/500 (42.60%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGP-----PGALGEKGNEGYKGDQGPKGM---------------IGDKG---------VQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSG-----LQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG 1668
            N  E   +G  GPKG  G  G +G  G RG  GDRGP     PG +G KG  G  GD G +G                IG KG         +QG  G  G+ G  G  G  G  G+ G  G+PG KG  G QG DG  G  G+ G KG++G      P     P   G +   G  G KGE+G  G  G+ G KG IG+ G +G +G  G +G  G P  +  L    GEIG++G+ GY+                                 G +G  G  G  G  G KG+ GD GP    G PG NG PG+                         G  GN G  G  G KG         +G++GD GE G  G  G  G PG +G RG  G     L G  G KG  G       PG  G KG++G RGL G+ G+ GE G KGL G  G  G++  G KG  G  G  GPKG  G++G  G  G  G IGD G
Sbjct:  720 NTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSP-GIPGLPGMIGEIGERGEIGYN---------------------------------GRQGDIGPRGPNGEFGPKGLSGDDGP---DGYPGANGLPGRK------------------------GETGNPGFPGRPGAKGVAA-----YSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGIN--GLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQG 1151          

HSP 7 Score: 105.145 bits (261), Expect = 5.928e-22
Identity = 247/771 (32.04%), Postives = 310/771 (40.21%), Query Frame = 1
Query: 2320 VNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKG---NMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGER-----GNPGIKGYKGNSGF----PDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG----DGIKGMKGLIGPQG------------------QKGESGYKGVQGLAGDKGPKGFPGKNIMGSKG---------------EKGNKGRIGEMG-----VKGFKGDIGPIGLPGSIGFQGQE------GQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKG---------EFGDAGKRGPQGPAGDQG------IGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFS--------ILYPGPQGETGVKGPKGEVGSVGPT------GIPGSKGEKGERGIEGDLGDKGVRG 4365
             N  L   KG  G  G  G  G  G  G  G  G  G +G  G+ G VG  G+ GEKG   ++G KGE G  G  G+ G  G  G +G++G  G  G  G  G  G  GV G PG         +  +G +   G KG++G+ G  G  G  G  G  G +G++G  G  G  GDPG+      GPKG  G + E      G PG KG  G+S      PD TLKGYKG        G QG  G +G  GE G  G +GL G +G+ G  G +G  G+ G  G  G+ G +G  G TG   + G+ G  GE+G  G  G+ G++G  GP G       K + G IG QG                  ++G  G  G  G  G  G +G PG++  G  G               E G  GR G  G     V G KG+ G  G PG  G++G        G +GL G+                                    VG  G       RG  G+ G  G  G  G+KG RG    V + GP+G +GQ G+ G  G+ G                                              RG  G +  G RG +G QGN G  G KG         E G  G  GP G A + G      IG  G  G RGD G DG +G+ G  G KG++G +          Y G  GE G  G  G  G    T      G PG  G KGERG +GD G KGV+G
Sbjct:   33 CNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGL-----PGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGY------VGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTG---ADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGE--------------------------------GYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGN---------------------------------------------RGAIGLT--GPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKG 710          

HSP 8 Score: 100.523 bits (249), Expect = 1.518e-20
Identity = 209/600 (34.83%), Postives = 267/600 (44.50%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKG---NEGYKGD-----------------QGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDG---MQGIPGMQGEKGRKGPKGFSLPQEGVLP----------------AERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDK--------GDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKG----------YKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGR--------SRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAG---------PIGEKGDI------GDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERG 1851
            G  G  G  G  G  G+PG +GVKG++GP GA+G+ G   N+G +GD                 Q P G  G KG  G+ G NG+ GA          G  G  G+ G  G AGLQG  G   + G+PGM GE G +G  G++  Q  + P                   G  GA G  G KGE G  G  G PG KG+  Y G KGD GE G  G  G P         RG +GD         G KG   +           +KGQ+G RG PG  G  G+ GAKG  G  G  G  GLKG  G  GP G  G  GE+G  G  G +G  G +GP G  G QG +G+ G  G  G+ G          Y+G  GD         G++G+RGE+G+ G  G  G PG +G RGD G  G +G  G +G          RG         KG++G+ GLDG+ G+ G  G KG  G  G  G +  IG +G + + G  GP+GD G  G  G         P GE GD+      G+ G +I G QG                      IG+ G  F    G  G +G++G+PG+PG+ G
Sbjct:  826 GFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGA---------KGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYP-GAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQ--------GLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQ-IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGD---------------------IGDIG--FQGEPGWDGAKGEQGYPGLPGKNG 1383          

HSP 9 Score: 93.2041 bits (230), Expect = 2.203e-18
Identity = 148/458 (32.31%), Postives = 200/458 (43.67%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGD----------------------------KGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEP------GNKGMIGY-----QGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGM 1548
            NG+ G KG  GF      PG +G KG +G  G +G  G  G  GDQGP+G+IG+                            +G  G+ G+ G++G  G  GP G+ G  G  G+ G  G AG  G+DG +G+ G QG++G +GP G +LP      AE+GD+G  G  G  G  G FG  G P      G  G IG+     QG  G  G++GF G  G   +   L   +GE+GD G +G        R  +   I G++G            D G  G++G  G  GA+G +G  G  G  G+ G PG  G  G  G                       G  G  GL G KG  G T   S    G RG+ G  G +G +GD G PG  G +G  G  G  G++G  G +                  G DG  G+RG++G+ GL G  G++G+
Sbjct: 1111 NGINGLKGATGF------PGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLP------AEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRH-GLIGPKGELGDMGRQG-------ERGESGYAIVGRQG------------DIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWG---------------------GIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYT------------------GADGPQGQRGDKGYMGLTGAPGLRGL 1497          

HSP 10 Score: 91.6633 bits (226), Expect = 6.809e-18
Identity = 104/310 (33.55%), Postives = 145/310 (46.77%), Query Frame = 1
Query: 2026 EGDKGPSGERGD--PGEVGEQGLRGLDGYSGK------KGESGIHGDKGEKGLAGFSGPK--GIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRG--------------RQGNMGIKGVKGLEGVKGD---RGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKG 2874
            +GD+GP G  G   P E G++G+ GLDG +G+      KG  G  G+ G  G  G  GP+  G  G +GD G PG       G  G+ G  GELGD G +GE+G++      +   +GD G+ G +G       PG  G+KGE G  G+PGK+G+VG  G  G  G+ G  G +G+DG  G              R G+ G  G+ G +G +GD    G IGF G++G +G  G  G                                   ++G  G  G +G+ GDKG+ GL G PG+  +   GP+G
Sbjct: 1241 QGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHN--GRHGLIGPKGELGDMGRQGERGES---GYAIVGRQGDIGDIGFQGE------PGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQG-----------------------------------EVGYTGADGPQGQRGDKGYMGLTGAPGLRGL--PGPQG 1502          

HSP 11 Score: 82.8037 bits (203), Expect = 3.317e-15
Identity = 199/571 (34.85%), Postives = 262/571 (45.88%), Query Frame = 1
Query: 2767 GDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGM-----IGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKG---ESGYKGVQGLAGDKGPKGFPGKNIMGS-KGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSN-GERGQRGPQGNTGEKGEKGEFG------------DAGKRGPQGPAGDQGIGLLGVKGE---RGDPGPDGYEGQRGPKGPKGDKGFS------ILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGE 4386
            G KG  G  G  G  G EG  GD  I   G  GP G +G++GE G  G KG++G     DI  KG  G PG +G  G  G PG +G  G  G  G  G  G  G  G +G  G  GQ+G  G      I   G++G++G+TG+ G +G  G+ G++G++G  G  GL G         KG  GL GP+G  G   E  Y     L G  G KG PG ++ G  K +   KG  G +G++G +G  GP G  G++G  G  G RG  G                                                ERG  G+ GE G  G+KG KG  G +G  G +G  G +G++G  GM G  G  G  G+      K L G  G  GD G  G +G  G+ G  G  G  G++G+S + G  G RGP G + E+GE G++G            +AG  G  G  G+ G  ++G KGE    G PG +GY G RG  G  GDKG        +  PG QG  G +G  G+ G  G  G+PG   EKG RG +  + + G RGP+G  G+
Sbjct:   42 GIKGRMGAPGPIGVPGLEGPAGD--IGPPGRAGPLGEKGDVGEYGEQGEKGHRG-----DIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGE--------KGDPGLPGPKGDTGAVSELPYS----LIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIG---------------------------------------------GPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRS-ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPG---EKGLRGDDCPVCNAGPRGPRGQEGD 544          

HSP 12 Score: 74.3294 bits (181), Expect = 1.307e-12
Identity = 78/209 (37.32%), Postives = 97/209 (46.41%), Query Frame = 1
Query: 2020 RTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLA-----------GFSGPKG---IKGERGDTGLPGKEAEK-IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRG 2601
            + +G  GP G+ G PG  G  G  GL G  G+ G+ G  G++GE G A           GF G  G    KGE+G  GLPGK      PG +G  GD G  G  G  G  G      V    Y       G +G  G  GF G +G  G  GL G  G+ G VG  G  GE   +G  G +G  G+RG +G MG+ G  GL G+ G +G
Sbjct: 1300 QIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVT---YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGE---VGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG 1502          

HSP 13 Score: 71.633 bits (174), Expect = 8.469e-12
Identity = 77/212 (36.32%), Postives = 107/212 (50.47%), Query Frame = 1
Query:  289 CNGLLGPKGEMGFGG---HEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTT 915
              G  GP+G++GF G   H G+ G  G KG+ G  G  GE+G  GY    G +G IGD G QG  G +G KG  G  G     G+ G  G PG +G  G  G+ G+ G+ G+ G KG+ G    +       P +RG+ G  GF G +G+ G  G +G  G +G +GY+GD+G++G  G  G +G+                +GDKGY   T
Sbjct: 1301 IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYA-IVGRQGDIGDIGFQGEPGWDGAKGEQGYPG---LPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPG---VTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQ----------------RGDKGYMGLT 1489          

HSP 14 Score: 65.0846 bits (157), Expect = 7.903e-10
Identity = 111/322 (34.47%), Postives = 140/322 (43.48%), Query Frame = 1
Query:  322 GFGGHEGKPGFRGVKGDRGP------PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGD------KGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQ--GDKGDIGELGF---------KGEKGEP--------------------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVM-----IKGQKGIRXXXXXXXXXXXXXAKGY---EGRAGSKGAEGLKGIRGDLGPIGKHGKPG------ENG 1116
            GF G +G  G RG +GD GP      PGA GE+G+ GY G  G  G  G KG QG+ G  G  G            E+G  G  G  G AG  G+ G +G PG  GE G  G  G   PQ    P  +GD       G  G  GL G  GE GD+G  G +G  GY   G +GDIG++GF         KGE+G P                         +D   G +G KG  G +++  + R  +         +G++G  G PG  G  G  GA GY   +G  G  GA+G +G RGD G +G  G PG        G
Sbjct: 1188 GFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGIT-------LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG 1502          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0079036)

HSP 1 Score: 388.267 bits (996), Expect = 4.873e-109
Identity = 434/1254 (34.61%), Postives = 558/1254 (44.50%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKI-------PGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTK-------YKGDNGEKGVKGSQGTAG-----------------------FPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKG---------DIGVTGVPG------DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKG------FTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQG------LPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIG--------IQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGP------------------IGLPGSIG-------FQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSN-GERGQRGPQGNTGEKGEKGEFGDAGKR--GPQGPAGDQGI-GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSIL-------YPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRG------NTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMR 5442
            GD G SG RGD G+ GE+G  G DG  G++GE+G  GD G+   AG+ G  G  G  G  G PG+ A          PG  GI+G+ G+ GD GFKG KG+     +           Y G  G KG KG QG  G                       +PG  G  G+ G  G+PG+ G+ G  G  G KG  G  G+  + G  G  G  GIKG  G  G  G  G  G PG KG          +G TG+PG      D + GP G KG  G  G     G KG  G  G  GQ G  G      F+G RG  G+ G +GL G PGI  +      G  G IGERG  G  G +G     DI   G +G  GE GPKG  G       PG  G  G  G TG  G  GR G +G   Y G++G  G  G+ G +G  G  G  G+RG +G        + G +GE G+ G  GL G  G +G  GD G+ G +G  G  G KG  GY G  G+ G KG  GFPG    G KG +G  G +G  G  G  GD GP                  +G+PG +        ++G  G +GL+G++                                              E+GD G IG  G  G KG++G+ G +GQ+G +G +G KG  G+ G +G                                       +   KGD G+ G+ GR+   G  GQ+G  G  GE G  G  G  G +  GP GP GD G  G  G  G  G  GP G  G  G +G +G+ G++I+         G QGE G  G KGE G  G  G  G  G  G RG  GD G  G+ G  GL G +G  G                                    PGD+G+ GL G +G++G+ G PG+ G QG +G VG RG+      +GE G+ G  G  G+ G KG  G  G PG+RG PG QGE         + G IFA HSQS  +P CP+ T +LW+GYS  G   + RA   DL   GSC+  F+ +P++ C+    C ++  ND + WLS+A  M M+M  I    +  Y+SRCVVCE  ++  A HSQS   P CP GW  +W+G S+ M+T     G GQ L SPGSCL  F+    +EC   G C YY+    FWL   +    F       +K   +   I++C VC R
Sbjct:  614 GDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGD---AGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGL-----PGMIGEIGERGEIGYNGRQG-----DI---GPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGP--QGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGER---------------------------------------------GEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRG----------------------------------PPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMAR---------------------------PGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGD------QGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRGFIFARHSQSVHVPQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDSLWLSTAEPMPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIECHGHGRCNYYDALASFWLTVIEEQDQFVQPRQQTLKADFTSK-ISRCTVCRR 1736          

HSP 2 Score: 243.047 bits (619), Expect = 5.195e-64
Identity = 442/1343 (32.91%), Postives = 560/1343 (41.70%), Query Frame = 1
Query:  169 RLMKLVLGLIVAVFWIIISLVQDSESAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPG---ALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGE---------FGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGE----PVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSG---------LQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTG--------------KRGEQG---------------HKGLKGDKGVK---GMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG----SCFNCSDGDAGNR---GDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGK------VGNSGKDGEKGNMGRKGENGLDGRR------------GRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLV---GDPGIL-AIGEKGPKG------FQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRG--------------RKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVK------GFKGDIGPIGLPGSIGF---QGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPK------GYKGQNGENGMKG 3828
            R ++ + GL+  V +++ SLV  + +   ICN    T C C G+   KG MG  G  G PG  G  GD GPPG    LGEKG+ G  G+QG KG  GD G +G  G              G  G+ G  G PG +G  G  G  GMQG  G  G+ G +GP G    Q     A  G   +KG  G +GE G+          GD G  G+ G  G  G+KGD G  G KG+ G     P  +I    ++GE GD      S +  L         KG  G++         GD G +G  G  G+ G  GL G RG++G  G+ GKPG++G PG+                            G+ G+KG  G            TG  G  G  GE+G DG  G+PG +G  G  G         L GPIG +G+ G       PG  G  G +G  GL G++G              +RGE G                 GL G  G+    G +++G KG  G+NG  G +G  GD GE G  G+KG  G+ G +I G  GS+G  G  G  G  G  G RG  GEKG     C  C+ G  G R   GD G+PG  G RG  GL G                                                     G +G  G  G  G  G  G  G+ G  GK G +G  G   E G          KGE GDT           GD G +GD G+ G+KG  G  G            KG+ GE G +G  G AG+ G  G  G  G  G PG++        +G  G DG KG  G  G+ G  G +            G  G  G  G KG++G KG++G IG    +G+IG  G  G+ I GP                              +G KG+ G  G+ G +G  GL    G+PG+   IG KG +G       QG IG  G  GIKG+ G+ G P     G  G+ G  GPKG +G  G  G  G+ G  G  G RG              R G Q P G KG +G+ G +G  G+ G++G  G +G RG +G  G QG  G+ G  GL G+ G  G  G+ G  G +G IGP+G  GE G K   GL+GD GP G+PG N + G KGE GN G  G  G K      G KGD G  GL G IG+    G +GQRG  GD                                        G + ++ E G  G  G  G  G KG +G+RGL GQ G  G        GY G+NG NG+KG
Sbjct:    4 RDLRHLSGLL-GVVYLLGSLVSVTLADGKICN---TTLCDCKGI---KGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGY------------PGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGD------SLSGVLKPDDTLKGYKGYVGLQ---------GDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGR---------------------------FGDKGMKGAPGW-----------TGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGE-GYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTG---------------------------------------------------PRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSL-------RKGEIGDT-----------GDSGHRGDTGDDGEKGRDGSDGS-----------KGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGL---RGEIGDRGPAGEVIPGP------------------------------VGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAP-----GQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPK---GLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDS----------------------------------QPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKG 1118          

HSP 3 Score: 190.274 bits (482), Expect = 6.726e-48
Identity = 210/546 (38.46%), Postives = 262/546 (47.99%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGE---KGLAGFSGPKGI---------KGERGDTGLPGKEAEK-------IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGF---PDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQ-----------GYKGVQGQKGIIGMIGEMGSQGDKGDTGERGS-----IGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            +G  G  G  G PG +GE G RG  GY+G++G+ G  G  GE   KGL+G  GP G          KGE G+ G PG+   K       I GD G  G  G +G  G  G KG+   V        G  G KG  GS G  G PG  G KG+ G  G+PG+ G+ G  G  G  G  GR G NGL      +G  G  G +G +G +G+ G +G  G  G IG  G P   I           +  V      +        +G  GD+G  G RGE GD G  G +G PG  A GE+G  G+ G +G  G  G+KG++G+ G    P ITL   KG  G  G  G  G PG  G KG  GP G +G  G  G +GPQ           G+ G  G  G  G+IG  G  GD G  GERG      +G QG  G+ G QG  G  G KG QG P   G  G  G  GP+G  G++G+ G+ G+ G  GPKG PG     S    G++   GE G+ GF+G+ G  G PG IGFQGQ G  G +GD+
Sbjct:  932 QGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGL------KGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQG-PRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPG--AKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDR---GEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQ 1465          

HSP 4 Score: 161.77 bits (408), Expect = 3.726e-39
Identity = 289/949 (30.45%), Postives = 382/949 (40.25%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIP---------------------------------------GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKG---------VKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG-------DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPK--------------------------------GFQGNIGERGNPGIKGYKGNSGFPDITLKG----------------------YKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQG--------------------------YQGEKGNQGSLGLKGLKGNQGPAG----DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIM----------GSKGEKGNKGRIGEMGVKGFKGDIGP------IGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGN-----KGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYP----------GPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRG 4365
            G++G  G RGD G  GE G  G+ G SG+ G  G  G  G  G  G  GP G  G+ G  G PGK  ++ P                                       GD G  G  GE GD G  G KG    V+ L     G  G KG         +K      G+ G  G +G+ G  G  G+ G VG +G  G +G +G  GE G  G+ G  G  G KG+KG  G  G  G  G PGE+G+ G TG+PG         I  P   K   G +G  G+ G  G+ G  G  G+ G +G  GL G+SGD G  G  G PG    GE G                                  G +G  G  G PG++GY+G+ G  ++ L G                      ++G+PG+ G  G +GLPGEKG +G+  P   +G RG +G +G  GY G  G +G IG+ G  G QG +G+ G  G  G+ G                           +GE G+ G  G +G  G+ G  G    DG KG +G  G +G  G++GY+G  G  G  G  G PG+N            G  G KG +G  G+ G KG KG+  P       G PG  G+ G +G +G KG+                                             +   G +GEIG++G  G       G KG  G +G  G +G  G  G++GE G+ G IG KG+                                          RG+ G+     +G+ GP G +G KG  G+ G  G+ G  G  G +     GVKGE+   GPDG  GQ G  G KG +G  ++ P          G Q   G KG KGEVGS+G  G  G+KG  G  G  G LG+ G++G
Sbjct:   84 GEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRG--EVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGE---------------------------------------------QGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQ------------------------------------------RGVPGQEV--IQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPK-----GVKGEQ---GPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQG 933          

HSP 5 Score: 110.153 bits (274), Expect = 1.597e-23
Identity = 215/609 (35.30%), Postives = 270/609 (44.33%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAA---GLQGYDGMQGI------PGMQGEKGRKGPKGFSLPQ-EGV--------------------LPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGY--------------------SFTTHLTRT-----TNEVMIKGQKGIRXXXXXXXXXXXXXAKG------YEGRAGSKGAEGLKGIRGDLGPIGKHG--KPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEK--GEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS--RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGE---------AGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSC----------FNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
            GLLG  G  G  G  G PG  G+ G+ G  G +G  G +G  G +GP G  G KG+ G+ G +G  GA GL G KG TG  G  G+PG KG A   G++G DG  G+      PG  G KG++GP G S P  +GV                    L  +RGD+G  G  G  GE G  G  G PG  G+ G +G  G  G  G KG +GE   ++ LD   G+IGD+G +G                            R+     T +  ++G++G +G  GP G +G  GAKG      Y G+ G  GAEGLKG +GD GP G  G   P E G  G  G+D                     G AG  G  G KG  G   +   N  G  G RG +  G  G  GD G PG  G  G  GL GP GE G+ GR   RG S            + G  G  G  G QG  G  G KG +G    G  G+ G  G  GP+G TGDAG           GP G+ G       + PG +G  G+ G  G  G  G PG  GF G++G+           +  +DG  G RGDKG+ G+ G  G+ GL
Sbjct:  924 GLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGE-SGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLD---------------------GRAGRPGHFGQKGAPGPPGENGPN--GAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYA---------IVGRQGDIGDIGFQGEPGWDGAKGEQGYP--GLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGL 1497          

HSP 6 Score: 106.301 bits (264), Expect = 2.489e-22
Identity = 175/500 (35.00%), Postives = 213/500 (42.60%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGP-----PGALGEKGNEGYKGDQGPKGM---------------IGDKG---------VQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSG-----LQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG 1668
            N  E   +G  GPKG  G  G +G  G RG  GDRGP     PG +G KG  G  GD G +G                IG KG         +QG  G  G+ G  G  G  G  G+ G  G+PG KG  G QG DG  G  G+ G KG++G      P     P   G +   G  G KGE+G  G  G+ G KG IG+ G +G +G  G +G  G P  +  L    GEIG++G+ GY+                                 G +G  G  G  G  G KG+ GD GP    G PG NG PG+                         G  GN G  G  G KG         +G++GD GE G  G  G  G PG +G RG  G     L G  G KG  G       PG  G KG++G RGL G+ G+ GE G KGL G  G  G++  G KG  G  G  GPKG  G++G  G  G  G IGD G
Sbjct:  720 NTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSP-GIPGLPGMIGEIGERGEIGYN---------------------------------GRQGDIGPRGPNGEFGPKGLSGDDGP---DGYPGANGLPGRK------------------------GETGNPGFPGRPGAKGVAA-----YSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGIN--GLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQG 1151          

HSP 7 Score: 105.145 bits (261), Expect = 5.928e-22
Identity = 247/771 (32.04%), Postives = 310/771 (40.21%), Query Frame = 1
Query: 2320 VNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKG---NMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGER-----GNPGIKGYKGNSGF----PDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG----DGIKGMKGLIGPQG------------------QKGESGYKGVQGLAGDKGPKGFPGKNIMGSKG---------------EKGNKGRIGEMG-----VKGFKGDIGPIGLPGSIGFQGQE------GQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKG---------EFGDAGKRGPQGPAGDQG------IGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFS--------ILYPGPQGETGVKGPKGEVGSVGPT------GIPGSKGEKGERGIEGDLGDKGVRG 4365
             N  L   KG  G  G  G  G  G  G  G  G  G +G  G+ G VG  G+ GEKG   ++G KGE G  G  G+ G  G  G +G++G  G  G  G  G  G  GV G PG         +  +G +   G KG++G+ G  G  G  G  G  G +G++G  G  G  GDPG+      GPKG  G + E      G PG KG  G+S      PD TLKGYKG        G QG  G +G  GE G  G +GL G +G+ G  G +G  G+ G  G  G+ G +G  G TG   + G+ G  GE+G  G  G+ G++G  GP G       K + G IG QG                  ++G  G  G  G  G  G +G PG++  G  G               E G  GR G  G     V G KG+ G  G PG  G++G        G +GL G+                                    VG  G       RG  G+ G  G  G  G+KG RG    V + GP+G +GQ G+ G  G+ G                                              RG  G +  G RG +G QGN G  G KG         E G  G  GP G A + G      IG  G  G RGD G DG +G+ G  G KG++G +          Y G  GE G  G  G  G    T      G PG  G KGERG +GD G KGV+G
Sbjct:   33 CNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGL-----PGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGY------VGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTG---ADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGE--------------------------------GYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGN---------------------------------------------RGAIGLT--GPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKG 710          

HSP 8 Score: 100.523 bits (249), Expect = 1.518e-20
Identity = 209/600 (34.83%), Postives = 267/600 (44.50%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKG---NEGYKGD-----------------QGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDG---MQGIPGMQGEKGRKGPKGFSLPQEGVLP----------------AERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDK--------GDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKG----------YKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGR--------SRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAG---------PIGEKGDI------GDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERG 1851
            G  G  G  G  G  G+PG +GVKG++GP GA+G+ G   N+G +GD                 Q P G  G KG  G+ G NG+ GA          G  G  G+ G  G AGLQG  G   + G+PGM GE G +G  G++  Q  + P                   G  GA G  G KGE G  G  G PG KG+  Y G KGD GE G  G  G P         RG +GD         G KG   +           +KGQ+G RG PG  G  G+ GAKG  G  G  G  GLKG  G  GP G  G  GE+G  G  G +G  G +GP G  G QG +G+ G  G  G+ G          Y+G  GD         G++G+RGE+G+ G  G  G PG +G RGD G  G +G  G +G          RG         KG++G+ GLDG+ G+ G  G KG  G  G  G +  IG +G + + G  GP+GD G  G  G         P GE GD+      G+ G +I G QG                      IG+ G  F    G  G +G++G+PG+PG+ G
Sbjct:  826 GFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGA---------KGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYP-GAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQ--------GLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQ-IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGD---------------------IGDIG--FQGEPGWDGAKGEQGYPGLPGKNG 1383          

HSP 9 Score: 93.2041 bits (230), Expect = 2.203e-18
Identity = 148/458 (32.31%), Postives = 200/458 (43.67%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGD----------------------------KGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEP------GNKGMIGY-----QGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGM 1548
            NG+ G KG  GF      PG +G KG +G  G +G  G  G  GDQGP+G+IG+                            +G  G+ G+ G++G  G  GP G+ G  G  G+ G  G AG  G+DG +G+ G QG++G +GP G +LP      AE+GD+G  G  G  G  G FG  G P      G  G IG+     QG  G  G++GF G  G   +   L   +GE+GD G +G        R  +   I G++G            D G  G++G  G  GA+G +G  G  G  G+ G PG  G  G  G                       G  G  GL G KG  G T   S    G RG+ G  G +G +GD G PG  G +G  G  G  G++G  G +                  G DG  G+RG++G+ GL G  G++G+
Sbjct: 1111 NGINGLKGATGF------PGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLP------AEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRH-GLIGPKGELGDMGRQG-------ERGESGYAIVGRQG------------DIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWG---------------------GIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYT------------------GADGPQGQRGDKGYMGLTGAPGLRGL 1497          

HSP 10 Score: 91.6633 bits (226), Expect = 6.809e-18
Identity = 104/310 (33.55%), Postives = 145/310 (46.77%), Query Frame = 1
Query: 2026 EGDKGPSGERGD--PGEVGEQGLRGLDGYSGK------KGESGIHGDKGEKGLAGFSGPK--GIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRG--------------RQGNMGIKGVKGLEGVKGD---RGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKG 2874
            +GD+GP G  G   P E G++G+ GLDG +G+      KG  G  G+ G  G  G  GP+  G  G +GD G PG       G  G+ G  GELGD G +GE+G++      +   +GD G+ G +G       PG  G+KGE G  G+PGK+G+VG  G  G  G+ G  G +G+DG  G              R G+ G  G+ G +G +GD    G IGF G++G +G  G  G                                   ++G  G  G +G+ GDKG+ GL G PG+  +   GP+G
Sbjct: 1241 QGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHN--GRHGLIGPKGELGDMGRQGERGES---GYAIVGRQGDIGDIGFQGE------PGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQG-----------------------------------EVGYTGADGPQGQRGDKGYMGLTGAPGLRGL--PGPQG 1502          

HSP 11 Score: 82.8037 bits (203), Expect = 3.317e-15
Identity = 199/571 (34.85%), Postives = 262/571 (45.88%), Query Frame = 1
Query: 2767 GDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGM-----IGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKG---ESGYKGVQGLAGDKGPKGFPGKNIMGS-KGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSN-GERGQRGPQGNTGEKGEKGEFG------------DAGKRGPQGPAGDQGIGLLGVKGE---RGDPGPDGYEGQRGPKGPKGDKGFS------ILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGE 4386
            G KG  G  G  G  G EG  GD  I   G  GP G +G++GE G  G KG++G     DI  KG  G PG +G  G  G PG +G  G  G  G  G  G  G  G +G  G  GQ+G  G      I   G++G++G+TG+ G +G  G+ G++G++G  G  GL G         KG  GL GP+G  G   E  Y     L G  G KG PG ++ G  K +   KG  G +G++G +G  GP G  G++G  G  G RG  G                                                ERG  G+ GE G  G+KG KG  G +G  G +G  G +G++G  GM G  G  G  G+      K L G  G  GD G  G +G  G+ G  G  G  G++G+S + G  G RGP G + E+GE G++G            +AG  G  G  G+ G  ++G KGE    G PG +GY G RG  G  GDKG        +  PG QG  G +G  G+ G  G  G+PG   EKG RG +  + + G RGP+G  G+
Sbjct:   42 GIKGRMGAPGPIGVPGLEGPAGD--IGPPGRAGPLGEKGDVGEYGEQGEKGHRG-----DIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGE--------KGDPGLPGPKGDTGAVSELPYS----LIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIG---------------------------------------------GPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRS-ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPG---EKGLRGDDCPVCNAGPRGPRGQEGD 544          

HSP 12 Score: 74.3294 bits (181), Expect = 1.307e-12
Identity = 78/209 (37.32%), Postives = 97/209 (46.41%), Query Frame = 1
Query: 2020 RTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLA-----------GFSGPKG---IKGERGDTGLPGKEAEK-IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRG 2601
            + +G  GP G+ G PG  G  G  GL G  G+ G+ G  G++GE G A           GF G  G    KGE+G  GLPGK      PG +G  GD G  G  G  G  G      V    Y       G +G  G  GF G +G  G  GL G  G+ G VG  G  GE   +G  G +G  G+RG +G MG+ G  GL G+ G +G
Sbjct: 1300 QIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVT---YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGE---VGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG 1502          

HSP 13 Score: 71.633 bits (174), Expect = 8.469e-12
Identity = 77/212 (36.32%), Postives = 107/212 (50.47%), Query Frame = 1
Query:  289 CNGLLGPKGEMGFGG---HEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTT 915
              G  GP+G++GF G   H G+ G  G KG+ G  G  GE+G  GY    G +G IGD G QG  G +G KG  G  G     G+ G  G PG +G  G  G+ G+ G+ G+ G KG+ G    +       P +RG+ G  GF G +G+ G  G +G  G +G +GY+GD+G++G  G  G +G+                +GDKGY   T
Sbjct: 1301 IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYA-IVGRQGDIGDIGFQGEPGWDGAKGEQGYPG---LPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPG---VTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQ----------------RGDKGYMGLT 1489          

HSP 14 Score: 65.0846 bits (157), Expect = 7.903e-10
Identity = 111/322 (34.47%), Postives = 140/322 (43.48%), Query Frame = 1
Query:  322 GFGGHEGKPGFRGVKGDRGP------PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGD------KGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQ--GDKGDIGELGF---------KGEKGEP--------------------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVM-----IKGQKGIRXXXXXXXXXXXXXAKGY---EGRAGSKGAEGLKGIRGDLGPIGKHGKPG------ENG 1116
            GF G +G  G RG +GD GP      PGA GE+G+ GY G  G  G  G KG QG+ G  G  G            E+G  G  G  G AG  G+ G +G PG  GE G  G  G   PQ    P  +GD       G  G  GL G  GE GD+G  G +G  GY   G +GDIG++GF         KGE+G P                         +D   G +G KG  G +++  + R  +         +G++G  G PG  G  G  GA GY   +G  G  GA+G +G RGD G +G  G PG        G
Sbjct: 1188 GFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGIT-------LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG 1502          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col4a1 (collagen, type IV, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081105-114])

HSP 1 Score: 410.223 bits (1053), Expect = 1.258e-118
Identity = 420/1218 (34.48%), Postives = 536/1218 (44.01%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGK----KGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK------------------IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENG--------------------------------LDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG-DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIG------ERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDG------------IKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGD-----KGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMR 5442
            G  G  G  G PG  G  GL+G  G +GK     G  G  G +GE G  G  G +G  GERG  G PG + +                   IPG  GI G+ GE G  G  G  G          K +   G  G KG+ G  G PG  G KG TG+ G+PG  G+ G  G  G KGN G  G +G                                + G +G QG  G+  + G  G +G  G  G PG KG  G  GVPG D   G                              + G KG  G+ G +G  GF+GLVG+PG     G+ G  G +G+ G      ERG PG++G  GN    D+ ++  KG  G+IG +G  G  GEKGF G  G  G  G  G  G  G  G KG  G  G  G IGE G  G +GD G  GS+G +G +G  G+ G  G KG  G++G  GD              KG  G  G  G+ GE G KG  G+ G  G +G   K   GS G  G+ G+ GE GV G  G  G  G PG  G  G +G  G  G+KG +G+ G PG                                    ERG+     +G  G +GE G KGDKGN GL G  G  G  G KG  G +G+ G+                                          +G  G RG+ G++  G +G RG QG  GE+G  GE         QGP G  G    G KGE+GD    G++G  G +G KGDKGF     G  GE G+ G  G  G +GP G+PG  G KGE+G+ G  G+ G RG  GL G  G  G  G   +              G              PG KG +G++G +G KG  G PG  G                   KGE G  GP G  G PGP G  G  G      H G  G +  + G +   HSQ+  +P CP  T  ++ GYS L + G+ER+H  DL + GSCL+ FSP+PF+FC     C ++ RND +YWL++   M MSM  +    ++ ++SRC VCEAP+   A HSQ+   P CP+GW +LW G SF+M+T  GA G GQ L+SPGSCL  F+   F+EC  +G C YY     FWL   +    F   +   +K       I++C VCM+
Sbjct:  260 GQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQ------KGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLD-MPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPG------------------------------ERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGN--MSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGH--KGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGF---------------------------------TGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGD------------------------------------------QGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGE---------QGPPGIPGS--AGSKGEKGD---VGFQGAPGSRGYKGDKGFI----GVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQG-------FPGAKGQQGVMGLQGLKGSDGTPGYNG---------------HPGAKGEPGQTGPPGPRGYPGPPGPDGIPG------HIGPPGPSSMDHGFLVTRHSQTIDVPHCPQGTTPIYDGYSLLYVQGNERSHGQDLGTAGSCLRKFSPMPFLFCNINNVCNFASRNDYSYWLTTPEPMPMSMAPVTGESIKPFISRCAVCEAPAMVIAVHSQTIQIPNCPDGWASLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATIEDTDMFTKPVPATLKAGSLRTHISRCQVCMK 1315          

HSP 2 Score: 177.948 bits (450), Expect = 3.500e-44
Identity = 347/1168 (29.71%), Postives = 450/1168 (38.53%), Query Frame = 1
Query:  394 GEKGNEGYKGDQGPKGM-----------------------------------IGDKGVQGNSGINXXX-------XXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGV-----LPAERGDKGAKGFSGL------------KGEIGEFG--------------------------DVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIR--XXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIP--------------------------------------GDEGSRGDSGLQ--GPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKG-MDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS----IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDP---------GEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGD--------------------TGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGR-----------RGRQGNMGIKGV---KGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIG-EMGSQGDKGDTGERGS------------IGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGES 3333
            GEKG +G +   GPKG                                    +G KG QG +             G  G KG +G+ G  G  G+ G  G +G  G  G  G PG+ G+ G +G  G      G+     LP   GD+G  G  GL            KGE  +FG                           +G PG  G  G  G  G  G  G +G KGE  K+ISL   +G  G +G+ G            E  + G  G +        G  G  G KGY G  G  G  G  G  G  G  G+ G PG+ G PG+                         G  G  G+ G+ G KG+T  + G V G  G  G  G +G+ G+ G P                                      GD+G +G  GL   GP G++G+ G                 GL G  G  G+ G  G  G  G++G KG + ++G  G  G  GL G  GD G  G+ G  G +GD GD+GT      PG Q         G  G           G+KG   +   GD G  G+KGFPG  G+ G+ G +G                                                     G  G  G++GDP         GE G+ G RG  GY G  G  G  G  G  G  GF G  G KG++GD                     G PG+  EK  G KG  G  G  G +G KG++G     ++      G  GEKGV G  G+ G PG  G  GE GL G PG HG+ G SG+DG  G  G +GE G+ GR           +G +GN G+ G+    G+ G KGD+G  G PG++G  G  G+PG ++ GP                                 KG  G +G+ G++G  G  G PGI   G  G KG +G++G +G PG +GYKG+ GF              IG  G  GLPG  G KGE+GP G  G  G KG+QG  G KG  G +G  G+ G E         T  +G             +GIQG+ G KG QG +GL+GLKG+     DG  G  G  G +G+ G++
Sbjct:   54 GEKGADG-RSFPGPKGTDGQPGPPGPPGPINEECDVTKGAPGPPGPPGLQGEVGQKGDQGETCTECNAFGPPGLPGPQGPKGLQGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPK-------------------GTTGLPGVPGFPGEKGNT-GMPG-VPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVP---------------GLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQ---------GPPGNMSDVDMEHMKGDKGDIGD--RGDPGPTGEKGFPGTSGDPGMPGKDG---------------------------------------------------MPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEK--GQKGTMGMTGTPGTQGHKGDQG-----SIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGP---------------------------------KGDRGDQGQPGERGATGEQGPPGI--PGSAGSKGEKGDVGFQGAPGSRGYKGDKGF--------------IGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGS-----DGTPGYNGHPGAKGEPGQT 1061          

HSP 3 Score: 171.014 bits (432), Expect = 4.000e-42
Identity = 307/967 (31.75%), Postives = 387/967 (40.02%), Query Frame = 1
Query: 2086 LRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGK--EAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGT-----------------------AGFPGNKGSKGETGLSGIPGKHGKVGNSGK----DGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGD--------------------RGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPG-----------------------------------IKGYKGNSGFPDITL------KGYKGIPGEIGPKGF---QGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD----GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGL------PGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGE------RGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETG--------VKGPKGE------------VGSVGPTGIP---GSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITG 4587
            L+G  G +G KGE G+ G  G  G AGF+G  G+ G+ G  G PG    A  + GDKG+ G  G+ G  G  G  GK+       T  KG+  + G+KG +G                         G PG+KGS G  G  G PG  G  G +GK     G +G  G +GE+G  G +G +G  G +GV G  G KGD                     G  G PGE G+ G  G+PG + T                          +  +G  G KG TGL G  G  G +G  G PG+    G  GP G QG  G  G PG                                   IKG KG  G P + +      +G  G+PG  G KG     G+PG+ GF GE GP G  G+ G  G  G QG  G  G  G  G  G  G +GD GD G +G  G  G QG  GN   + ++ +KG++G  GD    G  G KG  G  G  G  G  G+ G  G  G KG PG  I+G  G  G  G  G  G  G+ G +GP G       PG  GF+G +G +G KGD G  G                                            G  GE GEKG+ G  G  G  G  G  GD+G  GY G  G+ G KG                                       + G+ G  G  G  GR   GE G +GP G  GEKG+ G+ G  G  G +G  G  G GL G +GE      +G+PG  G  G  G  G KGDKG S L PG QG  G        ++GPKG+             G  GP GIP   GSKGEKG+ G +G  G +G +G +G  G                               G          PG KG++G++GS+G+ G++G PG+ G
Sbjct:  135 LQGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGT--KGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGT---------------------PGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPG--IIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNI----------------------------GSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKG---------------------------------------VGGLPGSPGEPGTPGRP--GEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGL-PGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIG-----------------VSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKG 989          

HSP 4 Score: 161.77 bits (408), Expect = 3.437e-39
Identity = 187/511 (36.59%), Postives = 232/511 (45.40%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGL---------DGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTG---TSGLRGRKGD---QGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKG----------------------------LIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGN 3426
             GD GP+GE+G PG  G+ G+ G DG  G  G+ G  GD G  G  G  G  G  G RGD G PG    K  G KG+ G  G  G KG  G KG   +         G  G KG  GS G  G PG KG KG  G++G PG  G  G+ G  G  G+ G+ GE G+          G  GR G  G++G  G  G KG  G  G PG  G+ G  GVPG  +                                  G +G  G +G+ G+ G  G+ G PGI   G KG KG  G  G++G PG +G  G +      ++G KG       +G QG PGE+G  GE GP G   ++G +G KGD   QG  G +G +G KG IG+ GE G  G  G  GE G  G+ G+ G KG QG +G KG  G++     G  G+KG                            L+G QG  G  G +GV GL G KG  G PG N   G+KGE G 
Sbjct:  604 RGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPK--GAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLP---------------------------------GSRGEPGGKGDKGNPGLPGIPGSPGI--PGTKGDKGLSGLPGDQGRPGERGLPGQA------MEGPKGD------RGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDR-----GFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQ 1060          

HSP 5 Score: 160.999 bits (406), Expect = 5.300e-39
Identity = 288/800 (36.00%), Postives = 365/800 (45.62%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRG-------PPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG-TSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDA------GNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK-IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDN---GEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGV 2649
            KG  GF G  G+PG +G KG+ G       P GA G +G  G  G QG +G  G++GV G  G +         G  G  G +G  G PG  G  G  G  G  G+PG  G  G+KG  G  LP         G KG  G  G+ G  GE G+ G P   G+ G +G  G  G  G KG  G P V           +G+ G  G            +  IKG KG +G PG D            G  G +G+ G+ G+ G  G  G+ G PG++G PG+                  +GP+G+IG  G +G  G++GL G+  D         G +G+ G  GI GD G  G +G RG+ GLQGP G   +                    ++G  G  G RG+ G  G KG  G  G   M G  G  G  G  G KGD G  G+ G IGE GD G  G    PG+ G KG KG  G  G  G  G  G  G+KG       G        GN G  GFPG PGE+G  G  G  G  G +G +G  G  G+ G  GK G+ G  G  G  G  G          +G  GP GE+      G+ G  G+ G++G++GE G+ G    +GL G  G  G KG++G+ GLPG      IPG KG +G  G  GD+G  GE+G            +GD    GE+G  G QG  G PG+ GSKGE G  G     G  G+ G  G+KG +G  GE GL G  G +G MG +GV G  G KG++G IG  GE GD G  G+
Sbjct:  265 KGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPG-DKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLP---------GPKGTTGLPGVPGFPGEKGNTGMP---GVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLD----------MPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGE------------------RGPKGEIGIMGMAGPPGFQGLVGNPGD--------PGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEH---------------MKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEK------GQSGQDGIPGFTGERGEPGVPG----RGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGF---QGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGL 987          

HSP 6 Score: 131.339 bits (329), Expect = 6.615e-30
Identity = 302/918 (32.90%), Postives = 377/918 (41.07%), Query Frame = 1
Query: 2143 KGEKGLAG--FSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGEN----------GLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKG-----------------FQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG---------------------------------DGIKGMKG--------LIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI-GLLGVKGERGD-----------------------PGPDGYEGQR---------GPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITG 4587
            KGEKG  G  F GPKG  G+ G  G PG   E+    KG  G  G  G +G  G+KG           +    G  G +G +G  GFPG  G KGE GL   PG  G  GN+G +G  G MG+ G            GL G +G  G  G +G  G++G+ G  G  G+PG KG+    G+ GD   GP         V     +         G  GQ GDKG  G  G  G  G +G  G+ G + I   GP+G  G  GE G PG+   +G+ GFP     G +G+PG  G KG                 + G+PG  G  GE G  G  GL GR G  G +G  G    +G+ G  G  G  G  G  GE+G+ G+ G  G +G  G  G +GLKGN GP G                                  GIKG KG        + GP G +G  G  G+ G  G  G  G PGK+  G  GE+G KG IG MG+ G  G  G +G PG  G +G  G  G++GD                   G  G  G  G PG +G  G+  D   E  +GDKG+IG++G+ G  G+KG  G SG  G  G  G  G  G+ G KG+                                                 GI G+   G  G+ G  G  G+ G  G  G  G +G  G  G  G  G  G KG++GD                       PG  G +GQ+         G +G KGD+G SI YPG  G+ G KG  G  GS G  G PG  GE G +G  G  G+KG  G  G+ G  G +G  G  G           G       G         IPG KGDKGL G  GD+G  G  G+ G
Sbjct:   53 KGEKGADGRSFPGPKGTDGQPGPPGPPGPINEECDVTKGAPGPPGPPGLQGEVGQKGDQGETCTECNAFG-PPGLPGPQGPKGLQGFPGPAGIKGEKGL---PGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDR--GP----DGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKV-ISLPGPQGAPGPRGESGRPGL---QGDRGFP-----GERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPG----RGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKD--GFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGD------------------FGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGD------------------------------------------------PGIIGKP--GSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQG-SIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPG 876          

HSP 7 Score: 124.405 bits (311), Expect = 7.450e-28
Identity = 216/606 (35.64%), Postives = 270/606 (44.55%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXX--------------------YTGEEGC--CGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIG---EFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-----------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXX--------XXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGN--VTGVRGDRG------------EKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS--RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----MIGTKGRKGVNGLTG-----------------PKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSC-FNCSDGDAGNRGDKGFPGIPGERGIDGLN 1866
            GL GPKG  G     G PGF G KG+ G PG  G +G  G  G QG KG  G  GV G  G  G  G      P                      Y G  G    G PG +G+ G+ G  G +G+PG  G  G+ G            P ERG KG  G  G+ G  G     G+ G+PG KG  G  G +GD G+LG KGE+GEP           V M  +   +G+IGD+GD G +       T+ +  + G+ G+ G PG  GD GD G  G  G  G  G  G +G  G  G +G  G  G  GSPG PG  G  G +           G  G  G +G+IG+ G  G  G KG KG T+ ++G     G +GD+G            EKG  G+ G  G PG  G  G+ GLQGP G  G KG+S   G+     +  +     RGL    G RGE G KG KG+ G+ G+     + GTKG KG++GL G                 PKGD GD G+ G  G  G+ G  G  IPG+ GSK                     GEKG   F  + G  G +GDKGF G+ GE G+ G N
Sbjct:  385 GLPGPKGTTGL---PGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDG-----------FPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKG-TMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGL---PGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPG--IPGSAGSK---------------------GEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYN 949          

HSP 8 Score: 112.079 bits (279), Expect = 5.149e-24
Identity = 176/481 (36.59%), Postives = 229/481 (47.61%), Query Frame = 1
Query:  304 GPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGS---PGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGD---EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------------------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGT 1671
            GPKGE+G  G  G PGF+G+ G+ G PG  G+ G  G +GD    G +G KG +G  G+ G  G       +   G++G  G  G  G  G +G+ G  G PGM G+ G  G            P + GDKG  G  G  G IGE GD G    +G +GY G  G  G  G  G  G P        + G  GDKGD G            +  I G  G        G+ G+ G KG  G  G+ G +G KG +G +G  G  GKPGE G    PG PG  G PG+ G PG +G  GP G+ G +G  G+ G+ G +G+       + G RG+ G KG+KG  G  GIPG     G++GD GL G  G++G  G  RG+     +GPKG++G +G  G+ G  GEQG  G+ G  G KG                      IG  G  G+ G  GPKG+ G  G  G  G KG+ G +G+
Sbjct:  524 GPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGD---FGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPG-----------SPGQPGDKGDPGIIGKPGSIGEPGDTGA---RGDMGYPGSMGPKGAKGVGGSPGHP----GFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNI-GSPGF------PGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGE-RGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGS 975          

HSP 9 Score: 103.605 bits (257), Expect = 1.979e-21
Identity = 171/453 (37.75%), Postives = 220/453 (48.57%), Query Frame = 1
Query:  313 GEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGE---LGFKGEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKG-----AEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKG----------------RSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLT 1593
            G +G  G  G+PG  G +GD G PG++G KG +G  G  G  G  G  G +G+ G +  +   G+ GP G  G  G  G PG+ G  G +G  GM G PG QG KG +G  G+        P + G+KG  G  G  GE G  G  GEPG +G  G  G+KG  G+    GF GE+GEP V    L  SRGE G KGDKG      +  +      KG KG+ G              G +GR G +G      EG KG RGD G  G+ G  GE G PG             PG  G +G +GD+G  G  G +GYKG KG  I +SG   G+ G  G KGE G    +G+PG  G++G+ G+ G  GE G++G                 +    +PG  GP+G +GL G+ G  G +G+QG  GL+G KG  G     G  G KG  G T
Sbjct:  644 GIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKG-DPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYP-----GSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSG------------LPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPG------------IPGSAGSKGEKGDVGFQGAPGSRGYKGDKG-FIGVSGE-PGLPGYNGPKGEMG---PQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQT 1061          

HSP 10 Score: 90.8929 bits (224), Expect = 1.329e-17
Identity = 216/603 (35.82%), Postives = 264/603 (43.78%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSG-INXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKG-FSLPQEGVL-----------PAERGDKGAKGFSGLKGEIGEFGDVGE-------PGNKGMIGYQGDKGDI---GELGFKGEKGEPVKMISLDKSRGEIGDKGD--------------KGYSFTTHLTRTTNEVMIKGQKGI--------------RXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNS-----GLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGP---------------KGDTGDAGEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
             CTEC+  G  G  G  G  G +G PG  G+KG++G PG  G  GN G+ G     G++G  G QG  G I    G  G KG  G TG+ G  G  G  G  G  GY G +G P   G KG +GP G F +P                P + GDKG+ GF G  G  G  G  GE       PG +G  G +G+ G     G+ GF GE+G P          G  GDKGD              KGYS     +    E    GQ G+              RG PGP G  G  G  G+ G  G+ G  G+ G  G  GP G  G  G  G PG  G  G PG  G   P          G          G KGY+GL G  +D+ G      GDRG  G  G+ G +G+PG  G  G  G     GE+G KG    +   G  GP G +GL G  G  G++G+ G  G++GD G      +GTKG +G  GL GP               KGD GD G+ GP GEKG  G  G   +PG  G  G  G+PG  G  G+ G+ G IGE         GD G RGD G+PG  G +G  G+
Sbjct:  114 TCTECNAFGPPGLPGPQGPKGLQGFPGPAGIKGEKGLPGPSGPAGNAGFNGA---PGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVP----------GFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPG--LDMPGPP----GDRGSPGVPGLPGSKGLPGQPGVPGKDGFP---GERGPKGE---IGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGD-----LGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEP--------GDTGARGDMGYPGSMGPKGAKGV 678          

HSP 11 Score: 74.3294 bits (181), Expect = 1.605e-12
Identity = 110/309 (35.60%), Postives = 143/309 (46.28%), Query Frame = 1
Query:  280 ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGD-----------RGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYT-----GEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGE---IGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDK-------GYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGK 1128
            E    G  GP GE G  G +G PGF G +G+           RG PG  G+KGN G  G  G  G+ G KG +G SG+ G +G PG +G  G       G+ G  G+PG++GA G Q   G  GIPG  G KG KG  GF        P  RG KG KGF G+ GE    G  G  GE G +G+ G+ G KG+ G +G KGE G+          RG  G KG +        +++             +G  GI+               G+ G  G +G  GL+G++G  G  G +G PG  G PG+
Sbjct:  785 EPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQ---GPPGIPGSAGSKGEKGDVGFQ-----GAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGD----------RGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQ---------------GFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQ 1060          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col4a1 (collagen, type IV, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081105-114])

HSP 1 Score: 408.683 bits (1049), Expect = 1.319e-116
Identity = 419/1228 (34.12%), Postives = 532/1228 (43.32%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGK----KGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK------------------IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENG--------------------------------LDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG-DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIG------ERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD------------------GIKGMKGLIGPQGQKGE---SGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGD-----KGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRN 5445
            G  G  G  G PG  G  GL+G  G +GK     G  G  G +GE G  G  G +G  GERG  G PG + +                   IPG  GI G+ GE G  G  G  G          K +   G  G KG+ G  G PG  G KG TG+ G+PG  G+ G  G  G KGN G  G +G                                + G +G QG  G+  + G  G +G  G  G PG KG  G  GVPG D   G                              + G KG  G+ G +G  GF+GLVG+PG     G+ G  G +G+ G      ERG PG++G  GN    D+ ++  KG  G+IG +G  G  GEKGF G  G  G  G  G  G  G  G KG  G  G  G IGE G  G +GD G  GS+G +G +G  G+ G  G KG  G++G  GD                  G  G  G  G +GQKG    +G  G QG  GD+G  G PGK   G KG  G  G  GE G  G  G+ G  G PG  G +GQ GQ G+ G                                                ERG+     +G  G +GE G KGDKGN GL G  G  G  G KG  G +G+ G+                                          +G  G RG+ G++  G +G RG QG  GE+G  GE         QGP G  G    G KGE+GD    G++G  G +G KGDKGF     G  GE G+ G  G  G +GP G+PG  G KGE+G+ G  G+ G RG  GL G  G  G  G   +              G              PG KG +G++G +G KG  G PG  G                   KGE G  GP G  G PGP G  G  G      H G  G +  + G +   HSQ+  +P CP  T  ++ GYS L + G+ER+H  DL + GSCL+ FSP+PF+FC     C ++ RND +YWL++   M MSM  +    ++ ++SRC VCEAP+   A HSQ+   P CP+GW +LW G SF+M+T  GA G GQ L+SPGSCL  F+   F+EC  +G C YY     FWL   +    F   +   +K       I++C VCM+ 
Sbjct:  529 GQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQ------KGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLD-MPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPG------------------------------ERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGN--MSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKP--GEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPG---------------------------------------------FTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGD------------------------------------------QGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGE---------QGPPGIPGS--AGSKGEKGD---VGFQGAPGSRGYKGDKGFI----GVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQG-------FPGAKGQQGVMGLQGLKGSDGTPGYNG---------------HPGAKGEPGQTGPPGPRGYPGPPGPDGIPG------HIGPPGPSSMDHGFLVTRHSQTIDVPHCPQGTTPIYDGYSLLYVQGNERSHGQDLGTAGSCLRKFSPMPFLFCNINNVCNFASRNDYSYWLTTPEPMPMSMAPVTGESIKPFISRCAVCEAPAMVIAVHSQTIQIPNCPDGWASLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATIEDTDMFTKPVPATLKAGSLRTHISRCQVCMKR 1582          

HSP 2 Score: 176.407 bits (446), Expect = 1.418e-43
Identity = 204/540 (37.78%), Postives = 265/540 (49.07%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGI---QGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGN--IGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTS--GLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGP---KGFPG-----------------------------KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQ 3525
            T+G++G  G +G PG + +  +  + G  G  G+ G  G  GEKG  G SG  G+ G+ G  G PG+  +K  GD GI    G +GE GD G +G+ G           Y G  G KG KG  G+ G PG KG+ G  G  G       +G  G  G KGN+G  G  G  G +G++G MG+ G  G +G KGD+G IG PG+ G+ GV G+PG                            G  G  G+ G+ G  G  G  G+KG  G  G PG    GE+G  G  G    G RG PG KG KGN G P I   G  GIPG  G KG  GLPG++G  GE G  G +  G +G +GDQG  G +G  G++G  G+ G  GS+G+KGD G +G+ G +GY+G+KG  G  G  GL G  GP        KG +GPQG  G  G KG QG+ G KG    +GFPG                             + ++G +G  G KG+ G MG++G KG  G  G  G  G +G+ GQ
Sbjct:  839 TKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDK--GDPGIIGKPGSIGEPGDTGARGDMG-----------YPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGD-PGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSP--------------------------GEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGF--TGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIP--GSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGP--------KGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQ 1326          

HSP 3 Score: 169.088 bits (427), Expect = 2.028e-41
Identity = 314/946 (33.19%), Postives = 393/946 (41.54%), Query Frame = 1
Query: 2086 LRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGK--EAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGT--------------------AGFPGNKGSKGETGLSGIPGKHGKVGNSGK----DGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDR--------------------GFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPG-----------------------------------IKGYKGNSGFPDITL------KGYKGIPGEIGPKGF---QGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD----GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGL------PGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQ--RGPKGPKGDKGFSILYPGPQGETGVKGP---------KGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITG 4587
            L+G  G +G KGE G+ G  G  G AGF+G  G+ G+ G  G PG    A  + GDKG+ G  G+ G  G  G  GK+         Y G  GE G +G  G                      G PG+KGS G  G  G PG  G  G +GK     G +G  G +GE+G  G +G +G  G +GV G  G KGD                     G  G PGE G+ G  G+PG + T                          +  +G  G KG TGL G  G  G +G  G PG+    G  GP G QG  G  G PG                                   IKG KG  G P + +      +G  G+PG  G KG     G+PG+ GF GE GP G  G+ G  G  G QG  G  G  G  G  G  G +GD GD G +G  G  G QG  GN   + ++ +KG++G  GD    G  G KG  G  G  G  G  G+ G  G  G KG PG  I+G  G  G  G  G  G  G+ G +GP G       PG  GF+G +G +G KGD                                        G       +G+ G  G  GE G KG KG  G++G  G +G KG +G  G  G  G  G  G  G  G  G  G  GE G+ G  G  G KG  G +GI G  G RG  G    G  G RG  G  G+KG  G  G  G  G  G  GD+  GL G+ G++G PG  G  GQ   GPKG +GD+G     PG +G TG +GP         KGE G VG  G PGS+G KG++G  G  G+ G+ G  G  GE                                         PG KG++G++GS+G+ G++G PG+ G
Sbjct:  410 LQGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPG-----YPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGT---------------------PGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPG--IIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDP----------------------------------GEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDK--GLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQG----QPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEM--------------------------------GPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKG 1255          

HSP 4 Score: 151.369 bits (381), Expect = 5.118e-36
Identity = 288/801 (35.96%), Postives = 359/801 (44.82%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRG-------PPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG-TSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDA------GNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGK-----KGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGV 2649
            KG  GF G  G+PG +G KG+ G       P GA G +G  G  G QG +G  G++GV G  G +         G  G  G +G  G PG  G  G  G  G  G+PG  G  G+KG  G  LP         G KG  G  G+ G  GE G+ G P   G+ G +G  G  G  G KG  G P V           +G+ G  G            +  IKG KG +G PG D            G  G +G+ G+ G+ G  G  G+ G PG++G PG+                  +GP+G+IG  G +G  G++GL G+  D         G +G+ G  GI GD G  G +G RG+ GLQGP G   +                    ++G  G  G RG+ G  G KG  G  G   M G  G  G  G  G KGD G  G+ G IGE GD G  G    PG+ G KG KG  G  G  G  G  G  G+KG       G        GN G  GFPG PGE+G  G  G  G  G +G +G  G  G  G+ G+KG  G  G  G  G  G           G  G  G+ G  G  G  G RG  G  G+     +GE G  GDKG  GL G  G  GI G +GD GL G     +PGD+G  G+ G L  +  +G KG   +        +G  GE+G  G QG  G PG+ GSKGE G  G     G  G+ G  G+KG +G  GE GL G  G +G MG +GV G  G KG++G IG  GE GD G  G+
Sbjct:  534 KGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPG-DKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLP---------GPKGTTGLPGVPGFPGEKGNTGMP---GVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLD----------MPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGE------------------RGPKGEIGIMGMAGPPGFQGLVGNPGD--------PGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEH---------------MKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSG-----LPGDQGRPGERG-LPGQAMEGPKGDRGD--------QGQPGERGATGEQGPPGIPGSAGSKGEKGDVGF---QGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGL 1253          

HSP 5 Score: 125.176 bits (313), Expect = 5.256e-28
Identity = 216/604 (35.76%), Postives = 270/604 (44.70%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXX--------------------YTGEEGC--CGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIG---EFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-----------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXX--------XXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGN--VTGVRGDRG---------EKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS--RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----MIGTKGRKGVNGLTG-----------------PKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSC-FNCSDGDAGNRGDKGFPGIPGERGIDGLN 1866
             GL GPKG  G     G PGF G KG+ G PG  G +G  G  G QG KG  G  GV G  G  G  G      P                      Y G  G    G PG +G+ G+ G  G +G+PG  G  G+ G            P ERG KG  G  G+ G  G     G+ G+PG KG  G  G +GD G+LG KGE+GEP           V M  +   +G+IGD+GD G +       T+ +  + G+ G+ G PG  GD GD G  G  G  G  G  G +G  G  G +G  G  G  GSPG PG  G  G +           G  G  G +G+IG+ G  G  G KG KG T+ ++G     G +GD+G         EKG  G+ G  G PG  G  G+ GLQGP G  G KG+S   G+     +  +     RGL    G RGE G KG KG+ G+ G+     + GTKG KG++GL G                 PKGD GD G+ G  G  G+ G  G  IPG+ GSK                     GEKG   F  + G  G +GDKGF G+ GE G+ G N
Sbjct:  653 RGLPGPKGTTGL---PGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDG-----------FPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKG-TMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGL---PGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPG--IPGSAGSK---------------------GEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYN 1215          

HSP 6 Score: 120.168 bits (300), Expect = 1.606e-26
Identity = 257/820 (31.34%), Postives = 326/820 (39.76%), Query Frame = 1
Query: 2272 ELGDKG-----FKGEKGKN----------QNVNVLLTKYKGDNGEKGVKGSQGT-------------------AGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGEN----------GLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKG-----------------FQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG---------------------------------DGIKGMKG--------LIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGF-------------SILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGE 4386
            + G+KG     F G KG +                    +G+ G+KG +G   T                    GFPG  G KGE GL   PG  G  GN+G +G  G MG+ G            GL G +G  G  G +G  G++G+ G  G  G+PG KG+ G  G  GD                    +         G  GQ GDKG  G  G  G  G +G  G+ G + I   GP+G  G  GE G PG+   +G+ GFP     G +G+PG  G KG                 + G+PG  G  GE G  G  GL GR G  G +G  G    +G+ G  G  G  G  G  GE+G+ G+ G  G +G  G  G +GLKGN GP G                                  GIKG KG        + GP G +G  G  G+ G  G  G  G PGK+  G  GE+G KG IG MG+ G  G  G +G PG  G +G  G  G++GD                   G  G  G  G PG +G  G+  D   E  +GDKG+IG++G+ G  G+KG  G SG  G  G  G  G  G+ G KG+                                                 GI G+      G  G  G+TG +G      D G  G  GP G +G+G        G PG  G++G  G KG KGD G              +I  PG  GE G KG KG +G  G  G  G KG++G  G  G  G+KGV G  G  GE
Sbjct:  338 KKGEKGADGRSFPGPKGTDGQPGPPGPPGPISPPGPPGLQGEVGQKGDQGETCTECNAFGPPGLPGPQGPKGLQGFPGPAGIKGEKGL---PGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPGDRGPDGDFGV------------PGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKV-ISLPGPQGAPGPRGESGRPGL---QGDRGFP-----GERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPG----RGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKD--GFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGD------------------FGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGD------------------------------------------------PGIIGKP-----GSIGEPGDTGARG------DMGYPGSMGPKGAKGVG--------GSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGE 1042          

HSP 7 Score: 113.235 bits (282), Expect = 2.185e-24
Identity = 176/481 (36.59%), Postives = 227/481 (47.19%), Query Frame = 1
Query:  304 GPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGS---PGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGD---EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------------------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGT 1671
            GPKGE+G  G  G PGF+G+ G+ G PG  G+ G  G +GD    G +G KG +G  G+ G  G       +   G++G  G  G  G  G +G+ G  G PGM G+ G  G            P + GDKG  G  G  G IGE GD G    +G +GY G  G  G  G  G  G P        + G  GDKGD G            +  I G  G           G+ G KG +G  G  G  G +G +GD G IG  GKPGE G    PG PG  G PG+ G PG +G  GP G+ G +G  G+ G+ G +G+       + G RG+ G KG+KG  G  GIPG     G++GD GL G  G++G  G  RG+     +GPKG++G +G  G+ G  GEQG  G+ G  G KG                      IG  G  G+ G  GPKG+ G  G  G  G KG+ G +G+
Sbjct:  793 GPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGD---FGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPG-----------SPGQPGDKGDPGIIGKPGSIGEPGDTGA---RGDMGYPGSMGPKGAKGVGGSPGHP----GFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNI-GSPGF---------PGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGE-RGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGS 1241          

HSP 8 Score: 101.679 bits (252), Expect = 8.593e-21
Identity = 171/453 (37.75%), Postives = 219/453 (48.34%), Query Frame = 1
Query:  313 GEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGE---LGFKGEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKG-----AEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKG----------------RSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLT 1593
            G +G  G  G+PG  G +GD G PG++G KG +G  G  G  G  G  G +G+ G +  +   G+ GP G  G  G  G PG+ G  G +G  GM G PG QG KG +G  G         P + G+KG  G  G  GE G  G  GEPG +G  G  G+KG  G+    GF GE+GEP V    L  SRGE G KGDKG      +  +      KG KG+ G              G +GR G +G      EG KG RGD G  G+ G  GE G PG             PG  G +G +GD+G  G  G +GYKG KG  I +SG   G+ G  G KGE G    +G+PG  G++G+ G+ G  GE G++G                 +    +PG  GP+G +GL G+ G  G +G+QG  GL+G KG  G     G  G KG  G T
Sbjct:  913 GIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKG-DPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIG--------SPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSG------------LPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPG------------IPGSAGSKGEKGDVGFQGAPGSRGYKGDKG-FIGVSGE-PGLPGYNGPKGEMG---PQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQT 1327          

HSP 9 Score: 94.3597 bits (233), Expect = 1.174e-18
Identity = 211/617 (34.20%), Postives = 258/617 (41.82%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGY-------------------------KGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGC--------------------CGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGD--------------------IGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNS-----GLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGP---------------KGDTGDAGEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
             CTEC+  G  G  G  G  G +G PG  G+KG++G PG  G  GN G+                         KGD+G  G  GD+G  G  G+ GK G PG  G KG  G+ G                      G+PGQ G  G  G+ G  G PG+QG KG  G K  SLP         G +GA G  G  G  G  GD G PG +G+ G+ GDKGD                     G  G  GE GEP +   L    G  G KG+ G                KG  G+             G  G+ G  G+ G  G+ G  G  GP G  G  G  G PG  G  G PG  G   P          G          G KGY+GL G  +D+ G      GDRG  G  G+ G +G+PG  G  G  G     GE+G KG    +   G  GP G +GL G  G  G++G+ G  G++GD G      +GTKG +G  GL GP               KGD GD G+ GP GEKG  G  G   +PG  G  G  G+PG  G  G+ G+ G IGE         GD G RGD G+PG  G +G  G+
Sbjct:  389 TCTECNAFGPPGLPGPQGPKGLQGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAG-KVISLP---------GPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQ-DGLPGRAGTPGQKGEPGRGLPGP----------KGTTGL------------PGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPG--LDMPGPP----GDRGSPGVPGLPGSKGLPGQPGVPGKDGFP---GERGPKGE---IGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGD-----LGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEP--------GDTGARGDMGYPGSMGPKGAKGV 947          

HSP 10 Score: 73.9442 bits (180), Expect = 2.212e-12
Identity = 116/302 (38.41%), Postives = 145/302 (48.01%), Query Frame = 1
Query:  280 ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGD-----------RGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYT-----GEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGE---LGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGK 1128
            E    G  GP GE G  G +G PGF G +G+           RG PG  G+KGN G  G  G  G+ G KG +G SG+ G +G PG +G  G       G+ G  G+PG++GA G Q   G  GIPG  G KG KG  GF        P  RG KG KGF G+ GE             G+ GY G KG++G     GF G KGE      +  S+GE GD+G  G   +               KG  GPPGP G  G  G +G+ G  G +G  GL+G++G  G  G +G PG  G PG+
Sbjct: 1051 EPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQ---GPPGIPGSAGSKGEKGDVGFQ-----GAPGSRGYKGDKGFIGVSGE------------PGLPGYNGPKGEMGPQGVPGFPGTKGE----QGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTY--VKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQ 1326          

HSP 11 Score: 72.4034 bits (176), Expect = 5.878e-12
Identity = 91/240 (37.92%), Postives = 103/240 (42.92%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSG--------PKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTK--YKGDNGEKGVKGSQGTAGFPGNKGSKGETG--------------------LSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG 2655
            +GDKG  G  GD      +G  G+DG  GK G  G  G KGE G  G  G         +         G PG+     PGDKG  G  G  G  G +G KG+   V  L       G  GE G  G QG  GFPG +G  G  G                     SGIPG  G  G SG+ G+ G  GR G  G  G  GR G  G KG  GL GV       GFPGEKG+ G+ GVPG
Sbjct:  463 KGDKGLPGTTGD------RGFPGVDGLPGKDGRPGYPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQ-----PGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGR-GLPGPKGTTGLPGVP------GFPGEKGNTGMPGVPG 684          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col4a3 (collagen, type IV, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070802-4])

HSP 1 Score: 263.462 bits (672), Expect = 2.466e-70
Identity = 177/480 (36.88%), Postives = 242/480 (50.42%), Query Frame = 1
Query: 4045 KGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEG---------DLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQG-ETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQV-QMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRNQP 5451
            KG+KG  G  G+ GP G  GD+G     ++         G +G  G +GPKG+ G       P G  G  G KG+ G VGP G+ G KG  G +G +G           GD+G RG  G  GE                                         PGD GDKGL G +G KG+KG+ G  GP G KG +G +G+ GE   KG +G  G  G  G                   PG +G + R   G +F  HSQ+T IP+CP+ ++ L+ GYS L + G+ R H  DL + GSCL MF+ +PF+ C + E C Y+ RND +YWLS+   M     +   ++ + Y+SRC VCEA +   A HSQ+   P+CP GW +LW G SF+M TG GA G GQ L SPGSCL  F++  F+EC  +G C +Y +   +WL + D    F M    N +T + +++I++C VCM+ QP
Sbjct: 1269 KGDKGCVGPQGRVGPPGCTGDRGTPGEPIQSCDELSCFQGKDGDCGLRGPKGNIG-------PLGRVGPDGQKGQCGPVGPAGLKGCKGSPGTKGPKGCDYTVEIFSTPGDRGFRGKTGQKGE-----------------------------------------PGDNGDKGLRGLKGTKGQKGDIGANGPDGSKGMLGLQGDSGEKGLKGARGLTGEVGAKGA------------------PGAKGPQLRKRDGFLFTRHSQTTVIPECPAGSKRLYTGYSLLFINGNNRGHGQDLGTLGSCLPMFNTMPFMVCNRDETCRYASRNDYSYWLSTDTPMLPDQQMMSGEILKWYISRCSVCEAIANVIAIHSQTINIPQCPVGWLSLWEGYSFVMQTGVGAEGSGQPLVSPGSCLEQFRKIPFIECHGRGTCNFYPDSYSYWLASLDHTNMFSMP---NRQTAKQKEIISRCQVCMKQQP 1679          

HSP 2 Score: 128.642 bits (322), Expect = 4.939e-29
Identity = 232/697 (33.29%), Postives = 300/697 (43.04%), Query Frame = 1
Query: 2092 GLDGYSGKKGE-----SGIHGDKGEKGLAGFSGPKGI---KGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKG---------------------------LEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGN-----------IGERGNPGIKGYKGNSGFPDIT----LKGYKGIPGEIGPKGFQGLPG------EKGFKGEIGPTGT------------------------------SGLRGRKGDQGP-----QGYKGVQGQKGIIGM---------------IGEMGSQGDKGDTGERGS-----IGIQGYQGEKGNQGSLGLKGLKGNQGPAGDG---IKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQ---EGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKG 3828
            G DG+ G  G      SG  GD+G  G+ G  GP G+   KG +G+TGLPG     + G  GI G  G +G  GF+G KG                     +G  G+ GFPG +G +G  G++G PG  G  G  G  G KG MGR G  G +G+ G  G+ G +G KG                           L  +    G +G PG KG+IG+ G+ G    G  G  G  G  G  G+ G KG  G +G  G  GD+G  G  G  G KG  G  G+PGI  + G  GPKG +G+           +GE+G PG  G  G  G   I     + G+ G+PGE G  G  G PG      + GF G  GP G                                G  G KGD+G       G  G++G+KGI G                 GE+GS G  G+ G+RG      + I G +GE+G  G  G  GL+G  GP GD    +KG KG +GPQG+ G  G  G          +G PG+ I         +G+ G+ G++G KG+IGP+G  G  G +GQ    G  GLKG K                        G PG  G KG            +RG +G+ G+KGE G+ GDKG RGL G  G +G  G  G +G  GM G
Sbjct:  778 GFDGFPGVAGVPGCCISGAKGDEGPSGIRGADGPPGLPGLKGPQGETGLPGLSIPGVTGVVGIPGIFGPVGAVGFRGPKG--------------------FQGRDGSPGFPGIRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGVPGDEGKPGEPGDPGPRGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQ--CGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGERGVTGVTGDPGPPGEAGDDGFDGFPGPPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCTMTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGD---------RGTPGEPIQSCDELSCFQGKDGDCGLRGPKGNIGPLGRVGPDGQKGQCGPVGPAGLKGCK------------------------GSPGTKGPKGCDYTVEIFSTPGDRGFRGKTGQKGEPGDNGDKGLRGLKGTKGQKGDIGANGPDGSKGMLG 1419          

HSP 3 Score: 122.865 bits (307), Expect = 2.543e-27
Identity = 201/593 (33.90%), Postives = 260/593 (43.84%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGK-------------------EAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL----------LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGEN--GLDGRRGRQGN------------MGIKGVKGLEGVKGDRGFIGF------PGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQ---------------GNIGERGNPGIKGYKGNSGFPDITLKGYKG-----------------IPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD-----------QGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQE 3519
              GD+G  G  G PG  G  G  GL G  G  G +G+ GD+G+ G  G  GP+G KG+  +   PG+                   +   + G  G+ G  GE+G  G  G+ GKN                +    G+ G  G  G QG  GFPG KG KG  G  G PG  G  G +G  G KG+    G    GL G +G  G              GI G+ G  GV G+RG  G       PGE GD G  G PG          G +G  G  G  G  GD G  G +G+ G  G  G  GE GD+G   + GD G+  I GEKG KG +               G IG  G PG KG +G SG P + + G KG                  P      G +G  G  G +G +GP G +G RG  G+           QG  G  G++G KG IG +G +G  G KG  G  G  G++G +G  G +G  G           GD  +G +G  G +G+ G++G KG++GL G KG KG  G N   GSKG  G +G  GE G+KG +G  G +G  G+ G +G +
Sbjct:  870 IRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGVPGDEGKPGEPGDPGPRGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGERGVTGVTGDPGPPGEAGDDGFDGFPGPP--------GCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCT-MTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGDRGTPGEPIQSCDELSCFQGKDGDCGLRGPKGNIGPLGRVGPDGQKGQCGPVGPAGLKGCKGSPGTKGPKGCDYTVEIFSTPGD--RGFRGKTGQKGEPGDNGDKGLRGLKGTKGQKGDIGANGPDGSKGMLGLQGDSGEKGLKGARGLTGEVGAKGAPGAKGPQ 1451          

HSP 4 Score: 121.324 bits (303), Expect = 9.406e-27
Identity = 216/635 (34.02%), Postives = 263/635 (41.42%), Query Frame = 1
Query: 2029 GDKGPSGERGDPG-----------------EVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGT------------AGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTG------VPGD-SITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERG---------------------------NPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGL------------------------PGEKGFKGEIGPTGT--SGLRGRKGDQGPQGYKGVQGQ-----------KGIIGMIGEMGSQGDKGDTGERGSIG--------IQGYQGEKGNQGSLGLKGLKGNQGPAG----DGIKGMKGLIGPQGQKGESGYKGVQGLAG---------DKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIG---PIGLPGSIGFQGQEGQRGLKGDK 3546
            G KGP GE G PG                  VG  G RG  G+ G+ G  G  G +G++G  G +GP G+ G  G  GL G +       +PGD   +G  GE GD G +G KG++ NV        G+ G  G+     T             G  G  GSKGE GL GI G+ GK G  G  G  G  G  G  GL G +G  GN G +GV G  GVKG +G  GF GE G  GV G      + GD S  GP                G              G  G  G  G  G++G  G+ GDPG    GE G  GF G  G  G                             GI G  G  G    T+ G  G+PG  G KG +G                         PGEKG +G  GP G   SG +G +G  G  G  G+QG            KG  G +G  G  G  G TG+RG+ G        +  +QG+ G+    GL+G KGN GP G    DG KG  G +GP G KG  G  G +G  G           G +GF GK    G  G+ G+KG  G  G KG KGDIG   P G  G +G QG  G++GLKG +
Sbjct:  816 GLKGPQGETGLPGLSIPGVTGVVGIPGIFGPVGAVGFRGPKGFQGRDGSPGFPGIRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGVPGD---EGKPGEPGDPGPRGPKGQSSNVT-----SPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGI----CGINGIPGFSGVPGERGVTGVTGDPG--PPGEAGDDGFDGFPGPPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCTMTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGDRGTPGEPIQSCDELSCFQGKDGD---CGLRGPKGNIGPLGRVGPDGQKGQCGPVGPAGLKGCKGSPGTKGPKGCDYTVEIFSTPGDRGFRGKTGQKGEPGDNGDKGLRGLKGTKGQKGDIGANGPDGSKGMLGLQGDSGEKGLKGAR 1433          

HSP 5 Score: 115.546 bits (288), Expect = 4.483e-25
Identity = 200/600 (33.33%), Postives = 246/600 (41.00%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----------------------------------IPGDKGIQGDVGELGDKGFKGEKGKN----------QNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGEN--GLDGRRGRQGN------------MGIKGVKGLEGVKGDRGFIGF------PGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQ---------------GNIGERGNPGIKGYKGNSGFPDITLKG-----------------------------YKGIPGEIGPKGFQGLPGEKGFKGEIGPT--------------GTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGD------------------TGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD----GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG 3390
            +G +G  G  G PG  G+QG  G+ G  G  G  G  G +G KGL G +G  G +G+ G+ G PG    K                                  + G  G+ G  GE+G  G  G+ GKN             +  +    G+ G  G  G QG  GFPG KG KG  G  G PG  G  G +G  G KG+    G    GL G +G  G              GI G+ G  GV G+RG  G       PGE GD G  G PG          G +G  G  G  G  GD G  G +G+ G  G  G  GE GD+G   + GD G+  I GEKG KG +               G IG  G PG KG +G SG P + + G                              KG  G +GP+G  G PG  G +G  G                G  GLRG KG+ GP G  G  GQKG  G +G  G +G KG                    G+RG  G  G +GE G+ G  GL+GLKG +G  GD    G  G KG++G QG  GE G KG +GL G+ G KG PG
Sbjct:  856 KGFQGRDGSPGFPGIRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGVPGDEGKPGEPGDPGPRGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGERGVTGVTGDPGPPGEAGDDGFDGFPGPP--------GCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCT-MTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGDRGTPGEPIQSCDELSCFQGKDGDCGLRGPKGNIGPLGRVGPDGQKGQCGPVGPAGLKGCKGSPGTKGPKGCDYTVEIFSTPGDRGFRGKTGQKGEPGDNGDKGLRGLKGTKGQKGDIGANGPDGSKGMLGLQGDSGEKGLKGARGLTGEVGAKGAPG 1446          

HSP 6 Score: 110.923 bits (276), Expect = 1.124e-23
Identity = 202/556 (36.33%), Postives = 260/556 (46.76%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLR-GLDGYSGKKGESGIHGDKGEKGLAGF-SGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGE--------KGNMGRKGENGLDGRRGRQGNMGIKGVKGLEG--VKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGI--LAIGEKGPKGFQGNIGERGNP----------GIKGYKGNSGF-------PDITLKGYKGIPGEIGPKGFQGLP---GEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG--KNIMGSKGE---------------KGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            +G+ GP G  G PGE G++G   G+ G SG+KGE G  G  G+KG+  F SGPK  KG+ GD+G           D+G  G +G  G  G KGEKG+  +         G  G++G++G  G+ G  G+KG  G+TG+ G  G+ G  G  G  GE        KG  G  G  GL G RG +G  G  G +GL G  ++G  G  G PG KG  G  G PG  ITGP G  G +G+ G  G+ G  G   +      +   G  GL+G+ G  G EGL GDPG     +        Q N+G + NP          GI+G KG+ G              G  G PG  GPKG  G+    GEKGFKG+ G  G  GL G+ G  G  G+KG  G+KG    +   G QG  G  GE+GS G        G+QGS+G+                  G  G  G+KG  G  G QG  GD G KG PG  + I G  GE               +G  G  G  G+ G KG+ G +  PG  G  G +G +G+KG
Sbjct:  197 KGNPGPQGIPGFPGEKGKEGRSMGIPGPSGQKGERGPPGIPGQKGIKLFASGPKEPKGDTGDSG-----------DRGSPGIIGLRGRPGPKGEKGERGD-----PGGPGKPGKEGLQGELGSKGGKGDKGYPGDTGIEGEKGQKGNPGPPGTPGEFIVINTEVKGQKGDPGPPGLLGLRGSEGFYGFPGYQGLPGTPIQGPNGKPGLPGFKGLKGDKGEPGPDITGPKGRDGQRGEQGPPGDPGLPGPSNV------ISRLGLKGLKGDKGLIGPEGLRGDPGNQGYVLLLLLILVLQDNLGIQANPANQVNSSSAVGIQGNKGSRGLKGPIGPAGPPGFSGLTGFPGPSGPKGEMGMKYEIGEKGFKGDTGAVGLLGLSGQDGLPGIPGFKGPPGEKGKPSALAPKGDQGYPGVGGEQGSTG------PMGSQGSMGV------------------GSPGAPGEKGNLGVVGRQGNLGDPGEKGSPGPVQTIPGDPGEPGLPGSPGLPGPPGNEGCAGVQGFPGLCGLKGEKG-LSTPGDTGLTGPKGDKGVKG 705          

HSP 7 Score: 107.071 bits (266), Expect = 2.012e-22
Identity = 248/781 (31.75%), Postives = 331/781 (42.38%), Query Frame = 1
Query: 1273 NVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMI-------------GTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSG----KKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDV---------GELGDKGFKGEKGKN---------QNVNVLLTKYKGDNGEK------GVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGR--KGENGLDGRRGRQGNMG---------IKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKG------------FEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGI--------IGMIGEMGSQGDKGDTGERGSIG----IQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGES--GYKGVQGLAGDKGPKG 3381
            +  GV+G +GEKG  G+ GD G+ G +G  G  G  G  G  G                     + G+ G+ G RG  G  G  G  G+ G+  I             GTKG  G  GL GP G  G  G  G  G KG+       I  A+   G+ G+ G  G  G PG  G  G  G      +G  GN G +G PG PGE+G +G                                                     R+ G  GPSG++G+ G  G  G +G+  ++      KG++G  GD+G  G+ G  G  G KGE+G+ G PG   +   G +G+QG++         G  GD G +GEKG+              V+ T+ KG  G+       G++GS+G  GFPG +G  G T + G  GK G  G  G  G+KG  G    G  G DG+RG QG  G         +    GL+G+KGD+G IG  G +GD G  G                  + ++                Q+      G++G  G +G            F GL G P        GP G +G +G +   G KG+KG++G   + L G  G  G  G  GF+G PGEKG    + P G  G  G  G+QG  G  G QG  G+         G +G +G QG+ GD GE+GS G    I G  GE G  GS GL G  GN+G A  G++G  GL G +G+KG S  G  G+ G  GDKG KG
Sbjct:   38 DCQGVKGQKGEKGSLGLVGDVGVQGHQGKEGPPGFPGLKGYLG---------------------IPGIPGRKGSRGISGTPGFFGPPGLPGLPGIQGPRGPPGLPGCNGTKGEPGPPGLIGPMGRPGIQGRPGIQGPKGET----IFIAAAEQMIGLTGQQGRAGDPGPPGLPGVQGNIGP-----EGPKGNPGPQGIPGFPGEKGKEG-----------------------------------------------------RSMGIPGPSGQKGERGPPGIPGQKGIKLFASGPKEPKGDTGDSGDRGSPGIIGLRGRPGPKGEKGERGDPGGPGKP--GKEGLQGELGSKGGKGDKGYPGDTGIEGEKGQKGNPGPPGTPGEFIVINTEVKGQKGDPGPPGLLGLRGSEGFYGFPGYQGLPG-TPIQGPNGKPGLPGFKGLKGDKGEPGPDITGPKGRDGQRGEQGPPGDPGLPGPSNVISRLGLKGLKGDKGLIGPEGLRGDPGNQGY---------------VLLLLLILVLQDNLGIQANPANQVNSSSAVGIQGNKGSRGLKGPIGPAGPPGFSGLTGFP--------GPSGPKGEMGMKYEIGEKGFKGDTG--AVGLLGLSGQDGLPGIPGFKGPPGEKGKPSALAPKGDQGYPGVGGEQGSTGPMGSQGSMGVGSPGAPGEKGNLGVVGRQGNLGDPGEKGSPGPVQTIPGDPGEPGLPGSPGLPGPPGNEGCA--GVQGFPGLCGLKGEKGLSTPGDTGLTGPKGDKGVKG 705          

HSP 8 Score: 91.2781 bits (225), Expect = 1.109e-17
Identity = 209/554 (37.73%), Postives = 270/554 (48.74%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKG------------IKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKG----KNQNVNVLLT-KYKGDNGEKG---------VKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVK----GLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEI--GPKGFQGLPGEKGFKGEIGPTG--TSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQG-------------SLGLKGLKGNQGPAGDGI-----KGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRG 3531
            +G+KG  G  GD G  G QG  G  G+ G KG  GI G  G KG  G SG  G            I+G RG  GLPG    K  G+ G  G +G +G  G +G  G    K + + +    +  G  G++G         + G QG  G  G KG+ G  G+ G PG+ GK G S        MG  G +G  G RG  G  G KG+K    G +  KGD G  G  G  G IG+ G PG    G  G++GD G  G  G++G +G++G KG KG  G  G TG+ GE G KG  G  G PG   +     KG +G+ G  G  G++G +G  GFP     GY+G+PG    GP G  GLPG KG KG+ G  G   +G +GR G +G QG  G  G  G   +I  +G +G KGD   +G IG +G +G+ GNQG             +LG++    NQ  +   +     KG +GL GP G  G  G+ G+ G  G  GPKG      MG K E G KG  G+ G  G  G  G  GLPG  GF+G  G++G
Sbjct:   46 KGEKGSLGLVGDVGVQGHQGKEGPPGFPGLKGYLGIPGIPGRKGSRGISGTPGFFGPPGLPGLPGIQGPRGPPGLPGCNGTK--GEPGPPGLIGPMGRPGIQGRPGIQGPKGETIFIAAAEQMIGLTGQQGRAGDPGPPGLPGVQGNIGPEGPKGNPGPQGIPGFPGEKGKEGRS--------MGIPGPSGQKGERGPPGIPGQKGIKLFASGPKEPKGDTGDSGDRGSPGIIGLRGRPGPK--GEKGERGDPGGPGKPGKEGLQGELGSKGGKGDKGYPGDTGIEGEKGQKGNPGPPGTPGEFIVINTEVKGQKGDPGPPGLLGLRGSEGFYGFP-----GYQGLPGTPIQGPNGKPGLPGFKGLKGDKGEPGPDITGPKGRDGQRGEQGPPGDPGLPGPSNVISRLGLKGLKGD---KGLIGPEGLRGDPGNQGYVLLLLLILVLQDNLGIQANPANQVNSSSAVGIQGNKGSRGLKGPIGPAGPPGFSGLTGFPGPSGPKGE-----MGMKYEIGEKGFKGDTGAVGLLGLSGQDGLPGIPGFKGPPGEKG 574          

HSP 9 Score: 88.9669 bits (219), Expect = 6.191e-17
Identity = 184/516 (35.66%), Postives = 234/516 (45.35%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKG---NEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYD---------------GMQGIPGMQGEKGRKGPKGFS----LPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDR---------------------GIPGDEGSRGDSG-----LQGPIGEK--GNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGM------DMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS 1674
            G +G +G  GF G +G PGF G++GD+G PG  G  G   N G  G +GPKG++G  GV G+ G   K G PG  GP+G  G+      PG+ G  GL  +D               G+ G+PG +GE G  G  G      +P     P   GD G KG  G +G  G FGD      +G++G+ G KG  G  GF GE G P     +    G  G KGD     +     T   +  KG+ G  G  G  GD G  G  G  G +G  G  G+ G+ GD GP G+ G  G +G PG PG +G  G  G PG  G  GP G  G  G  G+ G  G KGD       +TG  G  G KGEKGI G R                     G PG++G RG SG     + GP GE+         G+  P         GL+G  G  G +G  G  G  GD+G  G       ++   +G+ G  GL GPKG+ G  G  GP G+KG  G VG +
Sbjct:  848 GAVGFRGPKGFQGRDGSPGFPGIRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGVPGDEG---KPGEPGDPGPRGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGD------QGVMGFPGVKGVKGSPGFHGEPGIP----GVPGPNGPKGIKGDP----SPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGERGVTGVTGDPGPPGEAGDDGFDGFPGPPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDR---GCTMTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGDRGTPGEPIQSCDELSCFQGKDGDCGLRGPKGNIGPLGRVGPDGQKGQCGPVGPA 1343          

HSP 10 Score: 84.7297 bits (208), Expect = 1.286e-15
Identity = 218/694 (31.41%), Postives = 279/694 (40.20%), Query Frame = 1
Query: 2086 LRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNS-------GKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVT-GVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKG---------------IPGEIGPKGF---------QGLPGEKGFK-----------------------GEIGPTGTSGLRGRKGDQGPQGYKG-----VQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGS---------------LGLKGLKGNQGPAG-DGIKGMKGLIG--------------------PQGQKGESGYKGVQGLAGDKGPK---------------GFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNI 3834
             +G+ G  G+KG  G+ GD G +G  G  GP G  G +G  G+PG     IPG KG +G  G                    +   +G  G  G  G++G  G PG  G  G  G+ G PG  G  G +          G  G  GR G+ G  G  G QGN+G +G K   G  G +G  GFPGEKG  G + G+PG S                                GQ G++G  G+ G+ G K          + A G K PKG  G+ G+RG+PGI G +G  G      KG KG               + GE+G KG           G+ GEKG K                       G+ GP G  GLRG +G  G  GY+G     +QG  G  G+ G  G +GDKG+ G     G +G  G++G QG                LGLKGLKG++G  G +G++G  G  G                    P  Q   S   G+QG  G +G K               GFPG +  G KGE G K  IGE   KGFKGD G +GL   +G  GQ+G  G+ G KG  G  G P                                    A +GD+G  G  GE G+ G  G++G  G VG  G  G KG  G  G +GN+
Sbjct:   39 CQGVKGQKGEKGSLGLVGDVGVQGHQGKEGPPGFPGLKGYLGIPG-----IPGRKGSRGISGTP-----GFFGPPGLPGLPGIQGPRGPPGLPGCNGTKGEPGPPGLIGPMGRPGIQGRPGIQGPKGETIFIAAAEQMIGLTGQQGRAGDPGPPGLPGVQGNIGPEGPK---GNPGPQGIPGFPGEKGKEGRSMGIPGPS--------------------------------GQKGERGPPGIPGQKGIK----------LFASGPKEPKGDTGDSGDRGSPGIIGLRGRPG-----PKGEKGERGDPGGPGKPGKEGLQGELGSKGGKGDKGYPGDTGIEGEKGQKGNPGPPGTPGEFIVINTEVKGQKGDPGPPGLLGLRGSEGFYGFPGYQGLPGTPIQGPNGKPGLPGFKGLKGDKGEPGPD-ITGPKGRDGQRGEQGPPGDPGLPGPSNVISRLGLKGLKGDKGLIGPEGLRGDPGNQGYVLLLLLILVLQDNLGIQANPANQVNSSSAVGIQGNKGSRGLKGPIGPAGPPGFSGLTGFPGPS--GPKGEMGMKYEIGE---KGFKGDTGAVGL---LGLSGQDGLPGIPGFKGPPGEKGKPSAL---------------------------------APKGDQGYPGVGGEQGSTGPMGSQGSMG-VGSPGAPGEKGNLGVVGRQGNL 629          

HSP 11 Score: 74.7146 bits (182), Expect = 1.213e-12
Identity = 199/567 (35.10%), Postives = 237/567 (41.80%), Query Frame = 1
Query:  295 GLLGPKGEMG---FGGHEGKPGFRGVKGDRGP---------PGALGEKGNEGYK------------------GDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYT---------------GEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFS---------GLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGEL---GFKGEKGEP-----------------------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGK--HGKPGENGSPGKXXXXXXXXXXXXXXXXXXXX--------XXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGR-----SRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGD------TGDAGEAGPIGEKGDIGDVGTS-IPGAQ 1689
            GL GPKG MG     G EGKPG  G  G RGP         PG LG  G   +                   G  G KG IG  G+ G  G NG  G+ G  GP G                 G++G  G PG KG  G  G+ G  GIPG+ G  G KG KG   P     P   G+KG  G +         G+ G  G  G  G PG +G+ G  GD G  GE    GF G  G P                             D   G  G+KGD+G +    +T  +    IKG+KGI+G  GP G  G  G  G  G  GS G  G KG RG  GP G    G  GE G  G PG  G+ G  GPPG  G           P+G +G  G +G +G  G    + D      G  GD G +G KG  G  G  G +G +G  G  GP G KG KG       +G     E         RG  GKTG++GE G  G KG +G+K     GTKG+KG  G  GP G        GD+GE G  G +G  G+VG    PGA+
Sbjct:  893 GLRGPKGLMGRNGVPGDEGKPGEPGDPGPRGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGERGVTGVTGDPGPPGEAGDDGFDGFPGPPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCT----MTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGDRGTPGEPIQSCDELSCFQGKDGDCGLRGPKGNIGPLGRVGPDGQKGQCGPVGPAGLKGCKGSPGTKGPKGCDYTVEIFSTPGD--RGFRGKTGQKGEPGDNGDKGLRGLK-----GTKGQKGDIGANGPDGSKGMLGLQGDSGEKGLKGARGLTGEVGAKGAPGAK 1448          

HSP 12 Score: 68.5514 bits (166), Expect = 8.754e-11
Identity = 193/622 (31.03%), Postives = 243/622 (39.07%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP------------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRA--------GSKGAEGLKGIRGDLGP---IGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGE------------------KGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXX---------------LRGLDGKTGKRGEQGH---------------------------KGLKGDKGVKG-------MDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGD--------AGNRGDKGFPGIPGERGIDGLN 1866
            GLLG  G+ G     G PGF+G  G++G P AL  KG++GY G  G +G  G  G QG+ G+    GAPG KG  G  G +G  G PG+KG+ G      +Q IPG  GE G         P     P   G  G +GF GL G  GE G +  PG+ G+ G +GDK      G KG +G P               +   K     G   +K              +++     +         + + G  G+ G A        G+KG EG  GIRG  GP    G  G  GE G PG             PG  G  G  G  G  G  G +G KG +G   D S    G+RGD+G                   +G KG+ G  G+PGDEG  G+ G  GP   +G KG+S  V+ PGE GP G                  + GL G  G +GE G                            KGL G++G+ G       M   G KG KG  G  G  G  G  G  GP G KGD    G   PG                         +GEKG    C+ G          G  G  GF G+PGERG+ G+ 
Sbjct:  550 GLLGLSGQDGL---PGIPGFKGPPGEKGKPSALAPKGDQGYPGVGGEQGSTGPMGSQGSMGVG-SPGAPGEKGNLGVVGRQGNLGDPGEKGSPGP-----VQTIPGDPGEPGLP-----GSPGLPGPPGNEGCAGVQGFPGLCGLKGEKG-LSTPGDTGLTGPKGDK------GVKGRQGSPGCGSIGRPGPPGPPGMPGPKHLAAQGQGVEKVCQEMKVALVHQESLVLLDYLDVEVKKDRMDHLENLGFDGFPGVAGVPGCCISGAKGDEGPSGIRGADGPPGLPGLKGPQGETGLPG----------LSIPGVTGVVGIPGIFGPVGAVGFRGPKGFQGR--DGSPGFPGIRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGVPGDEGKPGEPGDPGP---RGPKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGLPGNQGLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPG------------------------LLGEKGE-PGCAGGTGKKGDKGICGINGIPGFSGVPGERGVTGVT 1110          

HSP 13 Score: 63.929 bits (154), Expect = 2.259e-9
Identity = 154/501 (30.74%), Postives = 202/501 (40.32%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGP-----KGMIGDKGVQGNS------------GINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQ------------------------------GEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEI---------GEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEK-------GEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPK 1602
            NG  G +G MGF G +G  G  G  G+ G PG  G  G +G KGD  P      G++G+KG  G +            GING  G  G+ G +G T   G  G PG  G AG  G+DG  G PG +                              G  G KG +G ++  +  LP  +G+KG KG  G  G           GE G  G+PG KG  G  G  G +   G KGE+          ++           G KGDKG             V   G  G RG PG      D  +  ++G+ G     GL+G +G++GP+G+ G  G+ G  G                         +G AG  G KG  G KG    D +  +    GDRG +G+    G +G PGD G +G  GL+G  G+KG+ G +                  G DG  G  G QG  G KG KG +G  + G  G KG  G  GP+
Sbjct: 1012 NGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGDPSPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFSGVPGERGVT---GVTGDPGPPGEAGDDGFDGFPGPPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCTMTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPG-VCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKG------CVGPQGRVGPPGCTGDRGTPGEPIQSCDELSC-FQGKDGDC---GLRGPKGNIGPLGRVGPDGQKGQCGP------------------------VGPAGLKGCKGSPGTKGPKGCDYTVEIFSTPGDRGFRGKT---GQKGEPGDNGDKGLRGLKGTKGQKGDIGAN------------------GPDGSKGMLGLQGDSGEKGLKGARG--LTGEVGAKGAPGAKGPQ 1451          

HSP 14 Score: 60.4622 bits (145), Expect = 2.619e-8
Identity = 155/507 (30.57%), Postives = 211/507 (41.62%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKG-RKGPKGFSLPQEGVLPAE------------------RGDKGAKGFSGLKGEIGEF--------GDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVK----MISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKG---------IDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPI--------GEKGDIGDVG 1668
             G +GP+G  G  G +G PGF G KG  G   ++G  G  G KG++GP G+ G KG++                    +G +   G  G  G  G  G  G++G PG +GEKG R  P G   P +  L  E                   G+KG KG  G  G  GEF        G  G+PG  G++G +G +G  G  G++G  G P++       L   +G  GDKG+ G   T            KG+ G RG  GP GD G  G      R G KG   LKG +G +GP G  G PG  G                            +    N G++     + +    S +  G++G++G +G KG           G  G PG  G +G+ G++  IGEKG KG +  V             L GL G+ G  G  G KG  G+KG      +  KG +G  G+ G +G TG  G  G +        GEKG++G VG
Sbjct:  188 QGNIGPEGPKGNPGPQGIPGFPGEKGKEG--RSMGIPGPSGQKGERGPPGIPGQKGIK-----------------LFASGPKEPKGDTGDSGDRGSPGIIGLRGRPGPKGEKGERGDPGGPGKPGKEGLQGELGSKGGKGDKGYPGDTGIEGEKGQKGNPGPPGTPGEFIVINTEVKGQKGDPGPPGLLGLRGSEGFYGFPGYQGLPGTPIQGPNGKPGLPGFKGLKGDKGEPGPDITGP----------KGRDGQRGEQGPPGDPGLPGPSNVISRLGLKG---LKGDKGLIGPEGLRGDPGNQGY--------------------VLLLLLILVLQDNLGIQANPANQVN----SSSAVGIQGNKGSRGLKGPIGPAGPPGFSGLTGFPGPSGPKGEMGMKYEIGEKGFKGDTGAVG------------LLGLSGQDGLPGIPGFKGPPGEKGKP--SALAPKGDQGYPGVGGEQGSTGPMGSQGSMGVGSPGAPGEKGNLGVVG 624          

HSP 15 Score: 58.9214 bits (141), Expect = 7.015e-8
Identity = 144/470 (30.64%), Postives = 186/470 (39.57%), Query Frame = 1
Query:  331 GHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKG-PKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLK--GIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNV------TGVRGDRGEKGEK----GIDGDRGIP--------GDEGSRGDSGLQGPIGEKGNKGRS--RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGT 1671
            G +G  G RG+KG  GP G  G  G  G+ G  GPKG +G K                        GE+G  G  G  G  GL G DG+ GIPG +G  G KG P   +   +   P   G++G+ G  G +G +G  G  G PG KG +G  G +G++G+ G KG  G PV+ I            GD G                +G  G+               +G+ G  G KG +GL   G  G  GP G  G  G  GSPG          R  P           + A G    K  + +K   +     V        V+ DR +  E     G  G  G+P        GDEG  G  G  GP G  G KG     G+      G  G  G+ G+ G  G  G +G KG +G  G  G    G +G +G  G+TGP G  G+ G  G  G KG +G  G 
Sbjct:  493 GIQGNKGSRGLKGPIGPAGPPGFSGLTGFPGPSGPKGEMGMK---------------------YEIGEKGFKGDTGAVGLLGLSGQDGLPGIPGFKGPPGEKGKPSALAPKGDQGYPGVGGEQGSTGPMGSQGSMG-VGSPGAPGEKGNLGVVGRQGNLGDPGEKGSPG-PVQTIP-----------GDPGEPGLPGSPGLPGPPGNEGCAGV---------------QGFPGLCGLKGEKGLSTPGDTGLTGPKGDKGVKGRQGSPG-----CGSIGRPGPPGPPGMPGPKHLAAQGQGVEKVCQEMKVALVHQESLVLLDYLDVEVKKDRMDHLENLGFDGFPGVAGVPGCCISGAKGDEGPSGIRGADGPPGLPGLKGPQGETGLPGLSIPGVTGVVGIPGIFGPVGAVGFRGPKGFQGRDGSPGFP--GIRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGV 906          

HSP 16 Score: 58.9214 bits (141), Expect = 8.731e-8
Identity = 58/139 (41.73%), Postives = 76/139 (54.68%), Query Frame = 1
Query: 4000 NGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI-GLLGVKGERG---------DPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGE 4386
            +G+ G RGP+GN G  G  G  G  G+ GP GPAG +G  G  G KG +G          PG  G+ G+ G KG  GD G   L    +G  G KG KG++G+ GP       G KG  G++GD G+KG++G +GL GE
Sbjct: 1310 DGDCGLRGPKGNIGPLGRVGPDGQKGQCGPVGPAGLKGCKGSPGTKGPKGCDYTVEIFSTPGDRGFRGKTGQKGEPGDNGDKGL----RGLKGTKGQKGDIGANGP------DGSKGMLGLQGDSGEKGLKGARGLTGE 1438          

HSP 17 Score: 58.151 bits (139), Expect = 1.192e-7
Identity = 168/535 (31.40%), Postives = 230/535 (42.99%), Query Frame = 1
Query:  208 FWIIISLVQ---------DSESAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGI------------------NXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGEL---GFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKG------------------VNGLTGPKGDTGDAGEAGPIGEKGDIGDVG 1668
             W+++ +               +   C+ S  + C C G+                  +G KG++G  G +G+ G +G++G +GP G  G KG  G  GI                   G  G PG++GP+G  G  GC G  G+ G  GL G     G PG+QG  G +GPKG ++    +  AE+      G +G +G  G+ G  G PG +G IG +G KG+ G     GF GEKG+  + + +    G+ G++G  G               I GQKGI+         G    KG  G +G +G+ G+ G+RG  GP       GE G  G PG  G PG+ G  G  G +G +GD G  G++G++G KG KG+          +  +   KG+K   GD G PG  G RG  G  G  G +G  G                     + G  GK G  G KGLKGDKG  G D+ G KGR G                  V    G KG  GD G  GP G +GD G+ G
Sbjct:    3 HWVLLRVTLVGMMLLGLLTPTQSKGACDCSGKSGCDCQGV------------------KGQKGEKGSLGLVGDVGVQGHQGKEGPPGFPGLKGYLGIPGIPGRKGSRGISGTPGFFGPPGLPGLPGIQGPRGPPGLPGCNGTKGEPGPPGLIGP---MGRPGIQGRPGIQGPKGETI---FIAAAEQ----MIGLTGQQGRAGDPGPPGLPGVQGNIGPEGPKGNPGPQGIPGFPGEKGKEGRSMGIPGPSGQKGERGPPG---------------IPGQKGIK-----LFASGPKEPKGDTGDSGDRGSPGIIGLRGRPGPK------GEKGERGDPGGPGKPGKEGLQGELGSKGGKGDKGYPGDTGIEGEKGQKGNPGPPGTPGEFIVINTEVKGQK---GDPGPPGLLGLRGSEGFYGFPGYQGLPGTP-------------------IQGPNGKPGLPGFKGLKGDKGEPGPDITGPKGRDGQRGEQGPPGDPGLPGPSNVISRLGLKGLKGDKGLIGPEGLRGDPGNQG 461          

HSP 18 Score: 57.3806 bits (137), Expect = 2.459e-7
Identity = 175/528 (33.14%), Postives = 218/528 (41.29%), Query Frame = 1
Query: 2902 NPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGN---KGRIGEMGVKGFKGD------------IGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI-------------------------GLLGVKGERGD-----------PGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGS--KGEKGER 4326
            N G  G+ G +G P   + G KG  G  G +G  G PG  G KG  G TG  GL          G  GV G  GI G +G +G +G KG  G  GS G  G +G++G+ G  G  G+ GN GP G  ++G KGL+G   + G  G +G  G  GD GP+G         KG+  N    G +G  G+  F               +G +GLPGS G  G  G  G  G  G  G  G PG  G  G KG                            +G  G  G++G MG  G KG +G  G  G+ G  G  G NG  G+KG+                      G+LG+KG  G  G  G +G KG  G+ GI G S  G  G+RG  G TG+ G  GE GD G  G  GP G +G                          G+ G  GE+GD           PG  G +G +G +G            GP GE G  G  GE G  G +G PG    G KGER
Sbjct:  776 NLGFDGFPGVAGVPGCCISGAKGDEGPSGIRGADGPPGLPGLKGPQGETGLPGLS-------IPGVTGVVGIPGIFGPVGAVGFRGPKGFQGRDGSPGFPGIRGDQGSPGMTGPPGVDGNPGPPG--LRGPKGLMG---RNGVPGDEGKPGEPGDPGPRG--------PKGQSSNVTSPGELGPPGLPAFDKTWETFRLYDILCVLGLLGLPGSKGEIGLPGICGQCGKNGVPGSSGPPGPPGDPGIKGL------------------------PGNQGLNGNFGDQGVMGFPGVKGVKGSPGFHGEPGIPGVPGPNGPKGIKGD-------------PSPPGPETPGLLGEKGEPGCAGGTGKKGDKGICGINGIPGFS--GVPGERGVTGVTGDPGPPGEAGDDGFDGFPGPPGCEGPCGPPGVPGSPGDPGPPGPRGEQGRDGIPGSAGEKGDRGCTMTGDSGLPGIKGEKGIKGTRG-PPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGER 1243          

HSP 19 Score: 56.225 bits (134), Expect = 4.783e-7
Identity = 60/146 (41.10%), Postives = 76/146 (52.05%), Query Frame = 1
Query: 3973 LRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDP---GPDGYEGQRGPKGPKGDKGFSILYP---GPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGD------LGDKGVRGPQG 4374
            + G+ G   +G +G  GP   +G +G  G  G  G +GPQG  G  G+ + GV G  G P   GP G  G RGPKG +G  G S  +P   G QG  G+ GP G  G+ GP G+ G KG  G  G+ GD       GD G RGP+G
Sbjct:  785 VAGVPGCCISGAKGDEGP---SGIRGADGPPGLPGLKGPQGETGLPGLSIPGVTGVVGIPGIFGPVGAVGFRGPKGFQGRDG-SPGFPGIRGDQGSPGMTGPPGVDGNPGPPGLRGPKGLMGRNGVPGDEGKPGEPGDPGPRGPKG 926          

HSP 20 Score: 55.8398 bits (133), Expect = 6.209e-7
Identity = 130/423 (30.73%), Postives = 174/423 (41.13%), Query Frame = 1
Query:  352 FRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFK-------------GEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT--IDISGNV-TGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSG-LQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHK--------GLKGDKGVKG 1545
             +G KGD GPPG LG +G+EG+ G  G +G+ G   +QG +G                        KPG  G  GL+G  G  G P + G KGR G +G           E+G  G  G  G    I   G  G  G+KG+IG +G +GD G  G+              G +  P   ++   + G  G+KG +G               + G  G  GP G  G   + G KG++G  G+ G  GL G  G  G  G  G PGE G P                          +   G+ G  G  G +G T  +   G++  G  G  GEKG  G+ G +G  GD G +G  G +Q   G+ G  G       PG  G +G  G++G  G  G +GE+G          G KGDKGVKG
Sbjct:  344 VKGQKGDPGPPGLLGLRGSEGFYGFPGYQGLPGTP-IQGPNG------------------------KPGLPGFKGLKGDKGEPG-PDITGPKGRDGQRG-----------EQGPPGDPGLPGPSNVISRLGLKGLKGDKGLIGPEGLRGDPGNQGYVLLLLLILVLQDNLGIQANPANQVNSSSAVGIQGNKGSRGLKGPIGPAGPPGFSGLTGFPGPSGPKGEMGMKYEIGEKGFKGDTGAVGLLGLSGQDGLPGIPGFKGPPGEKGKP------------------------SALAPKGDQGYPGVGGEQGSTGPMGSQGSMGVGSPGAPGEKGNLGVVGRQGNLGDPGEKGSPGPVQTIPGDPGEPGLPGSPGLPGPPGNEGCAGVQGFPGLCGLKGEKGLSTPGDTGLTGPKGDKGVKG 705          

HSP 21 Score: 52.7582 bits (125), Expect = 5.225e-6
Identity = 94/318 (29.56%), Postives = 119/318 (37.42%), Query Frame = 1
Query:  274 CTECSCNGLLGPKGEMGFG---------------------GHEGKPGFRGVKGDRGPPGAL----------------------------------GEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQK---GAAGLQGYDGMQ---------GIPGMQGEKGRKGPKG-------FSLP----------QEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDK-----GYSFTTHLTRTTNEVMIKGQK 960
            CT    +GL G KGE G                       G  GKPG +G +G  GPPG                                    G+KG  G +G  GP G  GD+G  G                  + G++G CG  G K   G  G  G DG +         G+ G +G  G KGPKG       FS P          Q+G  P + GDKG +G  G KG+ G+ G  G  G+KGM+G QGD G+ G  G +G  GE         ++G  G KG +     G+ FT H   T       G K
Sbjct: 1175 CTMTGDSGLPGIKGEKGIKGTRGPPGPCGPPGPCGPSGEIGSPGKPGEKGQRGCSGPPGVCISGPKGERGPNGFPGPPGLQGPCGPPGDPGPGLKGDKGCVGPQGRVGPPGCTGDRGTPGEP-------IQSCDELSCFQGKDGDCGLRGPKGNIGPLGRVGPDGQKGQCGPVGPAGLKGCKGSPGTKGPKGCDYTVEIFSTPGDRGFRGKTGQKGE-PGDNGDKGLRGLKGTKGQKGDIGANGPDGSKGMLGLQGDSGEKGLKGARGLTGE-------VGAKGAPGAKGPQLRKRDGFLFTRHSQTTVIPECPAGSK 1477          

HSP 22 Score: 52.373 bits (124), Expect = 7.316e-6
Identity = 45/95 (47.37%), Postives = 55/95 (57.89%), Query Frame = 1
Query: 4066 GDAGKRGPQGPAGDQGI-GLLGVKGERGD----PGPDGYEGQRGPKGPKGDKGFSILYPG---PQGETGVKGPKGEVGSVGPTGIPGSKGEKGER 4326
            G+ G  GP+G  G QGI G  G KG+ G     PGP G +G+RGP G  G KG  +   G   P+G+TG  G +G  G +G  G PG KGEKGER
Sbjct:  189 GNIGPEGPKGNPGPQGIPGFPGEKGKEGRSMGIPGPSGQKGERGPPGIPGQKGIKLFASGPKEPKGDTGDSGDRGSPGIIGLRGRPGPKGEKGER 283          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col4a2 (collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-070725-3])

HSP 1 Score: 255.758 bits (652), Expect = 6.220e-68
Identity = 201/523 (38.43%), Postives = 259/523 (49.52%), Query Frame = 1
Query: 3994 SSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI-------GLLGVKGERGDPGPDGYEGQRGPKGPKGDKG----FSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNP---------GITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGE--TRG---------------NTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMT-MGHNIKTMQSEDLIAKCLVCMRN 5445
            ++ G  G  G +G TG+ G KGE G  G  GPQG  G   I       G  G+KG  G PG  G  G   P G KGD+G    F +      GE GV+G +GE GS G +G+ G KG+KGE G+ G  G +G +G +G  G +G  G  G  G  G +G                       +PG++G  G +G +G  G  GNP         G  GP G KG  G  G  G   F+GE                         G  GH G QGE  TRG               N G +   HSQS +IP CP    +LW GYS L   G E+AH  DL   GSCL  F+ +PF++C   + C+Y+ RND++YWLS+   + M M +  ++++ Y+SRC VCEAPS   A HSQ T  P CP GW +LW G SFLM+T  G  GGGQ L+SPGSCL  F+   F+EC  AKG C Y+     FWL + D  +SFQ +     +K  Q    I++C VCM+N
Sbjct: 1194 TTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLF-----GEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQK----------------LPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEP------------------------GSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGYLLVKHSQSEEIPMCPQGMSLLWMGYSLLYFEGQEKAHNQDLGLAGSCLPRFNTMPFLYCNPGDICYYASRNDKSYWLSTTQPIPM-MPVEESEIKPYISRCSVCEAPSVAIAVHSQDTTIPNCPVGWRSLWIGYSFLMHTAAGDEGGGQSLASPGSCLEDFRTTPFIECNGAKGTCHYFANKHSFWLTSID--ESFQSSPSSETLKAGQLLSRISRCQVCMKN 1668          

HSP 2 Score: 170.244 bits (430), Expect = 1.045e-41
Identity = 281/903 (31.12%), Postives = 367/903 (40.64%), Query Frame = 1
Query: 2053 RGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKG-----LAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGN---------------------KGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENG------LDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIG---EKGPKGFQGNIGERGNPGIKGYKGNSGFPDI--------------TLKGYKGIPGEIG---PKGF---QGLPGEKGFKGEIGPTG---TSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI----------GLLGVKGERGDPGPDGYEGQRGPKGPKGD------------KGFSIL---YPG---PQGETGVKGPKG------------EVGSVGPTG---------IPGSKGEKGE---------RGIEGDLGDKGVRGPQGLAGE 4386
            RGD G  G +G++G  G SGK G  G  G KGE G      +G  G  G+ G RGDTGL G      PG  G  G  G  G  G KGE G             G  GE+G  G  GT GFPG                      +G +GE GL G  G  G +G+ G  G  GN+G  G+ G        G  G +G+ G +G+ G  G  G+RG  GF G KG+IG+ G                                        G KG  G  G+ GD+G  G  GD  ++ I    ++  KG +G+ G  G+PG  G +G  GFP I               +KG KG+PGE G   PKG     GLPG +GF G  GP G   +SG  GR GD G +G+KG  G    I + G  G +G+ G  G  G+ G+ G  GE+G+ G  G++G+KG QG       P  DG++G  G  G +G+ G+ G  G  G+ G  G KGFPG K I G  G KG KG  G  G   +       G PG+ G +G+ G+ G+                                             S      G  G  G  G+ GNKG+ G RG+ G  G +G    KG  G+ G  G                                                ++GI G   + G  G   P G  G++G  G+FG  G++G QG  G++G           G  G  G  G PG  G++G RGP GPKGD            KG+  +    PG   P G+ G++GP G            + G VGP+G         IPGS G +GE         +G +G  G  G+ GP G+AG 
Sbjct:  695 RGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGD-----PGLPGYFGMEGMPGMTGLKGESGP-----------PGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPG--------------------------------------HQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGP--TISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNW-------GQPGNPGTKGELGETGIP--------------------------------------------STTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPG------------------------------------------------IKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGR 1442          

HSP 3 Score: 169.859 bits (429), Expect = 1.207e-41
Identity = 300/879 (34.13%), Postives = 373/879 (42.43%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKG----------FKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIG-----VTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITL-------------KGYKGIPGEIGPKGFQGL---PGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD---------------------GIKGMKGLIGPQGQKGESG----------------YKGVQGLAGD---KGPKGFPGKNIM-------------GSKGEKGNKGRIGEMGVKGFKGDIGP-IGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI-GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGE---TGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            + GD G  G  G PGE G  G+ G DG  G +G  G  G  GE G  G+SGP G  G  G  G PG+      G  G+ GD G+ G  G               G   ++ V      G  GE G+ G +G  GFPG  G KG  G SG       +G+ G+ GE G  G  G  G  G RG  G  G KGVKG  G+ G  G  G  G KG+ G      +G PGD                                 G  G +G TGL G+ G  G+ G+ G PG+  + GE GP G QG  G  G PG  G+ G +G+                  +G +G PG IG +G +G    PG  G  G IGP G  G  G  G  G  G KG +G +G+ G  G+ G +G KG +G +G IG+ G+QG KG  GS G KG +G  GP GD                     G  G  G  GP+G KG  G                 KGV+GL G+   +GPKG PG   +             G+KG  G  GR G+ G+KGFKGD+GP I LPGS G +G+ G  G  G K         G  G  G +G  G DG  G+ G +G  G  G    +  +G  G  G KG  G+ G  G  G+ GQ G +G  G KG  G +G+KG                                                 +G  G       GQ G  G  GE GE G            P+   G+ G LG KG  GD G  G  GQRG  GP+G +GFS +  G QG+    G+KG  G  G+ G  GIP   G KG+RG  GD G  G +G QG  GE+
Sbjct:  522 SAGDPGDPGHSGFPGEQGRPGIDGRDGEPGFRGPPG-EGPVGEPGAKGYSGPPGRSGLIGPKGNPGQVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSG------DLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDP--------------------------------GLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAK---------GLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQ------------------------------------------------KGNQGVPGTDNWGQPGNPGTKGELGETGI-----------PSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIK-GTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEK 1292          

HSP 4 Score: 169.859 bits (429), Expect = 1.516e-41
Identity = 289/944 (30.61%), Postives = 383/944 (40.57%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEK---------------------GLAGFSGPKGIKGERGDTGLPGKE---------------AEKIPGDKGI---QGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGL---------------------SGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGR------------QGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIG---EKGPKGFQGNIGERGNPGIKGYKGNSGFPDI--------------TLKGYKGIPGEI---GPKGF---QGLPGEKGFKGEIGP---TGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIM---GSKGEKGNKG-----RIGEMGVKGFKGDIGPIGLPG-SIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPA------GDQG-IGLLGVKGERGDPGPDGYEGQRGPKGPKGD------------KGFSIL---YP---GPQGETGVKGPKG------------EVGSVGPT------GIPGSKGEKGERGIEGDLGDKGVRGPQGLAGE 4386
            GD GP GE G PG    +GL G  G  G KG +G  GD G+K                     G  G+ G KG+KG  G +G PG +               +   PGD G+   +GD G  GD G  G  G        +T  KG++G  G++G QG  G PG  G  G+TG                       G PG  G  G  G  G+ GN+G  G  G  G +G             +G+ G +G+ G  G  G+RG  GF G KG+IG+ G                                        G KG  G  G+ GD+G  G  GD  ++ I    ++  KG +G+ G  G+PG  G +G  GFP I               +KG KG+PGE    GPKG     GLPG +GF G  GP    G+SG  GR GD G +G+KG  G    I + G  G +G+ G  G  G+ G+ G  GE+G+ G  G++G+KG QG       P  DG++G  G  G +G+ G+ G  G  G+ G  G KGFPG K I    G KG+KGN+G       G+ G  G KG++G  G+P  + G  G  G +G  GD                                                 G+KGEIG++G  G +G +G   + G  GD G  G KG  G  G +G                                                  GI   S  G +G RG  G+ G  GEKG  GD G++G  G +      GD+G  G++G  G R      G++G RGP GPKGD            KG+  +    P   GP G+ G++GP G            + G VGP+      G+PG  G  G RG  G +G  G++G QG  G 
Sbjct:  636 GDPGPPGESGLPGP---RGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPG--MTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPG--------------------------------------HQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGP--TISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDS------------------------------------------------GNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGT------------------------------------------------PGIP--SPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRR------GFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGR 1430          

HSP 5 Score: 154.836 bits (390), Expect = 5.118e-37
Identity = 200/535 (37.38%), Postives = 246/535 (45.98%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGD----KGEKGLAGFSGPKGIKGERGDTGLPGKE----AEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLL--TKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGK---VGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLV-GDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKG----------------------LKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQE 3519
            +G KG  G  GDPG  G +G +G  G  G +G+ G  G+    KG KGL G  G +G KG  G TGLPG E         G+KG  G  G  GD G KG KG       L   T  +G+ G  G  G++G  G PG +GS G  G+ G+ G  G+   VG  G DG +G  G +G  G  G  G+ G  GI+G  G +G  G +G  G  G KG  G  GVPG                                     G  G  G +GE G+ G      G PG  ++G KG  G  GN GE G  G+ G +G  GF DI  KG +G  G  G KG  G PG +G  G   P G  G RG  GD G  G KGVQG +G  G  GE G  G KGD GE G +G  G +G +G++G  G KG                      L G QGP G  GI+G  G  G  G  G  G  G  G +G KG  G PG  I GS G +G  G +G  G++G +G  G  G+PG +G  G+ 
Sbjct:  948 KGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTD---------------------------------NWGQPGNPGTKGELGETGIPSTTTGVPG--SLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDI--KGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPG--IPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRS 1443          

HSP 6 Score: 150.599 bits (379), Expect = 9.611e-36
Identity = 311/1035 (30.05%), Postives = 400/1035 (38.65%), Query Frame = 1
Query:  283 CSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNE---------------------------GYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQG------YDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEI------------------GEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGES---------GIHGDKGEK---GLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGE-------------LGDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPK---GFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGE 3144
              C G  GP GE G  G  G  GF GV G +G  G  G+ G++                           G KG +GP G+ G  G+ G SG          +     +G  G  G PG +G  GL G      Y GM+G+PGM G KG  GP G        L  E+G  G  G  G  G+                   G  GD GEPG  G  G +G  GD G +G  G  G P             GD+G+      T          +KG KG              G  G+ G+ G +G +G  G +G++G  G  G  G  GSPG+                            G+ GL G  G K   I I+ ++  V   +G KG+ G  GD G  G  G++G  G+ G  G+ G+ G    V             ++GL G+ G  G +G  G  G  G++G   M G KG KG +G  G  GD+G  G       KGD+G    S+PG+                             +      G  G+ G KG  G+PGERG  GL+G                                                    EG KG  GE G  G  G  GL+G  G  G KG S         GI G  G+K   GL G  G  G+KG++G+ G+PG +    PG+ G +G++GE             LG KG  G+ G    +    +   +G  G   +KG+QG  GFPG KG  G  G  G PG     G  G  G  G+ G  GE G+ G RG +G+ G  GV G +G KG+ G +GFPG +G  G  G                                        G KG TG  G  G  G +G    P  L  GE+GP    G QG  G  GNPG  G  G+SGF  +   G+KG+P      G  G+PG  GF+GE G  G SGL      QG QG +G  G  G +GM G 
Sbjct:  632 VECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASG----GKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPG--------LQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPP-------------GDQGE------TGGPGFFGLPGLKGSKG------------GQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQ---------------------------KGDRGLTGPPGDK-PVIHITPHMKEVM--KGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKG-----------VKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGF------KGDLGPT-ISLPGS-----------------------------TGLRGETGHPGSTGAKGLYGMPGERGSSGLDG---------------------------------------------------IEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRG--------------------------------------PFGPKGDTGPPGFPGLPGAKGYPPVPQKLP-GEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGF--VGPSGHKGMP------GLPGIPGSPGFRGEPGSMGHSGL------QGEQGTRGRPGMPGPLGMAGR 1442          

HSP 7 Score: 145.591 bits (366), Expect = 3.124e-34
Identity = 276/865 (31.91%), Postives = 368/865 (42.54%), Query Frame = 1
Query:  349 GFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMI--GDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGI------PGMQGEKGRKGPKG-FSLPQE---------------GVLPAERGDKGAKGF---SGLKGEIGEFGDVGEPGN---------------------------KGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRG------EIGDKGDKGYS------FTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKG----------AEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTG-----DAGEAGPIGEKGDIGDVG-----TSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKK------------GESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKG-----FKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGT---------------AGFPGNKGSKGETGLSGIP------GKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVK 2571
            G+ G KG +GPPG  G+ G +G  G +G  G +     G  G+ G+ G            + G+ G  G PG  G  G++G  GM G+      PG+QGE+GR GP G F  P +                     RGD+G  G     G+KG IG+ G++G  GN                           +GM G+ G  G+ G  GF G KGE    I L   +G        G KGD+G +         H+T    EVM KG KG  G  G  G  G  G KG+ G  G +G           +G+KG+ G+ G  G  G PG  G PG      I G  G  GP+G +G  G  G  G+SG+KG+KG  G TI + G+ TG+RG+ G  G  G  G  G+PG+   RG SGL G  G KG +G    V  PG  G +G  G +G  G++G  G+ G  G++G  G KG    G KG  G++GL G KG+ G     + G+ G  G KG++G+ G     T +PG+                        +G KG+      GD+GN+G+ G  G+PG +G  G +   G                                                T+GD G  G +G PG  G +G  G+    G K            GE G+ GD+GEKG +G SG  G KG++G+ G+ G      PG +G QGD G  G KG             +    +  K  G+ G  G  G QG                +GF G  G KG  GL GIP      G+ G +G+SG  GE+G  GR G  G  G  GR  N+G   VK
Sbjct:  699 GYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPG------------HRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGE----IGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVM-KGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPG------IEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGS-TGLRGETGHPGSTGAKGLYGMPGE---RGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFP--GLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGS------------------------LGHKGTT-----GDSGNKGEIGQRGVPGPQGQQGFSDIKG------------------------------------------------TQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMG-----FPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGYLLVK 1452          

HSP 8 Score: 139.043 bits (349), Expect = 3.146e-32
Identity = 309/928 (33.30%), Postives = 384/928 (41.38%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGN---------------KGSKGETG-----LSGIPGKHGKVGNSGK--------------DGEKGNMGRKG------------ENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKG---------FTGLRGESGDKGFEGLVGDPGILA--------------IGEKGPKG-----FQGNIGERGNPGI---KGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-------GIKGMKGLIGPQGQKGES--GYKGVQGLAGDKGPKGFPGK----------------------NIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGE-----KGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSS-NGERGQRGPQGNTGEKGEK------------GEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGP------------------KGPKGDKGFSILYPGPQGETGVK---GPKGEV---GSVGPTGIPGSKGEKGERGIEGDLGDKGV 4359
            +G KG  GE G+ G VG +G  G++G  G  G  G+ G  G  G  G +GP G  G RGD+G+PG          G++G  G  G  G KGEKG    V V + +++GD G  G  G  G  G PG                KG+KG+ G     L G+ G+ G++G  G                GEKG MG KG            E+G+ G  G +GN    G+ G  G +GD G  GFPG  G  G  G PG+ +  P  D G                     +                   G  G  G KG  G  G+PG  A              +G  GPKG     F+G+ G RG PG    KG KG+ G  + ++K   G PG  G  G  G+ GE G +G+ G  GT G  G  G  G +G  G +G+KG +    + GS GD GD G  G  G QG  G  G  G  G +G  G +GP G+       G  G  GLIGP+G  G+     KG+ GL GD G  G  G+                        +G  G  G  G  G  G++GF G  GP    G+ GF G        GDKG  G PG  G  GP G+ GPRG  G PG  G KG  G SG    +   G KGE GE      G  G+ G  G+RG +G  GD G  GY G  G  GM G                                                L+G SG     GE+G+ GP G  G  G+             GE G +G+RG QG  G   IG  GVKG  GDPG  G  G  GP                  KG KG +G +  +PG  GE G+K   G KGE+   G  G  G PGS G+KG+RG+ G  GDK V
Sbjct:   81 QGPKGMKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGF--------PGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPGIVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGVSGFAGARGN---PGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGFPGEQGRPGIDGRDGEPGFRGPPG-EGPVGEPGAKGYSGPPGRSGLIGPKGNPGQVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPK---GTAGFSGD------LGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTG------------------------------------------------LKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGL--IGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTG-FPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPV 936          

HSP 9 Score: 130.568 bits (327), Expect = 1.386e-29
Identity = 302/948 (31.86%), Postives = 377/948 (39.77%), Query Frame = 1
Query: 2158 LAGFSGPKGIKGERGDTGLPGKEAEK--------------IPGDKGI--------QGDVGELGDKGFKGEKGKNQNVNVLLTK---------------------YKGDNGEKGVKGSQGTAGFPGN------KGSKGET------GLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDI-----GVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGER------------GNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEI-----GPTGTSGLRGRKGDQGPQ------GYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGE---------------------KGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGP----------KGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGE------KGEKGEFG-------DAGKRGPQGPAGDQGI-GLLGVKGERGDPGPD------GYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQ 4593
            L G  GP+G KG  G+TG PG  A +               PG KG          G  G  G  G KG KG +      +                        +GD G+ G KG+ G  GFPG       KG KGE       G +G PG  G  G  G+ G  G  GR GE G  G  G +G +G  G KG  G  G  G IG  G  G +     G++G+PGD   G  G  G  G  G  G+   +G          +GD G  G  G  G +G EG  G P     G KG  GF G++G++            G  G  G +G+ G+P    KG KG PG  G  G  G  G KG  GE+     G  G  GL G +GD G        GY G++G  G+ G+ GE G  G +G+ G  G  G  G+ G+                     +G+QG  GL G +G +G  GD G  G+ G IGP G +GE+G  G  GL G KG K        G +G  G  G+ GE G+KGF G  G IGLPG  G +G  G  G KGD+                             P     V       KE  +G KG+ G  G+ G  G +G +G  G  G EG           KG KG  GE G++G                                        +G+ G  GL GI G    +G +G +G  G  G       KG KG+ G         G RG  G  G  G  GL G+ GERG  G D      GY+G+ G  GP G  G    +PG QG  G  G  G+ G+ G  G PG KG  G +GI G  G KG +G QG+ G               D   +       G        S    +PG  G KG  G  G+KGE G  G+ GPQ
Sbjct:  376 LWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGFPGEQGRPGIDGRDGEPGFRGPPG-EGPVGEPGAKGYSGPPGRSGLIGPKGNPGQVLGATKGLSGLPGDD--GQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVP-----GPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGT--KGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSK--------GGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDR-------------------------GLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGP---------------------------------------KGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQG-FPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGT--------------DNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQ 1226          

HSP 10 Score: 126.716 bits (317), Expect = 1.672e-28
Identity = 297/1001 (29.67%), Postives = 384/1001 (38.36%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLR---GLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGD---------KGIQGDVGELGDKGFK--GEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKG---------------------ETGLSGIPGKHGKVGNSGKDGEKGNMG--------------------RKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDI------GVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGF-----EGLVGDPGILAIGEKGPKGFQGNIGERGNPG--IKGYKGNSGFP-------------------DITLKG--YKGIP----GEIGPKGFQGLPGEK---GFKGEIGPTGTSGLRGRKGD---------------------QGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD----GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPK---GFPGKN----------------IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSN-GERGQRGPQGNTGEKGEKGEFGDAGKRG-PQGPAGDQGI-GLLGVKGERGDPGPDGY---EGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGP 4590
            +G+KG  G +GD G++G    +   G+ G++G +G  G+ G  G +G  G  G  G  G +GD G PG E    P D          G +G VG  G KG K                +  G  G +G KG+ G  G PGN  ++                      E    G PG  G+ G++GK G KG+ G                      G  G  G++G QG+ G KG  GL G  G  G  G  G KG++      G  G PGD                              G  G  G++G  G+ G  G+ GF     EG VG+PG  A G  GP G  G IG +GNPG  +   KG SG P                   D + +G     IP    G+ GP G  GLPG +   GF G  GP GT+G  G  GD                     +G  GY G +G KG  G+ G+ G  G  G  GE G +    +    G  G  GL G +G+ G  GD    G  GM+G+ G  G KGESG  G+QG  G  GP    GFPG+                   G +G++G  G IG  GVKG  GD G IG+ G+IG  G +G+ G  G                                   G  G  G    +   G  G+ GE+G  G  G KG  GL G  G +G  G  GQ G+ G+ G                                                ++G  G   N G+ G  GP+G  G  G  G  G  G  G P    G +G+ G  G++G +G PGP G    EG  G  GPKG+KG S  Y G  G++G+KG KG++G      +PGS G +GE G  G  G KG+ G                                               +PG++G  GL G EG KG +G PG  GP
Sbjct:  258 QGEKGKMGSKGDKGDLGYLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPG-ELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDP-----------------------------GHSGFPGEQGRPGIDGRDGEPGFRGPPGEGPVGEPG--AKGYSGPPGRSGLIGPKGNPGQVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEV----FGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFF---------------------------------GLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGP-------------------------------PGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAY-GRPGDSGIKGFKGDLGPT--ISLPGSTGLRGETGHPGSTGAKGLYG-----------------------------------------------MPGERGSSGLDGIEGMKGYQGEPGTVGP 1108          

HSP 11 Score: 108.997 bits (271), Expect = 4.468e-23
Identity = 187/563 (33.21%), Postives = 251/563 (44.58%), Query Frame = 1
Query: 2077 EQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKE----AEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGE---KGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFI--GFPGEKGDIGVTGVPGD-SITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI----GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLK--------------GYKGIPGE----------------IGPKGFQGLPGEKGFKGEIGPTGTSGLRGRK-------GDQGPQG-----YKGVQGQKGIIGMIGEMGSQGDKG--------------DTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKG---ESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            E+G RGL G  G +G +G  G +GE GL    GPKG+KGE G+ G  G +     E +PG  G  G  G  G  G +G+ G +          +GD+G     G++G QGT G+PG KG KG+     +  +  + G+ G  G  G +G  G+ G  G  G QG  G +G+KG +G KG+R  I  G  GE G+IG  G PG  S T P+          +  +                GD G+   + ESG  GF G  G+PG+       G+ G  GF GN G +G+ G  G    S F D  +               G KG  G+                 GP+G +G  G  G  GE G   T              G  GP+G     +KG  G +G  G  G+ G +GD G                G+ G  G+ G  G++G+QG  G KG  G       G  G +GL GP+G+KG   E+  KG  G  GD G  GFPG+     +G  G  GR GE G +G  G+ GP+G PG+ G+ G  G+ GL G K
Sbjct:   53 EKGARGLPGPLGPQGPTGPKGRQGEPGL---QGPKGMKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDG-----CNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFR-GDPGPAGFPGIVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDK-------------GDLGYLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGL-----PGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGFPGE-----QGRPGIDGRDGEPGFRGPPGE-GPVGEPGAKGYSGPPGRSGLIGPK 582          

HSP 12 Score: 108.227 bits (269), Expect = 8.773e-23
Identity = 152/435 (34.94%), Postives = 195/435 (44.83%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIP----GKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVT---GVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGES------------GDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKG------------------FQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEK 3219
            G  G  G  G PGE G  GL G++G  G +GE G  G  G  GL GF G +G KG  GD           PG  G  G  G+ G KGF G KG        L   KG  G +GV G+    G PGN G+KGE G +GIP    G  G +G+ G  G+ GN G  G+ G+ G +G+QG   IKG +G  G  G +G  GFPG +G  G+    G  GD                           G  G+ G  G+KG  G RGE             GDKG  G++G PG     G++GP G +G+ G  G PG+ G KG    P   L G +G PG++G +G                  F G  G KG  G  G  G+ G RG  G  G   + G+QG++G  G  G  G  G  G +   G + ++  Q E+
Sbjct: 1071 GSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGD-----------PGQTGTTGIQGQPGQKGFPGLKGI-----FGLDGLKGQKGNQGVPGTD-NWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDR--------------------------GNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQ-KLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMG---HSGLQGEQGTRGRPGMPGPLGMAGRSVNVGYLLVKHSQSEE 1458          

HSP 13 Score: 105.531 bits (262), Expect = 5.802e-22
Identity = 189/546 (34.62%), Postives = 237/546 (43.41%), Query Frame = 1
Query:  193 LIVAVFWIIISLVQDSESAAAICNRSNCTE-CSC---------NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAE--RGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMIS-LDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXX-XXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVR--GDRGEKGEKGIDGDRGIPGD------------------------------EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-IPGAQ 1689
            LI+ V  +  +     + +   C   +C+  C C          G LGP+G  G  G +G+PG +G KG          KG  G  G  GPKG +G +GV G +G +G  G PG  G +G  G +GC G  G  G  G  G +G QG PG  G KG KG      P E  +  E  RGD G  GF G+       G  G+PG +G+ G+QG  G  G  G KG+KGE  K++  +    GEIG+ G  G  F+      ++    KG+ G +G  G  G +      G  G AG++G  GL G  G  G  G  G PG NG  G  G  G            G  GP G+ G  GN G KG KG  G           V   G  G +G KG  G+ G PG+                              +GS G  G  G  G+KG KG   G+ E   K P G  G  G  G  G  GE G +G +GD G KG +  G  G  G  GL GPKG  G+  EA   G  GD GD G S  PG Q
Sbjct:   17 LIITVVILTSTTFSGVKKSTGPCGGRDCSGGCQCYPEKGARGLPGPLGPQGPTGPKGRQGEPGLQGPKG---------MKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKG-----DPLEVWVYMERFRGDPGPAGFPGI------VGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGV-FSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKG-DHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGAN--GLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGFPGEQ 538          

HSP 14 Score: 98.9821 bits (245), Expect = 4.814e-20
Identity = 161/497 (32.39%), Postives = 213/497 (42.86%), Query Frame = 1
Query:  280 ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMI-----------GDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDG----MQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGS---KGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDG--DRGIPGDEGSRGD----------SGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMI----GTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG 1668
            E    G  G KGE+G  GH+G          +G PG+ G+KG+ G  G  G K +I           G KG  GN G              G+TG  G  G PG  G  G  G+ G    ++G+ G+ GE G +GPKG        +P   G  G +GF G+ G           GNKG  G  G  GD G  GFKG+ G     ISL  S G  G+ G  G +    L     E    G  GI             G KGY+G  G+    G++GL+G  G  G  G+ G PG+ G+                            G  G  G KG+ GLKG        + G+ G +G+KG +G+ G  + G PG+ G++G+          +G+ G +G KG  G S         G KGE G RG+ G  G++G    KG +GD G  G+  I    GT+G  G+    G KGD G+ G+ G  GEKG  GD G
Sbjct:  891 ERGLKGFSGTKGEIGLPGHQGA---------KGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMG------------DPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKG--------MPGPTGLPGIEGFPGMSGPK---------GNKGSSGAYGRPGDSGIKGFKGDLG---PTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIE------------GMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGT---------------------------TGIQGQPGQKGFPGLKG--------IFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDS---------GNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRG 1290          

HSP 15 Score: 84.7297 bits (208), Expect = 1.179e-15
Identity = 97/280 (34.64%), Postives = 139/280 (49.64%), Query Frame = 1
Query: 2764 LGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGE------IGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGN--QGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIG-----------FQGQEGQRGLKGDK 3546
            L    F+G++  +G  G     G  G     EKG +G  G +G +G  G KG +G  G     L+G KG+ GE      +GPKG  G+ G  GF G  G  G  G  G +G  GP G  G +G  G+ G  G  G Q         G+ G  G +GEKG+  +  + ++  +G+ GPA     G  G++GP    G+ GY+G+ G  G  GP+G     + G+KG+KG + +I    +KG KG++G IG PG  G           +QG++G+ G KGDK
Sbjct:   24 LTSTTFSGVKKSTGPCGGRDCSG--GCQCYPEKGARGLPGPLGPQGPTGPKGRQGEPG-----LQGPKGMKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGFPGLEGGQ---------GTPGWPGMKGEKGDPLEVWVYMERFRGDPGPA-----GFPGIVGP---TGDPGYRGLPGFQGPWGPQG-----LKGAKGQKGERTKI----LKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDK 270          

HSP 16 Score: 80.4925 bits (197), Expect = 1.951e-14
Identity = 143/421 (33.97%), Postives = 191/421 (45.37%), Query Frame = 1
Query:  286 SCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLP----------QEGV------LPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRG------EIGDKGDKGYSFTTHLTRTTNEVMIKGQKGI---RXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGK----------------------PGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNK 1407
            S  G  G +GE G  G  G  G  G+ G+RG  G  G +G +GY+G+ G  G  G  G+QG  G     G  G  G  G TG  G  G+PGQKG  GL+G  G+ G+ G +G +G  G   +  P          + G+      +P   G KG  G SG KGEIG+    G PG +G  G+   KG  G+ GF G KG P        +RG        G KGD+G            +  + G+KG+   RG  G  G+ G +G KG +G  G  G  G +G +GD GP G  G                       PGE G PG+ GI G  G+ G PGP G  G  G +G +G+ G+ G              + G+ G  G +GE G  G  G+ G++G+RG  G+ GP+G  G  
Sbjct: 1056 SLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQ---GHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQ---RGVPGPQGQQGFSDIKGTQGDYGFPGIKGIP----GFPGTRGTPGIPSPFGAKGDRG---------NVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPG--------------LPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRS 1443          

HSP 17 Score: 73.1738 bits (178), Expect = 4.142e-12
Identity = 61/158 (38.61%), Postives = 83/158 (52.53%), Query Frame = 1
Query: 2020 RTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKG--LAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGE 2487
            R  GD GP+G  G  G  G+ G RGL G+ G  G  G+ G KG+KG       G KG  GE G+ G PG  ++  P     QG+ G++G KG KG+ G            K ++G  G  G++G  G  G  G +G+TGL G PG +G+ G+ G+ GE
Sbjct:  177 RFRGDPGPAGFPGIVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLG--------YLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGE 326          

HSP 18 Score: 53.9138 bits (128), Expect = 2.944e-6
Identity = 59/159 (37.11%), Postives = 77/159 (48.43%), Query Frame = 1
Query: 4000 NGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI-GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSIL--------------YPGPQGETGVK--------------GPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
             G +G++G  G  G KG KGE G+AG  GP+G  G +G+ G  G  G  G PGP G  G+ GP G  G +G S +              +PG +GE G                GP G  G VGPTG PG +G     G +G  G +G++G +G  GER
Sbjct:   69 TGPKGRQGEPGLQGPKGMKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPGIVGPTGDPGYRGLP---GFQGPWGPQGLKGAKGQKGER 224          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col4a2 (collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-070725-3])

HSP 1 Score: 241.891 bits (616), Expect = 1.170e-64
Identity = 105/227 (46.26%), Postives = 139/227 (61.23%), Query Frame = 1
Query: 4771 NTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMT-MGHNIKTMQSEDLIAKCLVCMRN 5445
            N G +   HSQS +IP CP    +LW GYS L   G E+AH  DL   GSCL  F+ +PF++C   + C+Y+ RND++YWLS+   + M M +  ++++ Y+SRC VCEAPS   A HSQ T  P CP GW +LW G SFLM+T  G  GGGQ L+SPGSCL  F+   F+EC  AKG C Y+     FWL + D  +SFQ +     +K  Q    I++C VCM+N
Sbjct:  813 NVGYLLVKHSQSEEIPMCPQGMSLLWMGYSLLYFEGQEKAHNQDLGLAGSCLPRFNTMPFLYCNPGDICYYASRNDKSYWLSTTQPIPM-MPVEESEIKPYISRCSVCEAPSVAIAVHSQDTTIPNCPVGWRSLWIGYSFLMHTAAGDEGGGQSLASPGSCLEDFRTTPFIECNGAKGTCHYFANKHSFWLTSID--ESFQSSPSSETLKAGQLLSRISRCQVCMKN 1036          

HSP 2 Score: 169.088 bits (427), Expect = 1.235e-41
Identity = 278/900 (30.89%), Postives = 361/900 (40.11%), Query Frame = 1
Query: 2053 RGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKG-----LAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGN---------------------KGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENG------LDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIG---EKGPKGFQGNIGERGNPGIKGYKGNSGFPDI--------------TLKGYKGIPGEIG---PKGF---QGLPGEKGFKGEIGPT-------GTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI----------GLLGVKGERGDPGPDGYEGQRGPKGPKGD------------KGFSILYPGPQGETGVKGPKGEVGSVGPTG---------------------------IPGS---KGEKGERGIEGDLGDKGVRGPQGLAG 4383
            RGD G  G +G++G  G SGK G  G  G KGE G      +G  G  G+ G RGDTGL G      PG  G  G  G  G  G KGE G             G  GE+G  G  GT GFPG                      +G +GE GL G  G  G +G+ G  G  GN+G  G+ G        G  G +G+ G +G+ G  G  G+RG  GF G KG+IG+ G                                        G KG  G  G+ GD+G  G  GD  ++ I    ++  KG +G+ G  G+PG  G +G  GFP I               +KG KG+PGE G   PKG     GLPG +GF G  GP        G+SG  GR GD G +G+KG  G    I + G  G +G+ G  G  G+ G+ G  GE+G+ G  G++G+KG QG       P  DG++G  G  G +G+ G+ G  G  G+ G  G KGFPG K I G  G KG KG  G  G   +       G PG+ G +G+ G+ G+                                             S      G  G  G  G+ GNKG+ G RG+ G  G +G    KG  G+ G  G                                                ++GI G   + G  G   P G  G++G  G+FG  G++G QG  G++G           G  G  G  G PG  G++G RGP GPKGD            KG+    P PQ   G +GP G++G  GP+G                           IPGS   +GE G  G  G  G++G RG  G+ G
Sbjct:   62 RGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGD-----PGLPGYFGMEGMPGMTGLKGESGP-----------PGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPG--------------------------------------HQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGP--TISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNW-------GQPGNPGTKGELGETGIP--------------------------------------------STTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPG------------------------------------------------IKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYP---PVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPG 803          

HSP 3 Score: 167.933 bits (424), Expect = 2.313e-41
Identity = 287/948 (30.27%), Postives = 379/948 (39.98%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEK---------------------GLAGFSGPKGIKGERGDTGLPGKE---------------AEKIPGDKGI---QGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGL---------------------SGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGR------------QGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIG---EKGPKGFQGNIGERGNPGIKGYKGNSGFPDI--------------TLKGYKGIPGEI---GPKGF---QGLPGEKGFKGEIGP-------TGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIM---GSKGEKGNKG-----RIGEMGVKGFKGDIGPIGLPG-SIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPA------GDQG-IGLLGVKGERGDPGPDGYEGQRGPKGPKGD------------KGFSILYPGPQGETGVKGPKGEVGSVGPT------------------------GIPGSKGEKGERGIEGDLGDKGVRGPQGLAGE 4386
            GD GP GE G PG    +GL G  G  G KG +G  GD G+K                     G  G+ G KG+KG  G +G PG +               +   PGD G+   +GD G  GD G  G  G        +T  KG++G  G++G QG  G PG  G  G+TG                       G PG  G  G  G  G+ GN+G  G  G  G +G             +G+ G +G+ G  G  G+RG  GF G KG+IG+ G                                        G KG  G  G+ GD+G  G  GD  ++ I    ++  KG +G+ G  G+PG  G +G  GFP I               +KG KG+PGE    GPKG     GLPG +GF G  GP        G+SG  GR GD G +G+KG  G    I + G  G +G+ G  G  G+ G+ G  GE+G+ G  G++G+KG QG       P  DG++G  G  G +G+ G+ G  G  G+ G  G KGFPG K I    G KG+KGN+G       G+ G  G KG++G  G+P  + G  G  G +G  GD                                                 G+KGEIG++G  G +G +G   + G  GD G  G KG  G  G +G                                                  GI   S  G +G RG  G+ G  GEKG  GD G++G  G +      GD+G  G++G  G R      G++G RGP GPKGD            KG+    P PQ   G +GP G++G  GP+                        G+PG  G  G RG  G +G  G++G QG  G 
Sbjct:    3 GDPGPPGESGLPGP---RGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPG--MTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPG--------------------------------------HQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGP--TISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDS------------------------------------------------GNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGT------------------------------------------------PGIP--SPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRR------GFQGDRGPFGPKGDTGPPGFPGLPGAKGYP---PVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGR 798          

HSP 4 Score: 164.851 bits (416), Expect = 2.200e-40
Identity = 205/541 (37.89%), Postives = 262/541 (48.43%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDG-----YSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK-IPGDKGIQGDVGELGDKGFKGEK-------GKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKV------GNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGF---EGLVGDPGILAI--------GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGV---QGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGD 3543
            T+G KGP G  G PG  G  G +G  G      SG  G+ G+ G +G+ GL G  G  G  G  G  G+ G + E   PG +G QG  G  G  GF G+                  +  +GD GE G+ G++G  G  G+ G+ G TG  G PG  G+       G  G  G KG  G  G  G  G RG +G  G KG  GL G +G +G  G PG+KGD G+TG PGD                 I     +   G KG+ G +GD GFTG RG  G  G    EG  G PG  ++        GE G +G +G  G  G PGI+G+ G SG P +  +G KG  G  G  G  G+   KGFKG++GPT +  L G  G +G  G+ G  G KG+ GM GE GS G  G  G +G  G  G  G  G+ G  G  G +G++G +GD G  G  G+ G  GQKG  G KG+    GL G KG +G PG +  G  G  G KG +GE G+          G+PGS+G +G  G  G KG+
Sbjct:   70 TKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPV------------IHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSG-PKLIFQGNKGSSGAYGRPGDSGI---KGFKGDLGPTIS--LPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTT-----TGVPGSLGHKGTTGDSGNKGE 587          

HSP 5 Score: 160.999 bits (406), Expect = 3.260e-39
Identity = 288/849 (33.92%), Postives = 381/849 (44.88%), Query Frame = 1
Query: 2137 GDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKV--GNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKG---DIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD--------GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGP-IGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQG--------NTGEKGEKGEFGDAGKRGPQGPAGDQGI-GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGE---TGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDK---GLLGSEGDKGEKGNPGITGPQ 4593
            GD G  G +G  GP+G++G       PG     +PG KG  G  G+LGDK         +        + G  G+ G  G++G  G PG  G  G  G SG  G+HG+V   +SG  G+ G  G +G+ GL G  G  G  G++G+ G+ G+KG+ G  G  GE+G     G  G PG +                 G  G  G+IG  G  G+ GD+G  GL G    +G +G +GDPG + + G  GP G QG  G  G  G+ G KG+ G   +T  G+ G  GE G KGF G  GE G  G  G  G  G  G+KGD+G     G  G K +I +   M  +  KG  G+ G++G  G+ G +G +G  G+ G +G  G  G+        G+ G  GL GP+G  G +G  G++G  G  GPK        G+KG  G  GR G+ G+KGFKGD+GP I LPGS G +G+ G  G  G KG  G PG  G+ G DG +G +G                      + E G  G  G  G  G  G +G++G SG  G  G  G +GQ G+ G  G                                                L+GI G   +G +GQ+G QG          G  G KGE G+ G      P+   G+ G LG KG  GD G  G  GQRG  GP+G +GFS +  G QG+    G+KG  G  G+ G  GIP   G KG+RG  GD G  G +G QG  GE+G  G  G  G                                 KGDK   G++G  G +G +G+ G  GP+
Sbjct:    3 GDPGPPGESGLPGPRGLEG------FPG-----VPGPKGTAGFSGDLGDK--GERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGY--------------TGPPGPPGNIGEPGPSGRRGDQGEPGLIGA---RGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMT--GFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRG---LTGPPGDKPVIHITPHM-KEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLI----FQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGY---------------------QGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPG------------------------------------------------LKGIFGL--DGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGI-----PSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIK-GTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGR--------------------------------KGDKGEPGMMGFPGRRGFQGDRGPFGPK 702          

HSP 6 Score: 151.369 bits (381), Expect = 3.143e-36
Identity = 198/539 (36.73%), Postives = 245/539 (45.45%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGD----KGEKGLAGFSGPKGIKGERGDTGLPGKEAEK--------IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLL--TKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGK---VGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLV-GDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKG----------------------LKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQE 3519
            +G KG  G  GDPG  G +G +G  G  G +G+ G  G+    KG KGL G  G +G KG  G TGLPG E             G+KG  G  G  GD G KG KG       L   T  +G+ G  G  G++G  G PG +GS G  G+ G+ G  G+   VG  G DG +G  G +G  G  G  G+ G  GI+G  G +G  G +G  G  G KG  G  GVPG                                     G  G  G +GE G+ G      G PG  ++G KG  G  GN GE G  G+ G +G  GF DI  KG +G  G  G KG  G PG +G  G   P G  G RG  GD G  G KGVQG +G  G  GE G  G KGD GE G +G  G +G +G++G  G KG                      L G QGP G       G+ GP G+ G  G  G  G +G  G KG PG   I GS G +G  G +G  G++G +G  G  G+PG +G  G+ 
Sbjct:  315 KGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTD---------------------------------NWGQPGNPGTKGELGETGIPSTTTGVPG--SLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDI--KGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQ-----MGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRS 811          

HSP 7 Score: 142.895 bits (359), Expect = 1.357e-33
Identity = 270/862 (31.32%), Postives = 362/862 (42.00%), Query Frame = 1
Query:  349 GFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMI--GDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGI------PGMQGEKGRKGPKG-FSLPQE---------------GVLPAERGDKGAKGF---SGLKGEIGEFGDVGEPGN---------------------------KGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRG------EIGDKGDKGYS------FTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKG----------AEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGD-----TGDAGEAGPIGEKGDIGDVG-----TSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKK------------GESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKG-----FKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAG------------FPGNKGSKGETGLSGIP------GKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVK 2571
            G+ G KG +GPPG  G+ G +G  G +G  G +     G  G+ G+ G            + G+ G  G PG  G  G++G  GM G+      PG+QGE+GR GP G F  P +                     RGD+G  G     G+KG IG+ G++G  GN                           +GM G+ G  G+ G  GF G KGE    I L   +G        G KGD+G +         H+T    EVM KG KG  G  G  G  G  G KG+ G  G +G           +G+KG+ G+ G  G  G PG  G PG                +G +G  G  G  G+SG+KG+KG  G TI + G+ TG+RG+ G  G  G  G  G+PG+   RG SGL G  G KG +G    V  PG  G +G  G +G  G++G  G+ G  G++G  G KG    G KG  G++GL G KG+     T + G+ G  G KG++G+ G     T +PG+                        +G KG+      GD+GN+G+ G  G+PG +G  G +   G                                                T+GD G  G +G PG  G +G  G+    G K            GE G+ GD+GEKG +G SG  G KG++G+ G+ G      PG +G QGD G  G KG             +    +  K  G+ G  G  G QG +G              G  G KG  GL GIP      G+ G +G+SG  GE+G  GR G  G  G  GR  N+G   VK
Sbjct:   66 GYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPG------------HRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGE----IGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVM-KGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPG--IEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGS-TGLRGETGHPGSTGAKGLYGMPGE---RGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFP--GLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGS------------------------LGHKGTT-----GDSGNKGEIGQRGVPGPQGQQGFSDIKG------------------------------------------------TQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMG-----FPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGYLLVK 820          

HSP 8 Score: 124.79 bits (312), Expect = 5.588e-28
Identity = 296/977 (30.30%), Postives = 385/977 (39.41%), Query Frame = 1
Query:  289 CNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNE---------------------------GYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQG------YDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEI------------------GEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG--TSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGP--------KGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKG-KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMG---------------RKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIG----------------FPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSG 2937
            C G  GP GE G  G  G  GF GV G +G  G  G+ G++                           G KG +GP G+ G  G+ G SG          +     +G  G  G PG +G  GL G      Y GM+G+PGM G KG  GP G        L  E+G  G  G  G  G+                   G  GD GEPG  G  G +G  GD G +G  G  G P             GD+G+      T          +KG KG              G  G+ G+ G +G +G  G +G++G  G  G  G  GSPG+                            G+ GL G  G K   I I+ ++  V   +G KG+ G  GD G  G  G++G  G+ G  G+ G+ G    V              +G+ G  G+ G +G KG+ G  G+ G++   G  G K +    G KG +G  G  G  G KG  GD+G   S+PG+ G +G  G PG  G +G+ G     GE+GS  +  DG  G +G +G PG  G  G DGL G  G                                                ++G KG SG+ G  G  G QG  G  G+ G KG  G+ G KG+KG  G  G          G KGE G+TG+P      +PG  G +G  G+ G+KG  G++G          +  KG  G+ G  G +G  GFPG +G+ G     G  G  G VG+ G  GEKG  G               RKG+ G  G  G  G  G +G +G  G KGD G  G                 PGE+G  G  G+ G S                 G  G+ G  G  G+ G  G KG  GL G  G  GF    G+PG +     G  G QG  G RG PG+ G  G +G
Sbjct:    1 CIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASG----GKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPG--------LQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPP-------------GDQGE------TGGPGFFGLPGLKGSKG------------GQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQ---------------------------KGDRGLTGPPGDK-PVIHITPHMKEVM--KGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVV--------------KGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLI--FQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYG---MPGERGS--SGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPG------------------------------------------------SQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIP-STTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPS-----------------GRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFR---GEPGSM-----GHSGLQGEQGTRGRPGMPGPLGMAG 809          

HSP 9 Score: 86.6557 bits (213), Expect = 2.361e-16
Identity = 195/596 (32.72%), Postives = 248/596 (41.61%), Query Frame = 1
Query:  280 ECSCNGLLGPKGEMGFGGHEGK---PGFRGVKGDRGPPGALGEKG--------NEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGE----EGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPA--ERGDKGAKGF-------------SGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP--VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIG--KHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGL---------KGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDA----------------------GEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXX----XXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDG 1860
            E    G  G KGE+G  GH+G    PG  G KGDRG  G  G+K          E  KG +G  G +GD G  G  G  G  G PG +G  G+ GE    +G  G PG+ G  G +G  G  G+PG++G  G  GPK      +G   A    GD G KGF             +GL+GE G  G  G  G  GM G +G  G  G  G KG +GEP  V     D  +G  G +G KG S     T TT    I+GQ G                KG+ G  G  G +GLKG +G+ G  G    G+PG  G+  K  +          G  G  G +G  G +GN G  G +G+ G          G    +G +G+ G  G +GIPG  G+RG  G+  P G KG++G                    GL G+ G +G++G KG          KGDKG  GM  +G  GR+G  G  GP G  GD                       GE GP G+ G  G  G +             P G              GF GE GS  +   G  G +G +G PG+PG  G+ G
Sbjct:  258 ERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTG---IQGQPG---------------QKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGT--KGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQ-----GQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDF---------------GLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGM--MGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGH--SGLQGEQGTRGRPGMPGPLGMAG 809          

HSP 10 Score: 76.2554 bits (186), Expect = 3.260e-13
Identity = 148/423 (34.99%), Postives = 189/423 (44.68%), Query Frame = 1
Query:  283 CSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGI-----------------PGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGE------IGDKGDKGYSFTTHLTRTTNEVMIKGQKGI---RXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGK----------------------PGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNK 1407
             S  G  G +GE G  G  G  G  G+ G+RG  G  G +G +GY+G+ G  G  G  G+QG  G  G KG  G  G    TG  G  G+PGQKG  GL+G  G+ G+                 PG  G KG  G  G      GV P   G KG  G SG KGEIG+    G PG +G  G+   KG  G+ GF G KG P        +RG        G KGD+G            +  + G+KG+   RG  G  G+ G +G KG +G  G  G  G +G +GD GP G  G                       PGE G PG+ GI G  G+ G PGP G           G+SG  G+KG+ G        + G+ G  G +GE G  G  G+ G++G+RG  G+ GP+G  G  
Sbjct:  426 ISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQ---TGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGV-PGSLGHKGTTGDSGNKGEIGQ---RGVPGPQGQQGFSDIKGTQGDYGFPGIKGIP----GFPGTRGTPGIPSPFGAKGDRG---------NVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAG---------PPGDSGPSGHKGMPG--------LPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRS 811          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 415.231 bits (1066), Expect = 2.315e-118
Identity = 440/1285 (34.24%), Postives = 557/1285 (43.35%), Query Frame = 1
Query: 2020 RTEGDKGPSGERGDPGEVGEQGLRGLDG---YSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKG---IQGDVGELGDKGFKGEKGK--------NQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGI--PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGL--------------------------EGVKGDRGFIGFPGE---KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERG---------NPGIKGYKGNSGFPDIT-LKGYKGIPGEIGPKGFQGLPG---EKGFKGEIGPTGTSGLRGRKGDQGPQGY------------------KGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKG---------VQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQ-----RGPQGNTGEKGEKGEFGDAGKRGPQGPAG------DQG------------------IGLLGVKGERGDPGPDGYEGQRGP------------KGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGE------------KGERGI---EGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRN 5445
            R +GDKG SG  G PG  G +G  G+DG     G KG +G  G KGE+GL G  G  G  GERG  G  G     +PG+KG   + G VG  G  G KGE GK               +  + GD GEKG   S G  G PG++G KGE GL G+  PG  G+ G  G  G  G  G  G  G+DG  G +G+ G KG  GL                           GV G++GF G PG    KG+ G+ GVPG                           +G KG++G  G +G +G  G +G KG  G  G PG+      GPKG +GNIG  G          PG  G +G  GFP      G  G+PG IG  G  G PG   EKG  G  GP G SG  G KG++G +G                   KG +G++G IG+ GE GS GD G  G  G  G QG QGE G +G  G +G+KG+QG  G  G  G  GL GP G+KG+ G  G         ++G  G KG  G PG  I G  G KG+ GR G  G+ G +GD G +G+PG  GF G +G  G  G                                                  G  GE G KG  G  G  G +GL+G  G +GP G+ G+ GE G                                                     GI G  S GE+G+     RG  G+ GE GEKG  GD G  G  G +G      DQG                  I + G KGE+G PG  GY G  GP            KG KG++G+    PG QG  G  G +G  G  GP+GI G KG+            KG  GI   +GD GD+G+ GP+G  G                     +         G         +PG KGDKG+ G+ G  G  G PGI G  G KG+ G  G  G++ + G  G  G  G                       G  G      G +   HSQ+T+ P CP  T  ++ GYS L + G+ERAH  DL + GSCL+ FS +PF+FC     C ++ RND +YWLS+   M MSM  I    ++ ++SRC VCE P+   A HSQ+   P+CP+GW +LW G SF+M T  GA G GQ L+SPGSCL  F+   F+EC  +G C YY     FWL   +  + F+      +K       +++C VCMR 
Sbjct:  524 RLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKG---SPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGP------------------PGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDM---PGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAG---------------------------------------------IPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYD---------------------------------------------------GIPG--SPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGA-PGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPP----------GPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPI---------------------GLPGSPSMAHGFLVTRHSQTTETPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGDGIKPFISRCTVCEVPAMVMAVHSQTIQIPQCPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIECHGRGTCNYYANTYSFWLATIEKNEMFKKPTPSTLKAGDLRTHVSRCQVCMRR 1654          

HSP 2 Score: 217.238 bits (552), Expect = 5.515e-56
Identity = 377/1036 (36.39%), Postives = 479/1036 (46.24%), Query Frame = 1
Query:  538 GCCGKPGQKGAAG-------LQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFT----THLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGI-----------------DGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS-----RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKG---VKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGP------KGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQ 3516
            G  G PG KG  G       L+G  G  G+PG  G  GR+G  G    Q+G+     G KG  G  G KGE G  GD G PGN G  G+ G  G  G  G  GEKGEP  +       G  G KG+ G +                   G +G +G            + G+ GR GS+G +G  G+ G    +G  G  GE G  G P                        G  G +G  G +G+ G        + G+RGD G KGE G+                  GD+G PG  G  G+ G  G  G  G+KG +      G+  P      G KG +G  G  G  G  G  G+KG++G     G+DM G KG KG  G  GP G TG  G+ G  G++G  G      PG +G  G+ G PG +G+ G PG  G +GEKG       G  G  G  G+PG  GE+G +GL GE G+  E  ++   G  G  GE+G+ G  G+KG +G  G  G          +G+ GP GE+G  G  G QGL+G  G  G+ G  G  G+KG+ G++G  G       KG KG +G+ GLPG     IPG  G++GD G  G  G  GE+G   +V +  +  + G  G  G  G  G+ G PG KG+KG  GL GIPG+ G  G+SG  G  G+ G KGE G DG  G  G  G  G+ G  G+ G  G  G  G KGDIG  G PG S                                G  G KG  GL G  G +G  G  G  GI   G KG KG  G  G  G+PG  G  G++G     +KG KG  G  G  GFQG  G+ G +G  G  G SG+ G+KGD GP G  G  G KG +G+ GE G +GD+G TG +G +G  G  G   +  + G  G  G QGP+G   +G++GL GP+G       KGV G +G  GP G PG  I G+ G+KG  G  G  G  G+ G  G  GLPG IG  G 
Sbjct:  505 GLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDG-QQGL----PGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAG-TGTSGLPGEKGEP-GVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKG------------SPGHPGRPGSQGEKGEPGLPG----VGYPGPSGEKGFQGMP------------------------GTPGQAGFPGPQGVDG--------LPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPG-----FPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDA-----GPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGI---GIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGIS--------------------------------GVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTG--QDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGT--HTVTKGESGEPGPQGPSGP--RGIQGLPGPKGD------KGVTGASGLPGPSGIPG--IHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGS 1425          

HSP 3 Score: 185.267 bits (469), Expect = 4.080e-46
Identity = 314/938 (33.48%), Postives = 411/938 (43.82%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPG--------EVGEQGLRGLDGYSGKKGESGIHGDKGEKG--------LAGFSGPKGIKGERGDTG---LPGKEAEKI-----------------------------PGDKGIQGDVGE---LGDKGFKGEKGKNQNVNVLLTKYKGD-------------NGEKGVKGSQG---------------TAGFPGNKGSKGETGLSGI-PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGV---KGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKG----------------PKGFQGNIGERGNPG------IKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGY--------KGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGF------------------KGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEI---GEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDA---------GKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGI------EGDLGDKGVRGPQGLAGER 4389
            T+G+KG SG +G PG        EV E+G RGL G+ G KG+ G+ G +G  G        L G +GP G  GERG+ G   LPG   +                               PGD G+ G+ G+    G++G KG+KG       L+                   +G  G+KG +G               +AG  G+ G+KGE G     P   G  G SG  G  G  GR+G  G+DG++G  G+ G+ G    KG +G+ GDRG  G PGE+G  G  G                                        G  G  G +GE G  GF G+ G PG  A GE G                  GF G+ GE+G+PG       +G KG  G P +      G PG  G KGFQG+PG  G  G  GP G  GL G +GD GP+G         KGVQG  G +G+ G+ G+ G  G  GE+G  G+ G+ G KG  G +G+ G++G  G  G G KG +G  GPQG    SG+ G  G+ G++G  GFPG ++ G KG+KGN G  G  G  G                   KG++G +G+PGSIG  G  G  G  G+KG  G  G PG  G  G KG +G++G  G PG             + E+G++GEI   GEKG +G+ G  G  G  GQ G +G  G KG+ G  G+KG+                                                +G+ G+   G  G+ G  G TGEKG+ G  G           G++G +G  G  GIG+ GV G +GD G DG  G  G +G KGD G     PG  G  G KG  G  G  G  G+PG KG KG  G+      +G  GD GV+GP G +GE+
Sbjct:  303 TKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGT---------------------------------------GTSGLPGEKGEPGVPGFVGIPGTPG--AKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV------GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGL---SGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGS------------------------------------------------QGLQGQ--KGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGI----PGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEK 1136          

HSP 4 Score: 139.043 bits (349), Expect = 4.937e-32
Identity = 283/790 (35.82%), Postives = 365/790 (46.20%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQG-----PKGM---------IGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPG--------------QKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGL------------------------KGYKGLKGDT----IDISGNVTGVRGD------------RGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS----IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPG 2448
            G  GP GE GF G  G PG  G  G +G  G  G +G+ G KG+ G     PKG+          GDKG  G SG+ G++G  G+ G  G+ GE G  G PG              Q+G++G QG  G  G  G++GE+G  G  G  +P        +GDKG  G  G  G  G  G  G PG +G+ G+ G KG++G +G  G  G+P        S G +G+KGD G      ++        KG++G+RG PG   +      KG +G  G +G  G+ G +G LG  G  G PG++G  G  G  G  G++G  G +G QG +G  G+ G  GL                        KG KGLKG+     I I G V GV+GD            RG+KG+ GI G  G PG +G+ G +G+ G  G  G KG ++G         +     +GL G +G +G  GH G KG+ G  G+   G+ G KG  G+ G +G  G  GE G  G KGDIG  G      +PG +G +G+ G  G  G  G PG  G   E         G AG  G  G  G+PG  G DG+ GE GE+G  G  G  G  G  G +G  GD G  G  G KG  G   I      +G  G SGE+GD    G+QG+ G  G  G  G +G H     KG +G  GP+G  G RG  GLPG +     GDKG+ G  G  G  G  G  G             G  GE G  G  G  G+PG  GS G  G  G+PG
Sbjct:  676 GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMP------GPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQP----GAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPG-VPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKG-AKGTHGLVGIPGQ-----KGLTGDSGVQGPPGHSGEKGEPGYDGIP--GSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGD---RGDQGITGPKGDLGPPGPAGTH--TVTKGESGEPGPQGPSGPRGIQGLPGPK-----GDKGVTGASGLPGPSGIPGIHGT-----------PGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPG 1424          

HSP 5 Score: 112.464 bits (280), Expect = 5.543e-24
Identity = 187/559 (33.45%), Postives = 240/559 (42.93%), Query Frame = 1
Query: 2128 GIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKG---------------------SKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF--------IGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNI------------------------GERGNPGIKGYKGN----------SGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-------PAGDGIKGMKG-------------------LIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGL 3534
            G  G KGE G++ F GPKG   ERGD G PG   +     +G + +    G+KG KG  G+N         +KG+ GE G  G +G  G  G++G                     +KGE G SG  G  G V ++G+      +  KG+ GL G  G +G+ G+KG +G  G+ G  G          GFPGE+G+ G  G+PG ++ GP G  G  G  G+ G  G                   T +  +SG  G  GL G+PG     GE+G KG +G+                         G  G PGIKG +G+                 L G  G  GE G   F+  P  KG KGE G  G  G  GR+G  G  G +G+ G KG+ G IG  G QG  GD G  G+ G +G+ G  G  G+ GL G KG  G       P   G KG  G                     G QG+KG  G+ G  G  G+KG  G PG    G  GEKG +G  G  G  GF G  G  GLPG  G  G +G+ GL
Sbjct:  191 GAPGPKGEMGIS-FYGPKG---ERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEI----EVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAID----------------TSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFE--PRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGT-GTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL 722          

HSP 6 Score: 109.768 bits (273), Expect = 3.428e-23
Identity = 284/951 (29.86%), Postives = 366/951 (38.49%), Query Frame = 1
Query: 2035 KGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGD---------TGLPGKEAEKIPGDKGIQGDVGEL------GDKGFKGEKG-------------KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGK--------------HGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF---------------IGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDK------GFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYK--------------------------------GIPGEIGPKGFQGLPGEKGFKGEIGPT---------------------GTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGE-------RGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI-------------GLLGVKG--------------ERGDPGPDGYEGQRGPKGPKGDKGFS----------------ILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            KG +GE G PG  G +G  G  G+ G  G  GI G  G  G +G  G  G KG+RG           G PG   +  PG KG  GD+  +      G+KGF G  G                          G +G  G KG  G + F G KG +G+ G  G P K              +G+ G  G  GE G  G+ G++   G +G  G +G +G  G +G +G++G                 G  GEKG+ G  G PG  ++                          + E  + GD+G  G  G  GDK      GF G+ G PG+   G  GP GF         PG +G KG  G P + L+G K                                G+PG  G  GFQG  G+KG KG+  P+                     G SG+ G KGD+G  GY G  G  G  G  G MGS G KG+ GE       +G  G  G  G  G  G  G  G+ G Q     G+ G KG+ G  G KGE G  G +G  G+ G +GFPG    G+ G  G K   GE GV GF      +G+PG+ G +G+ G+  +K                                 G  G +G +G      ++G+KG  G  G  G++G+KG  GL G VG  GP G KG  G  G  G                                   G  G +G+ G  GLRG  G       G  GP+G  G  G  G  GD G  G  G  G+QG              G++GV G              ++G  GP G  G  GP G KG++G++                I  PGP G TG+ G  G  G  G  G PG KGE G  G+ G +G  G  G  G  GE+
Sbjct:   58 KGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQ--PGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGIS-FYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQS-FKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVS------------------------NGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGF---------PGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQ-----GLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEK---GEPGVPGF------VGIPGTPGAKGEPGKAIIK--------------------------------TGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPG-VGYPGPSGEKGFQGMPGTPGQA---------------------------------GFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEK 891          

HSP 7 Score: 109.383 bits (272), Expect = 5.499e-23
Identity = 191/509 (37.52%), Postives = 245/509 (48.13%), Query Frame = 1
Query:  280 ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNS---GINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDK---GAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDL-----------------------GPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDI-SGNVTGVRGDR---GEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGA 1686
            E   +G  G  G+ G  G  GK G +GV+G+ GP G  G +G +G +G QG KG IG+ G+ G +   G +G  G+PG  G  G  GE+G       KG  GL G  G+ G+PG++G+ GR GP G        LP ERGDK   G  G  G  G  G  G  G PG+ G+ G +G KG  G +G  G+KG       +    G  G+KG+ GY           E  I G    RG PG  G+ G+ G+KG  G  G+ G  G+ GI+GD                        GP G+ G+PG+ G PG PG  G+PG  G  G +G +G  G  GA G  G KG  G +G + D     +TG +GD    G  G  G+ G  GI G++G RGD G+ GP G+ G  G +           KGE G  G  G +G RG QG  G KGDKGV G         + G  G  G  G TGP G TG  G  GP G  G  G +G  +PG+
Sbjct:  944 EIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGL------KGEVGLPGI-GIPGVPGVKGDAGRDGPHG--------LPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGL-TGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG----RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPA-----GTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIG--LPGS 1425          

HSP 8 Score: 108.227 bits (269), Expect = 1.117e-22
Identity = 194/569 (34.09%), Postives = 249/569 (43.76%), Query Frame = 1
Query:  277 TECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEG---------------CCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKG---AKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLG-----------------PIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGM--DMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG----TSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDG 1860
            +E     + G KGE G  G  G  G +G  GD G PG  G+ G +G +G+ GPKG  G +G++G+ G+ G+KG+ G  G  G TGE+G                 G+ G KG  GL G  G+ G+PG++G+ GR GP G        LP ERGDKG     G  G  G  G  G  G PG+ G+ G +G KG  G +G  G+KG       +    G  G+KG+ GY           E  I G    RG PG  G+ G+ G+KG  G  G+ G  G+ GI+GD G                  I   G  GE G PG+                           AG  G  G  GL G T        G++G++GE+G  G  G +G  GD G++G SG  GP G  G KG +     PG  G KG     G+ G+ G RG+QG  G KGD G  G       TKG  G  G  GP G  G  G  GP G+KG  G  G    + IPG  G+                      G+KG       G +G  G  G+PG PG  G+ G
Sbjct:  925 SETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGI-GIPGVPGVKGDAGRDGPHG--------LPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGL-TGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG----RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQ---------------------------AGYPGSPGPVGLPGHT-----GQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGS---LGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTP---------------------GQKGET-----GPSGPTGQTGYPGPPGSDGLPG 1418          

HSP 9 Score: 104.375 bits (259), Expect = 1.618e-21
Identity = 211/635 (33.23%), Postives = 270/635 (42.52%), Query Frame = 1
Query:  289 CNGLLGPKGEMGFGGHEGKPGFRGVKGDRGP-------------------PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLP-QEGVL--------------PAERGDKGAKGFSGLKGEI---GEFGDVGEPG--------------NKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGK---HGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS-----------------RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------------------MIGTKGRKGVNGLT---GPKGDTGDAGEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSC---------FNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
             +GL G KGE G  G  G PG  G KG+ G                    PG  GEKG+ G+ G  G +G  G+ G+ G              G  G +GE+G  G PG  G AG  G  G+ G+PG++G+ G KG  G  LP  +GV               P   G  G +GFSG+ G     GE G VG PG               +G  G QG  G  G  G KGE+G       LD   G  GDKG+ G    T  T    +    G++G+ G PGP G+MG  G  G  G+ G+ G+ G  G +GD GP G     G PG  G  G+ G+ G PG+      E  +G +G+ G  G  G+ G KG  GD         D    V G  G +GEKG +GI G +G+ G +GS G+ GL GP GEKG  G S                 +G       G  G  G++G  G+ G  G  G +G KGD G+ GM                    + G KG KG +GL    G KG TGD+G  GP G  G+ G+ G   IPG+                         GEKG                G+ G++GD GFPG PG  G+ G+
Sbjct:  596 TSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPG-------------VGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGY-AGFPGLDMP-GPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSP------------------------GEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGI 1191          

HSP 10 Score: 98.2117 bits (243), Expect = 1.245e-19
Identity = 141/401 (35.16%), Postives = 183/401 (45.64%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVLPAERGDKGAKG-----------------FSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGK----PGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGV 1425
            KG++G  G  G PG +G  G  G PG+ G  G +G KG  G  G+ G KG+ G+SG+ G  G  G KG  GY   +G  G PG+KG AG+ G  G+ G PG  GEKG KG  GF   P    +P  +GD+G  G                   G KGE G+ G  G PG+ G +G  G  G  G  G KGE+G P         +G+ G++G  G +  + +T         GQKG  GPPG  G  G  G+ G  G  G +G +G+ G +GDLGP G  G      GE+G PG                          G +G  G++G  G KGD        +     + G+ G  G+KGE G  G  G  G  G  G  GL GPIG  G+   + G 
Sbjct: 1070 KGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGY---DGIPGSPGEKGEAGIPGR-GLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWP-GAPGFQGFKGDTGNQGPSGDAGPSGIT---------GQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQ------------------------GPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAHGF 1432          

HSP 11 Score: 92.0485 bits (227), Expect = 9.404e-18
Identity = 192/536 (35.82%), Postives = 245/536 (45.71%), Query Frame = 1
Query:  298 LLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPK-----GFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGD-----VGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQG---PIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
            L G KGE G  GH G PG  G  G  G  G  G KG  G  G +G +G+ GD+G  GN G  G  G  G           G  G PG+KG  G+ G+ G+ G PG +GE G+   K               P ++G+KG+ G  G  G  GE G+     VG PG  G  G+QG  G  G+ GF G +G    +  L   RG+ G KG+ G               + G KG++GPPGP G  GD G  G  G  G +G  G+ G  G  G  G  G PG       P      G +G  G  G QG  G  G AG  G +GY G  G       ++ G +GD+G  G  G  G  GIPG  G+ G  GL G   P GE G  G    + +PG  G  G  G +G  G  G  G  G+ G KG+KG +G+    G         + G KG+ G+ GE G  GEKG +GD G+  PG  G  G +G  G  G +G  G +G  G +G       G  G+ G+ G PG  GE+G  G+
Sbjct:  525 LKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAG----------TGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQG----VDGLPGLRGDPGPKGEPGLG-------------LPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQ----GPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGL------DMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGS--PGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGL-----QGQKGSIGEMGLPGPTGEKGQHGI 1016          

HSP 12 Score: 78.9518 bits (193), Expect = 8.295e-14
Identity = 168/469 (35.82%), Postives = 210/469 (44.78%), Query Frame = 1
Query: 2170 SGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKG--FTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKG---------EIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGD 3543
            SG KG KGERG  GLPG                      GF G +G            KGD GE G+ G++GT G PG+ G  G  GL GIPG+ G  G SG  G  G  G +G  G  G  G  G  G  G  G +G  GD   I     KG+ G  G+  + I G  G  G  G +G IG  G  G  G  G  G  G+ G  F G +GE GD+G  G    P     G +  + + G  GE+G PG  G +G    P  + KG KG PG +GP+G  G  G++G KG           GP G  G +G KG+ GPQG  G+    G I             +  E+G  G+ G+ G KG++G  G +G  G  G  G  + G  G  G  G++GE G  G+ GLA  +GPKG  G                      G  GD G  G PG  GFQG+ GQ+G KGD
Sbjct:   22 SGVKGQKGERGLPGLPGL--------------------MGFPGLQGPEGPPGP--LGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGI--NGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQ---PGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEI-------------EVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLA-LQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGD 449          

HSP 13 Score: 76.2554 bits (186), Expect = 6.110e-13
Identity = 157/466 (33.69%), Postives = 198/466 (42.49%), Query Frame = 1
Query:  382 PGALGEKGNEGY----KGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQ---EGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMI--------------GYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGV--------------RGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQ--GPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG 1668
            PGA GE G   +    KGD+G  G+ G  G  G  G                 G +G  G PG KG AG  G  G QG+PG +G  G  G +GF  P       LP E+G+ G  GF G+ G  G  G+ G    K +I              G+ GD+G+ G  G  G  G          S+GE G+ G  G  +              G+KG +         G  G  G  G  G +G +GL G+RGD GP G+ G     G PG  G+ G PG  G PG +G  G  G  G  G SG+ G+ G KG+   +   V G+              +G  G +G  G  G  G+ G+ G  G  GL   GP G+KGN G           GP G  G+ G  G  GK G  G  G KG+ GV  M M G+ G+ G  G  G  G+ GDAG  GP G  G  G  G
Sbjct:  510 PGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREG---------------RPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPG----KAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPG----------SQGEKGEPGLPGVGYPGP----------SGEKGFQ---------GMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL----GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIV--GVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSP---------GPTGATGIPGQPGAPGKEGLPGFPGPKGEMGV--MGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKG 910          

HSP 14 Score: 56.9954 bits (136), Expect = 4.424e-7
Identity = 77/229 (33.62%), Postives = 95/229 (41.48%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQ------------GPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEV 942
            +G+ G KGE G+ G  G  GF+G  G++GP G  G  G  G KGD             G  G+ G+KG +G+ GI               TG +G  G PG  G   +    G  G PG QG  G +G +G        LP  +GDKG  G SGL G  G  G  G PG KG  G  G  G  G  G  G  G P          G IG  G    +    +TR +   
Sbjct: 1248 DGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGI---------------TGPKGDLGPPGPAGTHTV--TKGESGEPGPQGPSGPRGIQG--------LPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLP----------GPIGLPGSPSMAHGFLVTRHSQTT 1441          

HSP 15 Score: 55.0694 bits (131), Expect = 1.688e-6
Identity = 163/451 (36.14%), Postives = 207/451 (45.90%), Query Frame = 1
Query:  250 AAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGAL------GEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSF--TTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEG--LKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGR 1572
            A  C+    ++C C+G+ G KGE G  G  G  GF G++G  GPPG L      GE G  G KG +GP G  G  G  G  GI G+ G PG  G  G  G +G  G  G  G  G+ GY G  G PG +GE G       S+         +G+KG  G +G+ G  G  G  G  G  G  G  G  G  G  G KGE G     IS    +GE GD+G  G     +T    + NE +  G+KG                KG  G  G +G  G   KG +G+ GP+G  GKPG++G  G+ G+ G+PG  G PGP G+ G +   G  G SG +G  G+     +I            E  EK   GDRG+PG  GS+GD GL+G  G  G  G S GV                L G TG  G  G +G KG  G+ G+ + G KGR
Sbjct:    8 AKACSGCGTSKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSM--------IKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMG-----ISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKG---------------EKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTK---GEKGESGPQGPPGIVVSNGEI------------EVCEK---GDRGLPGFPGSKGDKGLKGAQGFPGIPG-SPGVP---------------LPGSTGPPGFPGERGEKGQHGLPGLALQGPKGR 396          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 415.231 bits (1066), Expect = 2.613e-118
Identity = 440/1285 (34.24%), Postives = 557/1285 (43.35%), Query Frame = 1
Query: 2020 RTEGDKGPSGERGDPGEVGEQGLRGLDG---YSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKG---IQGDVGELGDKGFKGEKGK--------NQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGI--PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGL--------------------------EGVKGDRGFIGFPGE---KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERG---------NPGIKGYKGNSGFPDIT-LKGYKGIPGEIGPKGFQGLPG---EKGFKGEIGPTGTSGLRGRKGDQGPQGY------------------KGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKG---------VQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQ-----RGPQGNTGEKGEKGEFGDAGKRGPQGPAG------DQG------------------IGLLGVKGERGDPGPDGYEGQRGP------------KGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGE------------KGERGI---EGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRN 5445
            R +GDKG SG  G PG  G +G  G+DG     G KG +G  G KGE+GL G  G  G  GERG  G  G     +PG+KG   + G VG  G  G KGE GK               +  + GD GEKG   S G  G PG++G KGE GL G+  PG  G+ G  G  G  G  G  G  G+DG  G +G+ G KG  GL                           GV G++GF G PG    KG+ G+ GVPG                           +G KG++G  G +G +G  G +G KG  G  G PG+      GPKG +GNIG  G          PG  G +G  GFP      G  G+PG IG  G  G PG   EKG  G  GP G SG  G KG++G +G                   KG +G++G IG+ GE GS GD G  G  G  G QG QGE G +G  G +G+KG+QG  G  G  G  GL GP G+KG+ G  G         ++G  G KG  G PG  I G  G KG+ GR G  G+ G +GD G +G+PG  GF G +G  G  G                                                  G  GE G KG  G  G  G +GL+G  G +GP G+ G+ GE G                                                     GI G  S GE+G+     RG  G+ GE GEKG  GD G  G  G +G      DQG                  I + G KGE+G PG  GY G  GP            KG KG++G+    PG QG  G  G +G  G  GP+GI G KG+            KG  GI   +GD GD+G+ GP+G  G                     +         G         +PG KGDKG+ G+ G  G  G PGI G  G KG+ G  G  G++ + G  G  G  G                       G  G      G +   HSQ+T+ P CP  T  ++ GYS L + G+ERAH  DL + GSCL+ FS +PF+FC     C ++ RND +YWLS+   M MSM  I    ++ ++SRC VCE P+   A HSQ+   P+CP+GW +LW G SF+M T  GA G GQ L+SPGSCL  F+   F+EC  +G C YY     FWL   +  + F+      +K       +++C VCMR 
Sbjct:  537 RLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKG---SPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGP------------------PGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDM---PGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAG---------------------------------------------IPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYD---------------------------------------------------GIPG--SPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGA-PGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPP----------GPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPI---------------------GLPGSPSMAHGFLVTRHSQTTETPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGDGIKPFISRCTVCEVPAMVMAVHSQTIQIPQCPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIECHGRGTCNYYANTYSFWLATIEKNEMFKKPTPSTLKAGDLRTHVSRCQVCMRR 1667          

HSP 2 Score: 217.624 bits (553), Expect = 4.437e-56
Identity = 377/1036 (36.39%), Postives = 479/1036 (46.24%), Query Frame = 1
Query:  538 GCCGKPGQKGAAG-------LQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFT----THLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGI-----------------DGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS-----RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKG---VKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGP------KGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQ 3516
            G  G PG KG  G       L+G  G  G+PG  G  GR+G  G    Q+G+     G KG  G  G KGE G  GD G PGN G  G+ G  G  G  G  GEKGEP  +       G  G KG+ G +                   G +G +G            + G+ GR GS+G +G  G+ G    +G  G  GE G  G P                        G  G +G  G +G+ G        + G+RGD G KGE G+                  GD+G PG  G  G+ G  G  G  G+KG +      G+  P      G KG +G  G  G  G  G  G+KG++G     G+DM G KG KG  G  GP G TG  G+ G  G++G  G      PG +G  G+ G PG +G+ G PG  G +GEKG       G  G  G  G+PG  GE+G +GL GE G+  E  ++   G  G  GE+G+ G  G+KG +G  G  G          +G+ GP GE+G  G  G QGL+G  G  G+ G  G  G+KG+ G++G  G       KG KG +G+ GLPG     IPG  G++GD G  G  G  GE+G   +V +  +  + G  G  G  G  G+ G PG KG+KG  GL GIPG+ G  G+SG  G  G+ G KGE G DG  G  G  G  G+ G  G+ G  G  G  G KGDIG  G PG S                                G  G KG  GL G  G +G  G  G  GI   G KG KG  G  G  G+PG  G  G++G     +KG KG  G  G  GFQG  G+ G +G  G  G SG+ G+KGD GP G  G  G KG +G+ GE G +GD+G TG +G +G  G  G   +  + G  G  G QGP+G   +G++GL GP+G       KGV G +G  GP G PG  I G+ G+KG  G  G  G  G+ G  G  GLPG IG  G 
Sbjct:  518 GLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDG-QQGL----PGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAG-TGTSGLPGEKGEP-GVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKG------------SPGHPGRPGSQGEKGEPGLPG----VGYPGPSGEKGFQGMP------------------------GTPGQAGFPGPQGVDG--------LPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPG-----FPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDA-----GPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGI---GIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGIS--------------------------------GVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTG--QDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGT--HTVTKGESGEPGPQGPSGP--RGIQGLPGPKGD------KGVTGASGLPGPSGIPG--IHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGS 1438          

HSP 3 Score: 185.267 bits (469), Expect = 3.592e-46
Identity = 314/938 (33.48%), Postives = 411/938 (43.82%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPG--------EVGEQGLRGLDGYSGKKGESGIHGDKGEKG--------LAGFSGPKGIKGERGDTG---LPGKEAEKI-----------------------------PGDKGIQGDVGE---LGDKGFKGEKGKNQNVNVLLTKYKGD-------------NGEKGVKGSQG---------------TAGFPGNKGSKGETGLSGI-PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGV---KGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKG----------------PKGFQGNIGERGNPG------IKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGY--------KGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGF------------------KGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEI---GEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDA---------GKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGI------EGDLGDKGVRGPQGLAGER 4389
            T+G+KG SG +G PG        EV E+G RGL G+ G KG+ G+ G +G  G        L G +GP G  GERG+ G   LPG   +                               PGD G+ G+ G+    G++G KG+KG       L+                   +G  G+KG +G               +AG  G+ G+KGE G     P   G  G SG  G  G  GR+G  G+DG++G  G+ G+ G    KG +G+ GDRG  G PGE+G  G  G                                        G  G  G +GE G  GF G+ G PG  A GE G                  GF G+ GE+G+PG       +G KG  G P +      G PG  G KGFQG+PG  G  G  GP G  GL G +GD GP+G         KGVQG  G +G+ G+ G+ G  G  GE+G  G+ G+ G KG  G +G+ G++G  G  G G KG +G  GPQG    SG+ G  G+ G++G  GFPG ++ G KG+KGN G  G  G  G                   KG++G +G+PGSIG  G  G  G  G+KG  G  G PG  G  G KG +G++G  G PG             + E+G++GEI   GEKG +G+ G  G  G  GQ G +G  G KG+ G  G+KG+                                                +G+ G+   G  G+ G  G TGEKG+ G  G           G++G +G  G  GIG+ GV G +GD G DG  G  G +G KGD G     PG  G  G KG  G  G  G  G+PG KG KG  G+      +G  GD GV+GP G +GE+
Sbjct:  316 TKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGT---------------------------------------GTSGLPGEKGEPGVPGFVGIPGTPG--AKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV------GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGL---SGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGS------------------------------------------------QGLQGQ--KGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGI----PGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEK 1149          

HSP 4 Score: 138.658 bits (348), Expect = 5.630e-32
Identity = 283/790 (35.82%), Postives = 365/790 (46.20%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQG-----PKGM---------IGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPG--------------QKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGL------------------------KGYKGLKGDT----IDISGNVTGVRGD------------RGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS----IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPG 2448
            G  GP GE GF G  G PG  G  G +G  G  G +G+ G KG+ G     PKG+          GDKG  G SG+ G++G  G+ G  G+ GE G  G PG              Q+G++G QG  G  G  G++GE+G  G  G  +P        +GDKG  G  G  G  G  G  G PG +G+ G+ G KG++G +G  G  G+P        S G +G+KGD G      ++        KG++G+RG PG   +      KG +G  G +G  G+ G +G LG  G  G PG++G  G  G  G  G++G  G +G QG +G  G+ G  GL                        KG KGLKG+     I I G V GV+GD            RG+KG+ GI G  G PG +G+ G +G+ G  G  G KG ++G         +     +GL G +G +G  GH G KG+ G  G+   G+ G KG  G+ G +G  G  GE G  G KGDIG  G      +PG +G +G+ G  G  G  G PG  G   E         G AG  G  G  G+PG  G DG+ GE GE+G  G  G  G  G  G +G  GD G  G  G KG  G   I      +G  G SGE+GD    G+QG+ G  G  G  G +G H     KG +G  GP+G  G RG  GLPG +     GDKG+ G  G  G  G  G  G             G  GE G  G  G  G+PG  GS G  G  G+PG
Sbjct:  689 GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMP------GPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQP----GAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPG-VPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKG-AKGTHGLVGIPGQ-----KGLTGDSGVQGPPGHSGEKGEPGYDGIP--GSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGD---RGDQGITGPKGDLGPPGPAGTH--TVTKGESGEPGPQGPSGPRGIQGLPGPK-----GDKGVTGASGLPGPSGIPGIHGT-----------PGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPG 1437          

HSP 5 Score: 112.849 bits (281), Expect = 4.504e-24
Identity = 187/559 (33.45%), Postives = 240/559 (42.93%), Query Frame = 1
Query: 2128 GIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKG---------------------SKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF--------IGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNI------------------------GERGNPGIKGYKGN----------SGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-------PAGDGIKGMKG-------------------LIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGL 3534
            G  G KGE G++ F GPKG   ERGD G PG   +     +G + +    G+KG KG  G+N         +KG+ GE G  G +G  G  G++G                     +KGE G SG  G  G V ++G+      +  KG+ GL G  G +G+ G+KG +G  G+ G  G          GFPGE+G+ G  G+PG ++ GP G  G  G  G+ G  G                   T +  +SG  G  GL G+PG     GE+G KG +G+                         G  G PGIKG +G+                 L G  G  GE G   F+  P  KG KGE G  G  G  GR+G  G  G +G+ G KG+ G IG  G QG  GD G  G+ G +G+ G  G  G+ GL G KG  G       P   G KG  G                     G QG+KG  G+ G  G  G+KG  G PG    G  GEKG +G  G  G  GF G  G  GLPG  G  G +G+ GL
Sbjct:  204 GAPGPKGEMGIS-FYGPKG---ERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEI----EVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAID----------------TSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFE--PRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGT-GTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL 735          

HSP 6 Score: 110.153 bits (274), Expect = 2.930e-23
Identity = 284/951 (29.86%), Postives = 366/951 (38.49%), Query Frame = 1
Query: 2035 KGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGD---------TGLPGKEAEKIPGDKGIQGDVGEL------GDKGFKGEKG-------------KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGK--------------HGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF---------------IGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDK------GFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYK--------------------------------GIPGEIGPKGFQGLPGEKGFKGEIGPT---------------------GTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGE-------RGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI-------------GLLGVKG--------------ERGDPGPDGYEGQRGPKGPKGDKGFS----------------ILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            KG +GE G PG  G +G  G  G+ G  G  GI G  G  G +G  G  G KG+RG           G PG   +  PG KG  GD+  +      G+KGF G  G                          G +G  G KG  G + F G KG +G+ G  G P K              +G+ G  G  GE G  G+ G++   G +G  G +G +G  G +G +G++G                 G  GEKG+ G  G PG  ++                          + E  + GD+G  G  G  GDK      GF G+ G PG+   G  GP GF         PG +G KG  G P + L+G K                                G+PG  G  GFQG  G+KG KG+  P+                     G SG+ G KGD+G  GY G  G  G  G  G MGS G KG+ GE       +G  G  G  G  G  G  G  G+ G Q     G+ G KG+ G  G KGE G  G +G  G+ G +GFPG    G+ G  G K   GE GV GF      +G+PG+ G +G+ G+  +K                                 G  G +G +G      ++G+KG  G  G  G++G+KG  GL G VG  GP G KG  G  G  G                                   G  G +G+ G  GLRG  G       G  GP+G  G  G  G  GD G  G  G  G+QG              G++GV G              ++G  GP G  G  GP G KG++G++                I  PGP G TG+ G  G  G  G  G PG KGE G  G+ G +G  G  G  G  GE+
Sbjct:   71 KGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQ--PGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGIS-FYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQS-FKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVS------------------------NGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGF---------PGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQ-----GLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEK---GEPGVPGF------VGIPGTPGAKGEPGKAIIK--------------------------------TGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPG-VGYPGPSGEKGFQGMPGTPGQA---------------------------------GFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEK 904          

HSP 7 Score: 109.383 bits (272), Expect = 5.244e-23
Identity = 188/515 (36.50%), Postives = 241/515 (46.80%), Query Frame = 1
Query:  280 ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNS---GINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDK---GAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDL-----------------------GPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDI-SGNVTGVRGDRGE---------KGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGA 1686
            E   +G  G  G+ G  G  GK G +GV+G+ GP G  G +G +G +G QG KG IG+ G+ G +   G +G  G+PG  G  G  GE+G       KG  GL G  G+ G+PG++G+ GR GP G        LP ERGDK   G  G  G  G  G  G  G PG+ G+ G +G KG  G +G  G+KG       +    G  G+KG+ GY           E  I G    RG PG  G+ G+ G+KG  G  G+ G  G+ GI+GD                        GP G+ G+PG+ G PG PG  G+PG  G  G +G +G  G  GA G  G KG  G +G + D     +TG +GD G          KG  GI G++G  GD+G  G  G  GP G  G    ++G S              G  G +G RG QG  G KGDKGV G         + G  G  G  G TGP G TG  G  GP G  G  G +G  +PG+
Sbjct:  957 EIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGL------KGEVGLPGI-GIPGVPGVKGDAGRDGPHG--------LPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGL-TGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG----RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGE-----------PGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIG--LPGS 1438          

HSP 8 Score: 108.227 bits (269), Expect = 1.065e-22
Identity = 194/569 (34.09%), Postives = 249/569 (43.76%), Query Frame = 1
Query:  277 TECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEG---------------CCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKG---AKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLG-----------------PIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGM--DMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG----TSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDG 1860
            +E     + G KGE G  G  G  G +G  GD G PG  G+ G +G +G+ GPKG  G +G++G+ G+ G+KG+ G  G  G TGE+G                 G+ G KG  GL G  G+ G+PG++G+ GR GP G        LP ERGDKG     G  G  G  G  G  G PG+ G+ G +G KG  G +G  G+KG       +    G  G+KG+ GY           E  I G    RG PG  G+ G+ G+KG  G  G+ G  G+ GI+GD G                  I   G  GE G PG+                           AG  G  G  GL G T        G++G++GE+G  G  G +G  GD G++G SG  GP G  G KG +     PG  G KG     G+ G+ G RG+QG  G KGD G  G       TKG  G  G  GP G  G  G  GP G+KG  G  G    + IPG  G+                      G+KG       G +G  G  G+PG PG  G+ G
Sbjct:  938 SETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGI-GIPGVPGVKGDAGRDGPHG--------LPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGL-TGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG----RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQ---------------------------AGYPGSPGPVGLPGHT-----GQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGS---LGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTP---------------------GQKGET-----GPSGPTGQTGYPGPPGSDGLPG 1431          

HSP 9 Score: 104.76 bits (260), Expect = 1.479e-21
Identity = 211/635 (33.23%), Postives = 270/635 (42.52%), Query Frame = 1
Query:  289 CNGLLGPKGEMGFGGHEGKPGFRGVKGDRGP-------------------PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLP-QEGVL--------------PAERGDKGAKGFSGLKGEI---GEFGDVGEPG--------------NKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGK---HGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS-----------------RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------------------MIGTKGRKGVNGLT---GPKGDTGDAGEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSC---------FNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
             +GL G KGE G  G  G PG  G KG+ G                    PG  GEKG+ G+ G  G +G  G+ G+ G              G  G +GE+G  G PG  G AG  G  G+ G+PG++G+ G KG  G  LP  +GV               P   G  G +GFSG+ G     GE G VG PG               +G  G QG  G  G  G KGE+G       LD   G  GDKG+ G    T  T    +    G++G+ G PGP G+MG  G  G  G+ G+ G+ G  G +GD GP G     G PG  G  G+ G+ G PG+      E  +G +G+ G  G  G+ G KG  GD         D    V G  G +GEKG +GI G +G+ G +GS G+ GL GP GEKG  G S                 +G       G  G  G++G  G+ G  G  G +G KGD G+ GM                    + G KG KG +GL    G KG TGD+G  GP G  G+ G+ G   IPG+                         GEKG                G+ G++GD GFPG PG  G+ G+
Sbjct:  609 TSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPG-------------VGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGY-AGFPGLDMP-GPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSP------------------------GEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGI 1204          

HSP 10 Score: 98.2117 bits (243), Expect = 1.167e-19
Identity = 141/401 (35.16%), Postives = 183/401 (45.64%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVLPAERGDKGAKG-----------------FSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGK----PGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGV 1425
            KG++G  G  G PG +G  G  G PG+ G  G +G KG  G  G+ G KG+ G+SG+ G  G  G KG  GY   +G  G PG+KG AG+ G  G+ G PG  GEKG KG  GF   P    +P  +GD+G  G                   G KGE G+ G  G PG+ G +G  G  G  G  G KGE+G P         +G+ G++G  G +  + +T         GQKG  GPPG  G  G  G+ G  G  G +G +G+ G +GDLGP G  G      GE+G PG                          G +G  G++G  G KGD        +     + G+ G  G+KGE G  G  G  G  G  G  GL GPIG  G+   + G 
Sbjct: 1083 KGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGY---DGIPGSPGEKGEAGIPGR-GLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWP-GAPGFQGFKGDTGNQGPSGDAGPSGIT---------GQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQ------------------------GPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAHGF 1445          

HSP 11 Score: 92.0485 bits (227), Expect = 8.887e-18
Identity = 192/536 (35.82%), Postives = 246/536 (45.90%), Query Frame = 1
Query:  298 LLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPK-----GFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGD-----VGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQG---PIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
            L G KGE G  GH G PG  G  G  G  G  G KG  G  G +G +G+ GD+G  GN G  G  G  G           G  G PG+KG  G+ G+ G+ G PG +GE G+   K               P ++G+KG+ G  G  G  GE G+     VG PG  G  G+QG  G  G+ GF G +G    +  L   RG+ G KG+ G             + + G KG++GPPGP G  GD G  G  G  G +G  G+ G  G  G  G  G PG       P      G +G  G  G QG  G  G AG  G +GY G  G       ++ G +GD+G  G  G  G  GIPG  G+ G  GL G   P GE G  G    + +PG  G  G  G +G  G  G  G  G+ G KG+KG +G+    G         + G KG+ G+ GE G  GEKG +GD G+  PG  G  G +G  G  G +G  G +G  G +G       G  G+ G+ G PG  GE+G  G+
Sbjct:  538 LKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAG----------TGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQG----VDGLPGLRGDPGPKGEPG-------------LGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQ----GPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGL------DMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGS--PGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGL-----QGQKGSIGEMGLPGPTGEKGQHGI 1029          

HSP 12 Score: 76.2554 bits (186), Expect = 6.121e-13
Identity = 157/466 (33.69%), Postives = 198/466 (42.49%), Query Frame = 1
Query:  382 PGALGEKGNEGY----KGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQ---EGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMI--------------GYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGV--------------RGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQ--GPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG 1668
            PGA GE G   +    KGD+G  G+ G  G  G  G                 G +G  G PG KG AG  G  G QG+PG +G  G  G +GF  P       LP E+G+ G  GF G+ G  G  G+ G    K +I              G+ GD+G+ G  G  G  G          S+GE G+ G  G  +              G+KG +         G  G  G  G  G +G +GL G+RGD GP G+ G     G PG  G+ G PG  G PG +G  G  G  G  G SG+ G+ G KG+   +   V G+              +G  G +G  G  G  G+ G+ G  G  GL   GP G+KGN G           GP G  G+ G  G  GK G  G  G KG+ GV  M M G+ G+ G  G  G  G+ GDAG  GP G  G  G  G
Sbjct:  523 PGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREG---------------RPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPG----KAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPG----------SQGEKGEPGLPGVGYPGP----------SGEKGFQ---------GMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL----GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIV--GVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSP---------GPTGATGIPGQPGAPGKEGLPGFPGPKGEMGV--MGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKG 923          

HSP 13 Score: 71.2478 bits (173), Expect = 2.124e-11
Identity = 154/444 (34.68%), Postives = 190/444 (42.79%), Query Frame = 1
Query: 2365 GVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKG------------LEGVKGDR---------GFIGFPGEKGDIGVTGVPGD----------------SITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGL-----RGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKG---------EIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGD 3543
            GVKG +G  G PG  G  G  GL G  G  G +G  G  GE G  G KG  G  G  G  GN G+ G+ G              G KGDR         G IG+PG  G  G  G PGD                 I G  G  G  G  G +G  G  G  G  G  G  G KG  G+     +GE GD+G  G    P     G +  + + G  GE+G PG  G +G    P  + KG KG PG +GP+G  G  G++G KG           GP G  G +G KG+ GPQG  G+    G I             +  E+G  G+ G+ G KG++G  G +G  G  G  G  + G  G  G  G++GE G  G+ GLA  +GPKG  G                      G  GD G  G PG  GFQG+ GQ+G KGD
Sbjct:   36 GVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQ---PGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEI-------------EVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLA-LQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGD 462          

HSP 14 Score: 56.9954 bits (136), Expect = 4.004e-7
Identity = 77/229 (33.62%), Postives = 95/229 (41.48%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQ------------GPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEV 942
            +G+ G KGE G+ G  G  GF+G  G++GP G  G  G  G KGD             G  G+ G+KG +G+ GI               TG +G  G PG  G   +    G  G PG QG  G +G +G        LP  +GDKG  G SGL G  G  G  G PG KG  G  G  G  G  G  G  G P          G IG  G    +    +TR +   
Sbjct: 1261 DGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGI---------------TGPKGDLGPPGPAGTHTV--TKGESGEPGPQGPSGPRGIQG--------LPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLP----------GPIGLPGSPSMAHGFLVTRHSQTT 1454          

HSP 15 Score: 56.9954 bits (136), Expect = 4.543e-7
Identity = 164/453 (36.20%), Postives = 209/453 (46.14%), Query Frame = 1
Query:  244 SAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGAL------GEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSF--TTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEG--LKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGR 1572
            S +A C+    ++C C+G+ G KGE G  G  G  GF G++G  GPPG L      GE G  G KG +GP G  G  G  G  GI G+ G PG  G  G  G +G  G  G  G  G+ GY G  G PG +GE G       S+         +G+KG  G +G+ G  G  G  G  G  G  G  G  G  G  G KGE G     IS    +GE GD+G  G     +T    + NE +  G+KG                KG  G  G +G  G   KG +G+ GP+G  GKPG++G  G+ G+ G+PG  G PGP G+ G +   G  G SG +G  G+     +I            E  EK   GDRG+PG  GS+GD GL+G  G  G  G S GV                L G TG  G  G +G KG  G+ G+ + G KGR
Sbjct:   19 SDSAACSGCGTSKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSM--------IKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMG-----ISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKG---------------EKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTK---GEKGESGPQGPPGIVVSNGEI------------EVCEK---GDRGLPGFPGSKGDKGLKGAQGFPGIPG-SPGVP---------------LPGSTGPPGFPGERGEKGQHGLPGLALQGPKGR 409          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 415.231 bits (1066), Expect = 2.613e-118
Identity = 440/1285 (34.24%), Postives = 557/1285 (43.35%), Query Frame = 1
Query: 2020 RTEGDKGPSGERGDPGEVGEQGLRGLDG---YSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKG---IQGDVGELGDKGFKGEKGK--------NQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGI--PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGL--------------------------EGVKGDRGFIGFPGE---KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERG---------NPGIKGYKGNSGFPDIT-LKGYKGIPGEIGPKGFQGLPG---EKGFKGEIGPTGTSGLRGRKGDQGPQGY------------------KGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKG---------VQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQ-----RGPQGNTGEKGEKGEFGDAGKRGPQGPAG------DQG------------------IGLLGVKGERGDPGPDGYEGQRGP------------KGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGE------------KGERGI---EGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRN 5445
            R +GDKG SG  G PG  G +G  G+DG     G KG +G  G KGE+GL G  G  G  GERG  G  G     +PG+KG   + G VG  G  G KGE GK               +  + GD GEKG   S G  G PG++G KGE GL G+  PG  G+ G  G  G  G  G  G  G+DG  G +G+ G KG  GL                           GV G++GF G PG    KG+ G+ GVPG                           +G KG++G  G +G +G  G +G KG  G  G PG+      GPKG +GNIG  G          PG  G +G  GFP      G  G+PG IG  G  G PG   EKG  G  GP G SG  G KG++G +G                   KG +G++G IG+ GE GS GD G  G  G  G QG QGE G +G  G +G+KG+QG  G  G  G  GL GP G+KG+ G  G         ++G  G KG  G PG  I G  G KG+ GR G  G+ G +GD G +G+PG  GF G +G  G  G                                                  G  GE G KG  G  G  G +GL+G  G +GP G+ G+ GE G                                                     GI G  S GE+G+     RG  G+ GE GEKG  GD G  G  G +G      DQG                  I + G KGE+G PG  GY G  GP            KG KG++G+    PG QG  G  G +G  G  GP+GI G KG+            KG  GI   +GD GD+G+ GP+G  G                     +         G         +PG KGDKG+ G+ G  G  G PGI G  G KG+ G  G  G++ + G  G  G  G                       G  G      G +   HSQ+T+ P CP  T  ++ GYS L + G+ERAH  DL + GSCL+ FS +PF+FC     C ++ RND +YWLS+   M MSM  I    ++ ++SRC VCE P+   A HSQ+   P+CP+GW +LW G SF+M T  GA G GQ L+SPGSCL  F+   F+EC  +G C YY     FWL   +  + F+      +K       +++C VCMR 
Sbjct:  537 RLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKG---SPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGP------------------PGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDM---PGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAG---------------------------------------------IPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYD---------------------------------------------------GIPG--SPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGA-PGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPP----------GPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPI---------------------GLPGSPSMAHGFLVTRHSQTTETPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGDGIKPFISRCTVCEVPAMVMAVHSQTIQIPQCPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIECHGRGTCNYYANTYSFWLATIEKNEMFKKPTPSTLKAGDLRTHVSRCQVCMRR 1667          

HSP 2 Score: 217.624 bits (553), Expect = 4.437e-56
Identity = 377/1036 (36.39%), Postives = 479/1036 (46.24%), Query Frame = 1
Query:  538 GCCGKPGQKGAAG-------LQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFT----THLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGI-----------------DGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS-----RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKG---VKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGP------KGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQ 3516
            G  G PG KG  G       L+G  G  G+PG  G  GR+G  G    Q+G+     G KG  G  G KGE G  GD G PGN G  G+ G  G  G  G  GEKGEP  +       G  G KG+ G +                   G +G +G            + G+ GR GS+G +G  G+ G    +G  G  GE G  G P                        G  G +G  G +G+ G        + G+RGD G KGE G+                  GD+G PG  G  G+ G  G  G  G+KG +      G+  P      G KG +G  G  G  G  G  G+KG++G     G+DM G KG KG  G  GP G TG  G+ G  G++G  G      PG +G  G+ G PG +G+ G PG  G +GEKG       G  G  G  G+PG  GE+G +GL GE G+  E  ++   G  G  GE+G+ G  G+KG +G  G  G          +G+ GP GE+G  G  G QGL+G  G  G+ G  G  G+KG+ G++G  G       KG KG +G+ GLPG     IPG  G++GD G  G  G  GE+G   +V +  +  + G  G  G  G  G+ G PG KG+KG  GL GIPG+ G  G+SG  G  G+ G KGE G DG  G  G  G  G+ G  G+ G  G  G  G KGDIG  G PG S                                G  G KG  GL G  G +G  G  G  GI   G KG KG  G  G  G+PG  G  G++G     +KG KG  G  G  GFQG  G+ G +G  G  G SG+ G+KGD GP G  G  G KG +G+ GE G +GD+G TG +G +G  G  G   +  + G  G  G QGP+G   +G++GL GP+G       KGV G +G  GP G PG  I G+ G+KG  G  G  G  G+ G  G  GLPG IG  G 
Sbjct:  518 GLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDG-QQGL----PGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAG-TGTSGLPGEKGEP-GVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKG------------SPGHPGRPGSQGEKGEPGLPG----VGYPGPSGEKGFQGMP------------------------GTPGQAGFPGPQGVDG--------LPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPG-----FPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDA-----GPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGI---GIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGIS--------------------------------GVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTG--QDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGT--HTVTKGESGEPGPQGPSGP--RGIQGLPGPKGD------KGVTGASGLPGPSGIPG--IHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGS 1438          

HSP 3 Score: 185.267 bits (469), Expect = 3.592e-46
Identity = 314/938 (33.48%), Postives = 411/938 (43.82%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPG--------EVGEQGLRGLDGYSGKKGESGIHGDKGEKG--------LAGFSGPKGIKGERGDTG---LPGKEAEKI-----------------------------PGDKGIQGDVGE---LGDKGFKGEKGKNQNVNVLLTKYKGD-------------NGEKGVKGSQG---------------TAGFPGNKGSKGETGLSGI-PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGV---KGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKG----------------PKGFQGNIGERGNPG------IKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGY--------KGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGF------------------KGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEI---GEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDA---------GKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGI------EGDLGDKGVRGPQGLAGER 4389
            T+G+KG SG +G PG        EV E+G RGL G+ G KG+ G+ G +G  G        L G +GP G  GERG+ G   LPG   +                               PGD G+ G+ G+    G++G KG+KG       L+                   +G  G+KG +G               +AG  G+ G+KGE G     P   G  G SG  G  G  GR+G  G+DG++G  G+ G+ G    KG +G+ GDRG  G PGE+G  G  G                                        G  G  G +GE G  GF G+ G PG  A GE G                  GF G+ GE+G+PG       +G KG  G P +      G PG  G KGFQG+PG  G  G  GP G  GL G +GD GP+G         KGVQG  G +G+ G+ G+ G  G  GE+G  G+ G+ G KG  G +G+ G++G  G  G G KG +G  GPQG    SG+ G  G+ G++G  GFPG ++ G KG+KGN G  G  G  G                   KG++G +G+PGSIG  G  G  G  G+KG  G  G PG  G  G KG +G++G  G PG             + E+G++GEI   GEKG +G+ G  G  G  GQ G +G  G KG+ G  G+KG+                                                +G+ G+   G  G+ G  G TGEKG+ G  G           G++G +G  G  GIG+ GV G +GD G DG  G  G +G KGD G     PG  G  G KG  G  G  G  G+PG KG KG  G+      +G  GD GV+GP G +GE+
Sbjct:  316 TKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGT---------------------------------------GTSGLPGEKGEPGVPGFVGIPGTPG--AKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV------GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGL---SGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGS------------------------------------------------QGLQGQ--KGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGI----PGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEK 1149          

HSP 4 Score: 138.658 bits (348), Expect = 5.630e-32
Identity = 283/790 (35.82%), Postives = 365/790 (46.20%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQG-----PKGM---------IGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPG--------------QKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGL------------------------KGYKGLKGDT----IDISGNVTGVRGD------------RGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS----IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPG 2448
            G  GP GE GF G  G PG  G  G +G  G  G +G+ G KG+ G     PKG+          GDKG  G SG+ G++G  G+ G  G+ GE G  G PG              Q+G++G QG  G  G  G++GE+G  G  G  +P        +GDKG  G  G  G  G  G  G PG +G+ G+ G KG++G +G  G  G+P        S G +G+KGD G      ++        KG++G+RG PG   +      KG +G  G +G  G+ G +G LG  G  G PG++G  G  G  G  G++G  G +G QG +G  G+ G  GL                        KG KGLKG+     I I G V GV+GD            RG+KG+ GI G  G PG +G+ G +G+ G  G  G KG ++G         +     +GL G +G +G  GH G KG+ G  G+   G+ G KG  G+ G +G  G  GE G  G KGDIG  G      +PG +G +G+ G  G  G  G PG  G   E         G AG  G  G  G+PG  G DG+ GE GE+G  G  G  G  G  G +G  GD G  G  G KG  G   I      +G  G SGE+GD    G+QG+ G  G  G  G +G H     KG +G  GP+G  G RG  GLPG +     GDKG+ G  G  G  G  G  G             G  GE G  G  G  G+PG  GS G  G  G+PG
Sbjct:  689 GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMP------GPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQP----GAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPG-VPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKG-AKGTHGLVGIPGQ-----KGLTGDSGVQGPPGHSGEKGEPGYDGIP--GSPGEKGEAGIPG-RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGD---RGDQGITGPKGDLGPPGPAGTH--TVTKGESGEPGPQGPSGPRGIQGLPGPK-----GDKGVTGASGLPGPSGIPGIHGT-----------PGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPG 1437          

HSP 5 Score: 112.849 bits (281), Expect = 4.504e-24
Identity = 187/559 (33.45%), Postives = 240/559 (42.93%), Query Frame = 1
Query: 2128 GIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKG---------------------SKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF--------IGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNI------------------------GERGNPGIKGYKGN----------SGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-------PAGDGIKGMKG-------------------LIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGL 3534
            G  G KGE G++ F GPKG   ERGD G PG   +     +G + +    G+KG KG  G+N         +KG+ GE G  G +G  G  G++G                     +KGE G SG  G  G V ++G+      +  KG+ GL G  G +G+ G+KG +G  G+ G  G          GFPGE+G+ G  G+PG ++ GP G  G  G  G+ G  G                   T +  +SG  G  GL G+PG     GE+G KG +G+                         G  G PGIKG +G+                 L G  G  GE G   F+  P  KG KGE G  G  G  GR+G  G  G +G+ G KG+ G IG  G QG  GD G  G+ G +G+ G  G  G+ GL G KG  G       P   G KG  G                     G QG+KG  G+ G  G  G+KG  G PG    G  GEKG +G  G  G  GF G  G  GLPG  G  G +G+ GL
Sbjct:  204 GAPGPKGEMGIS-FYGPKG---ERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEI----EVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAID----------------TSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFE--PRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGT-GTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL 735          

HSP 6 Score: 110.153 bits (274), Expect = 2.930e-23
Identity = 284/951 (29.86%), Postives = 366/951 (38.49%), Query Frame = 1
Query: 2035 KGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGD---------TGLPGKEAEKIPGDKGIQGDVGEL------GDKGFKGEKG-------------KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGK--------------HGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF---------------IGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDK------GFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYK--------------------------------GIPGEIGPKGFQGLPGEKGFKGEIGPT---------------------GTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGE-------RGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI-------------GLLGVKG--------------ERGDPGPDGYEGQRGPKGPKGDKGFS----------------ILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            KG +GE G PG  G +G  G  G+ G  G  GI G  G  G +G  G  G KG+RG           G PG   +  PG KG  GD+  +      G+KGF G  G                          G +G  G KG  G + F G KG +G+ G  G P K              +G+ G  G  GE G  G+ G++   G +G  G +G +G  G +G +G++G                 G  GEKG+ G  G PG  ++                          + E  + GD+G  G  G  GDK      GF G+ G PG+   G  GP GF         PG +G KG  G P + L+G K                                G+PG  G  GFQG  G+KG KG+  P+                     G SG+ G KGD+G  GY G  G  G  G  G MGS G KG+ GE       +G  G  G  G  G  G  G  G+ G Q     G+ G KG+ G  G KGE G  G +G  G+ G +GFPG    G+ G  G K   GE GV GF      +G+PG+ G +G+ G+  +K                                 G  G +G +G      ++G+KG  G  G  G++G+KG  GL G VG  GP G KG  G  G  G                                   G  G +G+ G  GLRG  G       G  GP+G  G  G  G  GD G  G  G  G+QG              G++GV G              ++G  GP G  G  GP G KG++G++                I  PGP G TG+ G  G  G  G  G PG KGE G  G+ G +G  G  G  G  GE+
Sbjct:   71 KGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQ--PGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGIS-FYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQS-FKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVS------------------------NGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGF---------PGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQ-----GLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEK---GEPGVPGF------VGIPGTPGAKGEPGKAIIK--------------------------------TGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPG-VGYPGPSGEKGFQGMPGTPGQA---------------------------------GFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEK 904          

HSP 7 Score: 109.383 bits (272), Expect = 5.244e-23
Identity = 188/515 (36.50%), Postives = 241/515 (46.80%), Query Frame = 1
Query:  280 ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNS---GINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDK---GAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDL-----------------------GPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDI-SGNVTGVRGDRGE---------KGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGA 1686
            E   +G  G  G+ G  G  GK G +GV+G+ GP G  G +G +G +G QG KG IG+ G+ G +   G +G  G+PG  G  G  GE+G       KG  GL G  G+ G+PG++G+ GR GP G        LP ERGDK   G  G  G  G  G  G  G PG+ G+ G +G KG  G +G  G+KG       +    G  G+KG+ GY           E  I G    RG PG  G+ G+ G+KG  G  G+ G  G+ GI+GD                        GP G+ G+PG+ G PG PG  G+PG  G  G +G +G  G  GA G  G KG  G +G + D     +TG +GD G          KG  GI G++G  GD+G  G  G  GP G  G    ++G S              G  G +G RG QG  G KGDKGV G         + G  G  G  G TGP G TG  G  GP G  G  G +G  +PG+
Sbjct:  957 EIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGL------KGEVGLPGI-GIPGVPGVKGDAGRDGPHG--------LPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGL-TGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG----RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGE-----------PGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIG--LPGS 1438          

HSP 8 Score: 108.227 bits (269), Expect = 1.065e-22
Identity = 194/569 (34.09%), Postives = 249/569 (43.76%), Query Frame = 1
Query:  277 TECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEG---------------CCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKG---AKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLG-----------------PIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGM--DMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG----TSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDG 1860
            +E     + G KGE G  G  G  G +G  GD G PG  G+ G +G +G+ GPKG  G +G++G+ G+ G+KG+ G  G  G TGE+G                 G+ G KG  GL G  G+ G+PG++G+ GR GP G        LP ERGDKG     G  G  G  G  G  G PG+ G+ G +G KG  G +G  G+KG       +    G  G+KG+ GY           E  I G    RG PG  G+ G+ G+KG  G  G+ G  G+ GI+GD G                  I   G  GE G PG+                           AG  G  G  GL G T        G++G++GE+G  G  G +G  GD G++G SG  GP G  G KG +     PG  G KG     G+ G+ G RG+QG  G KGD G  G       TKG  G  G  GP G  G  G  GP G+KG  G  G    + IPG  G+                      G+KG       G +G  G  G+PG PG  G+ G
Sbjct:  938 SETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGI-GIPGVPGVKGDAGRDGPHG--------LPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGL-TGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPG----RGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQ---------------------------AGYPGSPGPVGLPGHT-----GQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGS---LGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTP---------------------GQKGET-----GPSGPTGQTGYPGPPGSDGLPG 1431          

HSP 9 Score: 104.76 bits (260), Expect = 1.479e-21
Identity = 211/635 (33.23%), Postives = 270/635 (42.52%), Query Frame = 1
Query:  289 CNGLLGPKGEMGFGGHEGKPGFRGVKGDRGP-------------------PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLP-QEGVL--------------PAERGDKGAKGFSGLKGEI---GEFGDVGEPG--------------NKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGK---HGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRS-----------------RGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------------------MIGTKGRKGVNGLT---GPKGDTGDAGEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSC---------FNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
             +GL G KGE G  G  G PG  G KG+ G                    PG  GEKG+ G+ G  G +G  G+ G+ G              G  G +GE+G  G PG  G AG  G  G+ G+PG++G+ G KG  G  LP  +GV               P   G  G +GFSG+ G     GE G VG PG               +G  G QG  G  G  G KGE+G       LD   G  GDKG+ G    T  T    +    G++G+ G PGP G+MG  G  G  G+ G+ G+ G  G +GD GP G     G PG  G  G+ G+ G PG+      E  +G +G+ G  G  G+ G KG  GD         D    V G  G +GEKG +GI G +G+ G +GS G+ GL GP GEKG  G S                 +G       G  G  G++G  G+ G  G  G +G KGD G+ GM                    + G KG KG +GL    G KG TGD+G  GP G  G+ G+ G   IPG+                         GEKG                G+ G++GD GFPG PG  G+ G+
Sbjct:  609 TSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPG-------------VGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGY-AGFPGLDMP-GPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSP------------------------GEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGI 1204          

HSP 10 Score: 98.2117 bits (243), Expect = 1.167e-19
Identity = 141/401 (35.16%), Postives = 183/401 (45.64%), Query Frame = 1
Query:  310 KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVLPAERGDKGAKG-----------------FSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGK----PGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGV 1425
            KG++G  G  G PG +G  G  G PG+ G  G +G KG  G  G+ G KG+ G+SG+ G  G  G KG  GY   +G  G PG+KG AG+ G  G+ G PG  GEKG KG  GF   P    +P  +GD+G  G                   G KGE G+ G  G PG+ G +G  G  G  G  G KGE+G P         +G+ G++G  G +  + +T         GQKG  GPPG  G  G  G+ G  G  G +G +G+ G +GDLGP G  G      GE+G PG                          G +G  G++G  G KGD        +     + G+ G  G+KGE G  G  G  G  G  G  GL GPIG  G+   + G 
Sbjct: 1083 KGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGY---DGIPGSPGEKGEAGIPGR-GLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWP-GAPGFQGFKGDTGNQGPSGDAGPSGIT---------GQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQ------------------------GPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAHGF 1445          

HSP 11 Score: 92.0485 bits (227), Expect = 8.887e-18
Identity = 192/536 (35.82%), Postives = 246/536 (45.90%), Query Frame = 1
Query:  298 LLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPK-----GFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGD-----VGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQG---PIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
            L G KGE G  GH G PG  G  G  G  G  G KG  G  G +G +G+ GD+G  GN G  G  G  G           G  G PG+KG  G+ G+ G+ G PG +GE G+   K               P ++G+KG+ G  G  G  GE G+     VG PG  G  G+QG  G  G+ GF G +G    +  L   RG+ G KG+ G             + + G KG++GPPGP G  GD G  G  G  G +G  G+ G  G  G  G  G PG       P      G +G  G  G QG  G  G AG  G +GY G  G       ++ G +GD+G  G  G  G  GIPG  G+ G  GL G   P GE G  G    + +PG  G  G  G +G  G  G  G  G+ G KG+KG +G+    G         + G KG+ G+ GE G  GEKG +GD G+  PG  G  G +G  G  G +G  G +G  G +G       G  G+ G+ G PG  GE+G  G+
Sbjct:  538 LKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAG----------TGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQG----VDGLPGLRGDPGPKGEPG-------------LGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQ----GPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGL------DMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGS--PGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGL-----QGQKGSIGEMGLPGPTGEKGQHGI 1029          

HSP 12 Score: 76.2554 bits (186), Expect = 6.121e-13
Identity = 157/466 (33.69%), Postives = 198/466 (42.49%), Query Frame = 1
Query:  382 PGALGEKGNEGY----KGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQ---EGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMI--------------GYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGV--------------RGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQ--GPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG 1668
            PGA GE G   +    KGD+G  G+ G  G  G  G                 G +G  G PG KG AG  G  G QG+PG +G  G  G +GF  P       LP E+G+ G  GF G+ G  G  G+ G    K +I              G+ GD+G+ G  G  G  G          S+GE G+ G  G  +              G+KG +         G  G  G  G  G +G +GL G+RGD GP G+ G     G PG  G+ G PG  G PG +G  G  G  G  G SG+ G+ G KG+   +   V G+              +G  G +G  G  G  G+ G+ G  G  GL   GP G+KGN G           GP G  G+ G  G  GK G  G  G KG+ GV  M M G+ G+ G  G  G  G+ GDAG  GP G  G  G  G
Sbjct:  523 PGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREG---------------RPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPG----KAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPG----------SQGEKGEPGLPGVGYPGP----------SGEKGFQ---------GMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL----GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIV--GVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSP---------GPTGATGIPGQPGAPGKEGLPGFPGPKGEMGV--MGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKG 923          

HSP 13 Score: 71.2478 bits (173), Expect = 2.124e-11
Identity = 154/444 (34.68%), Postives = 190/444 (42.79%), Query Frame = 1
Query: 2365 GVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKG------------LEGVKGDR---------GFIGFPGEKGDIGVTGVPGD----------------SITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGL-----RGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKG---------EIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGD 3543
            GVKG +G  G PG  G  G  GL G  G  G +G  G  GE G  G KG  G  G  G  GN G+ G+ G              G KGDR         G IG+PG  G  G  G PGD                 I G  G  G  G  G +G  G  G  G  G  G  G KG  G+     +GE GD+G  G    P     G +  + + G  GE+G PG  G +G    P  + KG KG PG +GP+G  G  G++G KG           GP G  G +G KG+ GPQG  G+    G I             +  E+G  G+ G+ G KG++G  G +G  G  G  G  + G  G  G  G++GE G  G+ GLA  +GPKG  G                      G  GD G  G PG  GFQG+ GQ+G KGD
Sbjct:   36 GVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQ---PGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEI-------------EVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLA-LQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGD 462          

HSP 14 Score: 56.9954 bits (136), Expect = 4.004e-7
Identity = 77/229 (33.62%), Postives = 95/229 (41.48%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQ------------GPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEV 942
            +G+ G KGE G+ G  G  GF+G  G++GP G  G  G  G KGD             G  G+ G+KG +G+ GI               TG +G  G PG  G   +    G  G PG QG  G +G +G        LP  +GDKG  G SGL G  G  G  G PG KG  G  G  G  G  G  G  G P          G IG  G    +    +TR +   
Sbjct: 1261 DGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGI---------------TGPKGDLGPPGPAGTHTV--TKGESGEPGPQGPSGPRGIQG--------LPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLP----------GPIGLPGSPSMAHGFLVTRHSQTT 1454          

HSP 15 Score: 56.9954 bits (136), Expect = 4.543e-7
Identity = 164/453 (36.20%), Postives = 209/453 (46.14%), Query Frame = 1
Query:  244 SAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGAL------GEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSF--TTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEG--LKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGR 1572
            S +A C+    ++C C+G+ G KGE G  G  G  GF G++G  GPPG L      GE G  G KG +GP G  G  G  G  GI G+ G PG  G  G  G +G  G  G  G  G+ GY G  G PG +GE G       S+         +G+KG  G +G+ G  G  G  G  G  G  G  G  G  G  G KGE G     IS    +GE GD+G  G     +T    + NE +  G+KG                KG  G  G +G  G   KG +G+ GP+G  GKPG++G  G+ G+ G+PG  G PGP G+ G +   G  G SG +G  G+     +I            E  EK   GDRG+PG  GS+GD GL+G  G  G  G S GV                L G TG  G  G +G KG  G+ G+ + G KGR
Sbjct:   19 SDSAACSGCGTSKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSM--------IKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMG-----ISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKG---------------EKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTK---GEKGESGPQGPPGIVVSNGEI------------EVCEK---GDRGLPGFPGSKGDKGLKGAQGFPGIPG-SPGVP---------------LPGSTGPPGFPGERGEKGQHGLPGLALQGPKGR 409          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Xenopus
Match: med27 (mediator complex subunit 27 [Source:Xenbase;Acc:XB-GENE-6054175])

HSP 1 Score: 246.128 bits (627), Expect = 8.713e-65
Identity = 165/448 (36.83%), Postives = 219/448 (48.88%), Query Frame = 1
Query: 4126 GVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGN------PGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMT-MGHNIKTMQSEDLIAKCLVCMRN 5445
            GVKG  GD    G +G  G KG  GD+G  +  PG  G  G KG KG  G  G  G+ G +G++G +G+ GD+G+ G++GP G  G                                         + GD G KGL+G+ G  G+ G       PG   P G +G+ G  G  G + FKG  G  G  GL                     PG  G +  N G +   HSQ+ + P CP     LW GYS L   G E+AH  DL   GSCLQ FS +PF++C   + C+Y+ RND++YWLS+   + M M +   +++ Y+SRC VCEAP+   A HSQ    P CP+GW +LW G SFLM+T  G  GGGQ LSSPGSCL  F+   F+EC   +G C Y+     FWL   D  + FQ +     +K       I++C VCM+N
Sbjct: 1307 GVKGVIGD---LGLQGNYGAKGIPGDEG-KVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQG----------------VQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGL---------------------PGMPGRSV-NIGYLLVKHSQTDEEPMCPVGMARLWTGYSLLYFEGQEKAHNQDLGLAGSCLQRFSTMPFLYCNPGDVCYYANRNDKSYWLSTTAPLPM-MPVVEEEIRPYISRCSVCEAPAVAIAVHSQDVSIPHCPDGWRSLWIGYSFLMHTAAGDEGGGQSLSSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTID--EPFQSSPPADTLKAGLIRTHISRCQVCMKN 1709          

HSP 2 Score: 204.527 bits (519), Expect = 5.281e-52
Identity = 428/1343 (31.87%), Postives = 545/1343 (40.58%), Query Frame = 1
Query:  163 CQRLMKLVLGLIVAVFWIIISLVQDSE----SAAAICNRSNCTE-CSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGM------QGIPGMQGEKGRKGPKG----FSLPQEGVLPAERGDKGAKGFSGLK------GEIGEFGDVGEPGNKGMIGYQGDKG-----------------------DIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIG----------KHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXI-GAAGNSGLKGYKGLKGDTID--ISGNVTGVRGDRGEKGEK-------------GIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGE---RGDTGLPGKEAEKIPGDKGIQGDV--------------------------------------GELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF------IGFPGEKGDIGVTGVPGDS----ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKG---------------------FTGLRGESGDKGFEGLVGD---PGILAI-GEKGPKGFQGNIGERGNP---GIKGYKGNSGFPDIT------------------------------------------------LKGYKGIPGEIGPKGFQGLPGEKGF----KGEIGPTGTSGLRGRKGDQGPQ------GYKGVQGQKGIIGMIGEMGSQGDKGDTGERG-SIGIQGYQGEKGNQGSLGL---KGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQR--GLKGDK 3546
            C +L    +   +    ++     ++     S    C   +C++ C C         +   G  G+PG  G +G  GPPG +G  G +G KGD+G +G  G  G  G+ G +G  G PG  G  G+TG+ G  GKPG  G  G QG  G+      +G PG+ G  G KG KG     S+  +  L   RG  G  GF G +      G  G  G  G  GN+G+ GY G+KG                       +I  L +KG KG+          +GE G+ GDKG    T            GQ+G  G  G  G  G+ G  G  G  G  G +G KG  GDLGP G          + G  GE G PG  G+ G  G  G PG  G  G      G  G++GLKG +G KG   D  +     G  G  G  G++             G+ G  G PG +G RG  G +G  G KG +G  R                 G  G  G  G QGH G KG+ G +G+   G  G  G  GL GP      AG  GP GEKGD                                          F    G  G +GD GFPG+PG  G  G NG DG                                                + G  GPSG+ G  G  G  G  GL G +G +GE+G  G        GF G KG++GE   RG +G PG     +PG  G QGD                                       G  G KGF G  G +      L   KGD G   + G  G +G  G++G+ G  GL G+PG  GK G  G  GEKG++G +    L    G QGN G+ G++GL+G +GD+G       +G PG  G+ G+ G PG      I GP    G  G  G  G  G +G +G  G  GQ GD+G                     F G+RG  G+ G  GLVG    PG+  I G  G +GFQG  G +G P   G+KG  GN GFP +                                                 LKG KG+PG  G  G  GLPG + F    KGE G  G  G +G  G+ GP       G+ G +G  GI G  G  G +G  GD GERG +I + G +G KG  G+ GL   +G+ G +G  GD G +G++G+IG  GQ GE G+ G QGL G  G +GFPG   + G KG  G  G  G+ G  G +G  G  GLPG+ G  GQ G    GLKG K
Sbjct:   19 CFQLQHYSVTWCMLFVVLVTCFAGNAHAGDKSYTGPCGGRDCSQGCQC---------LPEKGSRGQPGPLGGQGTSGPPGLIGIAGLQGRKGDKGERGFPGVTGPSGDKGQSGVTGFPGADGVPGHTGQGGPRGKPGHDGCNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGL-GYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGD----------QGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPA-----GEPGPVGFPGFQGHAGRKGEAGDRGVQ--GLPGAPGTVGLAGP------AGFPGPAGEKGD----------------------------------------KVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDG------------------------------------------------SPGFPGPSGD-GIKGLPGSHGFPGLPGNAGARGETGFPG-------PGFPGSKGLRGEPGNRGVSGFPG-----VPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFG--LKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDR----LGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFK 1221          

HSP 3 Score: 182.57 bits (462), Expect = 2.784e-45
Identity = 292/829 (35.22%), Postives = 369/829 (44.51%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKG-----------EKGLAGFSGPKGIKGERGDTGLPGKEAEK----IPGDKGIQGDVGELGDKGFKGEKG----------------KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQ-GNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKG------FQGLPGEKGFKGEIGPTG-TSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAG------DKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGP----------QGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSIL--YPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEG 4338
            G  G SG+RGD G  G  GL G+ G SGK G  G+ G+KG           E+G  G  G +G+KG +GD G+PG + +      PG+KGI+G  G  G  G  G                   +           +GD GEKG  G  G  G PG  G  G     G+ G+HG  G  G  G  G  G KG  G  G  G QG  G KG     G+KG  G IGFPG KG  G +G  GD                       K    +   KG+ GD+G +G +G SG KG +G+ G PG L + G  G + F+ G+ GE G PG+ G +G  G  ++   G  G PG  GP+G      F G+PGE+G  G+IG  G T  L G +G +G  G  G+ GQ+GI G   E G+ GD+G  G  G IG  G  GEKG  G  GL G  G+QG P   G+ G KG  G  G  G+ G+ G++G+AG       KG  G PG +I+G KG KG  G  G+ G          +G+PG  G +G EG +GL G  G  G  G  G  G     G  G  GPPG PG  G  G  G     ++ G KG IG+ G  GN G KG  G  G+VG  G  G  G  G  G  G                                                 +G  G S  G RG +GP+G  G+ GE G  G  G+ GP          QG  G  GI  +G +G +GD GP G  G  G  G  G +G   +  +P P G  G +GP   +G  GP G  G+ G  G  G+ G
Sbjct:  731 GPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGG---FIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDR------------GEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILG--EVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHG---EKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTI-----VGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAG------------------------------------------------FQGFVGVS--GYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGI--IGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGP---MGRTGPNGFKGASGVPGRAGLPG 1479          

HSP 4 Score: 171.785 bits (434), Expect = 4.976e-42
Identity = 199/548 (36.31%), Postives = 259/548 (47.26%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGE---QGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK-------IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHG-KVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGP--------QGYKGVQGQKG-------IIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG----------------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            +G  GP+G +G PGE+G     G+RG  G  G  G  G+HG  G KG+ G  G +G +G +G  G P     K        PG KG  G  G  GD+G +G  G    +  ++   KG+ G++GV G +G +G  G+KG  G  G  G+PG  G +    G  GE G  G  G  G+ G  G  G +G  G  G  G  G  GF G PGE+G  G  G  GD+I  P                               G +G  G +G +GD+GF G+ G      IGE G  G +G  G++G   + G+ G+ GFP     G  G+PGE G  GF GLPG+ GF G  G  G  GL G KG  G         +G+KG+ G KG       I+GM G  GS+G +GD G  G IG+ G  G +G  G     GL G+ G                P      G+KG+IG  G +G  G KG+    GD+G  G PG   I G+KG KG+ G  G +GV G++GD GP GL G IG  G +G  G  G
Sbjct:  873 KGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLP----------------GQRGIHGEKGTTGDEGFRGIEG-----VIGEHGQTGEKGFPGQQG---LVGFPGSQGFP-----GLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGI---PGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPG 1388          

HSP 5 Score: 169.088 bits (427), Expect = 3.015e-41
Identity = 297/886 (33.52%), Postives = 379/886 (42.78%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGK--KGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKI------------------------PGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF------IGFPGEKGDIGVTGVPGDS----ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIG--------MIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMG----VKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG-------RSSNGERGQ-----RGPQGNTGEKGEKGE----FGDAGKRGPQGPAGDQG----IGLLGVKGERGDPGPD---------------------------GYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            +G KG  G  G PG  G  G RG  G+ G    G  G+ G+ G +G++GF G  G+ G +GD      E  +I                        PG  GI+G  G  G  GF G  G        L   KGD G   + G  G +G  G++G+ G  GL G+PG  GK G  G  GEKG++G +    L    G QGN G+ G++GL+G +GD+G       +G PG  G+ G+ G PG      I GP    G  G  G  G  G +G +G  G  GQ GD+G      E G  G  G+ G PG L +G     GF G  G  GNPGI G  G  G P +  KG KG PG  G +G +G  G   ++G  GP+G  G  G KG  G  G KG +G++G  G        M+   G  GD+G +G +G  G++G +G  G  G LGL GL G +    GD G  G  G+IG QG  GE G  G+ G  G  GP+G PG +   G  GE+G  G IGE G    + G +G  G  G PG  G +G  G++G  GD                                             E  RG +G IGE G+ G KG  G +GL G  G +G  G  G  GE G  G                                      G+ G  G  G+RGI+G       +  NG+ G      +G +G +G KG+ GE     G  G  G +G  GDQG    IGL G  G RG PG                             G   + G KG  GD G    Y    G  G+ G +G+VG  G  GIPG+KG KG  G +G +G  G RG QG  G R
Sbjct:  597 DGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFG--------LKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDR----LGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEG------EKGPPGPAGMKGLPGELGVG-----GFIGVRGRHGNPGIPGLVGMHGLPGV--KGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGD---------------------------------------------EGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSG------------------------------------FPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNY----GAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLR 1372          

HSP 6 Score: 169.088 bits (427), Expect = 3.226e-41
Identity = 293/943 (31.07%), Postives = 368/943 (39.02%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNM--------------------------------------GIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGIL-------AIGEKG--------PKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGL---------------------------RGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN---IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI----GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFS-----ILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNP 4575
            EGD+   G  G+PG VG  G +G  G  G+ G+ G+ G  G  G  G +GP G  G  G+ G      EK  G KG QGD G  G  G  G  G+N             +G KG+ GS G  G PGN G++GETG  G     G  G+ G  GE GN G  G  G+ G  G QG+                                       GI+G KG  G  G  G  G  G KGD G      DS+ GP                                  GF+G RG+ G+ G  GL G PG+          GEKG        P G QGN G  G  G+KG +G+ G P   L+G  G PG  G KG +G PG  G  G  GP    G                             G KG  GP G KG+ G+ G+ G IG  G  G+ G  G  G  G+ G +G KG+ G  G +G+KG +G PA  G+KG  G IG  G KG +G  G +G  G++GP G P K    ++ +KGE G++G  G  G+ G KG  G  G PG      Q G  GL G +                                                    E G+KGE G  G  GN+G+ G+VG +G  G+ G  G  G                                                     GISG    G  G+RG  G+ GE+G+  +    G+RG +G  G  G+    G+ G KG  GD G  G EG  G  G  G+KGF      + +PG QG  G+ G  GE GS G  G+PG  G  G RGI G  G  G +G  G  G   +          G           G  G  G KG+      GD+G  GL+G  G  G +G P
Sbjct:  490 EGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEK--GSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPG----PGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGT-----DSLPGP---------------------------------PGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPG--LQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPG------QLGLPGLPGLRSF--------------------------------------------------EFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTP---------------------------------------------------GISGFP--GVPGERGKYGDIGERGDTIDL--PGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAE-----GDQGLPGLIGLPGTVGVRGLP 1270          

HSP 7 Score: 168.703 bits (426), Expect = 4.487e-41
Identity = 295/927 (31.82%), Postives = 382/927 (41.21%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGD-------------KGFKGEKG-----------------KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKG----SKGETGLSGIPGKHGKVGNSGKDGEKGNM-GRKGENGLDGRRGRQGNMGIKGVKGLE-------------GVKGDRGFIGFP---------GEKGDIGVTGVPGDS----ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKG-------------EIGPTGT----------------------SGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIG-----PQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKG---------EIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEK---GEFGDAGKRGPQGP-----------------AGDQGI----GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGI---PGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            +G+KG  G++G P   GE+G  G+ G+ G++G  G  G+ G  G  GF G  G+ G              +PG KG +G+VG+LG              KG++GE G                      N   +++ G  G+ G+KG +G  G+ G+ G      G  G+ G PGK G  G  G  G +  M G  G  G DG+RG  G+ G++G+KG +             G  G+ G +GFP         GE GD GV G+PG      + GP G  G  G+ G      +KG  G +      GD GF G+ G  G  G  G  G PG       G KG  G+ G  G PG  G +G +GFP     G KG+ GE G +G  G PG  G  G             EIG  GT                      +G+RG+KG  GP G+ GV G KGI         +GD+G     G  G  G +G++GN G  GL G+ G  G P   G++G KG +G     P G++G +G  G+QGL G +G +G PG +  +G+ G  GNKG  G  G  G  G  GP  L    GF G  G  G  G +                              G  G  G  G    E E+G  G         E+G  G +G +G  GN G+ G VG  G  G KG  G  GM+G                                               G++G  GR +   RG +GP GN G  G K   G  G  G RG QGP                  GDQG+    G+ G+KG +G PGP    GQ G  G  G + F     G  G  GV G +G +G VGP GI   PG  G +G  GI G  G  G RG  G  GER
Sbjct:  278 QGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPG--------------LPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQ------GDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGI---------KGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAAL---FGFPGMPGNPGTPGPQ------------------------------GSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEG---------------------------------------------FQGMKGAKGRPA--WRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGP---PGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGER 1092          

HSP 8 Score: 163.31 bits (412), Expect = 1.688e-39
Identity = 287/828 (34.66%), Postives = 362/828 (43.72%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGD--KGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKN--QNVNVLLTKYKGDNGEKGV----------------------KGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGL------RGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGK---NIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLK-GDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEK-------GEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSS-NGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI----GLLGVKGERGDPGPD-----GYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLG 4347
            +G KG  G+ G PG  G  G  G +G  G  G  G  GD  KG  G  GF G  G  G RG+TG PG      PG KG++G+ G  G  GF G  G +  Q      T  + + G++G                        G +G  GFPG  G  G  GL GI             G++G     G  G  G+RG +GN G+ G+ G+ G+ G  GF G  GEKG +      GD +  P                               G++G TGL G  G KG +G  G PG+           QG +G  G PG KG KG+ G P     G  GIPG     GF G+PG  G  G  G  G  G        G KG  GP G KG+ G+ G+ G IG  G  G+ G  G  G  G+ G +G KG+ G  G +G+KG +G PA  G+KG  G IG  G KG +G  G +G  G++GP G P K    ++ +KGE G++G  G  G+ G KG  G  G PG +G  G  G R  + GDKG TG PG  G +G  G  GP G  G PG  G +G+ G SG      ERG  G+IGE+       GE G KG  G  GL GQ G  G KG  G  G  G++G IG  G+ G                                        +G  G+    G  G +G  G  G  GEKG  G  G  G  G  G +GI    GL G KG  G PG D     G++G  G KG  G+    +  PGP G  G +G +G  G +   G+PG+ G +G  G     G
Sbjct:  559 KGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGP---GFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGI------------KGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSV------GDRLGAPS------------------------------GEQGNTGLPGLQGLKGTQGDQGIPGL-----------QGKVGTPGTPGNKGIKGSPGAP-----GVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGE---------------------------------------KGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLI---GLPGTVGVRGLPGFSNKTG 1277          

HSP 9 Score: 158.303 bits (399), Expect = 7.080e-38
Identity = 197/562 (35.05%), Postives = 250/562 (44.48%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDP-----------GEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIK-GERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQG----TAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGN-------PGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQG------------------------------LPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGP--------AGDGIKGMKGLIGPQGQKGESGYKGV---QGLAGDKGPKGFPG----KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIG 3504
            T+GD+G  G  GDP           GE G+QG+ G  G SG KG  G+ G  G+ GL G  G +  + G++G+TG PG     + G++GI G+VG  G  GF G  G      +  + + G  GE+G  G  G    T   PG +G+KG+ G  G+PG+ G  G  G  G++G  G +G  G  G+ G +G  G +G+ G  G +G  G  G PGEKG  G  G+PG                                   Q G  G  G+ G  G  G +G+ G PG   IG KG KG  G  G+ G        PG  G KG  G  D  L G  G+PG +G +G  G                              LP + G KG IG  G  G  G KG  G +G  GV G  GI G  G  GS G +G  G  G  G QG +G +G+ G  GLKG  G  GP        A  G  G  G+IG QG +G+ G KG+    G  G  G +G PG        GS+GE+G  GR G  G KG  G  G  GLPG  G
Sbjct:  965 TKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPG-----VIGNQGILGEVGPDGIIGFPGFTGPRGTPGI--SGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPG-----------------------------------QHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEG--DQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPG 1482          

HSP 10 Score: 145.976 bits (367), Expect = 3.883e-34
Identity = 297/992 (29.94%), Postives = 389/992 (39.21%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPG---------EVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAE-KIPGDKGIQGDVGELGDK-----------------------GFKGEKG------------------KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENG---LDGRRGRQGNMGIKGVKG-LEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLV----GDPGI-----------------LAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFP--------DITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKG------LIGPQGQKGESGY--------KGVQGLAGDKGPKGFPG-KNIMGSKG----EKGNKGRIGEMGV-------------------KGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSN----GERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGY---------------EGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPG 4578
             GDKG SG  G PG         + G +G  G DG +G +G++G+ G  G +G  G SG  G KG++G+      E + ++ G +G  G  G +G +                       G+ GEKG                  +   + +LL +YKG  G++G KG+ G  G P   G KGE G++G PG+ G  GN G  G  G +G  G NG   L G +G++G +G  G +G +  V G +   G+ GE G  G+ GV                D           +       GQ GD G  G RG  G +G  GL     G PGI                   IG KG  GF G  G+RG PG +G +G  G          D   +G  G PG +G  GFQG  G KG  G+ G  G  G  G  G  GP G+ G  G+KG      E GS+G +GD+G  G  G  GY G  G  GS G  G      P+GDGIKG+ G      L G  G +GE+G+        KG++G  G++G  GFPG   + G +G    E   +  IG+ G                     G+ G  G  G PG  GF G  G +G+KGD                                                RG     G  G  G +GD+GN GL G  G  G  G  G  G  G KG++G +                                           L+G+ G   +    G +G+ G  G  G KG KG  G  G  G  GPA      L G  G  G+PG  G                EG++GP GP G KG         GE GV G  G  G  G  GIPG  G  G  G++G  G  G+ G QG+ G +G   ++G  G  G+ G                        PG KG  G  G++GD+GE+G PG
Sbjct:  115 SGDKGQSGVTGFPGADGVPGHTGQGGPRGKPGHDGCNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGDQGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGV-------------YGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPG------PSGDGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGD------------------------------------------------RGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPG----------------------------LQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAA-----LFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLP-------GELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIG-----------------------FPGVKGGNGTSGTKGDRGEQGPPG 976          

HSP 11 Score: 105.145 bits (261), Expect = 1.057e-21
Identity = 164/498 (32.93%), Postives = 225/498 (45.18%), Query Frame = 1
Query:  235 DSESAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGN-------EGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKG---QKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-IPG 1683
            ++ +   I N+    E   +G++G  G  G  G  G  GF GV G+RG  G +GE+G+        G KG  G  G+ G +G+ G  G  G +G  G++G  G  G+ G  G PGQ+G  G  G  G  G+PG+ GEKG  G  G        LP + G  G +G +GL G  G  G  G+PG   +IG +G KG  G    KG+ GE   ++ +    G  G +GD+G      L  T     + G   + G+ G  GP G  G  G  G  GR G     G+KG+ GDLG  G +G  G  G  GK                        +G  G +G+ G KGLKG +    G V GV G RG++G KG+ GD          G+ GL+GP G+ G       ++                 G  G  G  GH+G++GD G KG+       G  G++G+ G+ G     G  GE GP+G  G  G  G S +PG
Sbjct: 1037 ETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPG--------LPGQHGFPGIRGIAGLDGLPGTKGINGQPGAD-IIGLKGFKGLSGG---KGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGK------------------------VGVPGLAGIPGAKGLKG-SAGFQGFV-GVSGYRGDQGPKGLRGD---------IGEYGLKGPPGQPGPMSEPPLITAE--------------QGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPG 1473          

HSP 12 Score: 101.293 bits (251), Expect = 1.466e-20
Identity = 178/488 (36.48%), Postives = 232/488 (47.54%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLD-KSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYE----GRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDS---GLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGD------KGVKGMD-MIGTK-----------GRKGVNGLTGPKGDTGDA----GEAGPIGEKGDIGDVG 1668
            G+ GP    GF G  G PG  G +G  GPPG  G++G+E   G++GP G  G KG+ G  G+                   G  G  G+ G  G+ G  GM G+PG++G KG  G +GF           +G KGAKG    +G  G  G++G PG KG  G  G KGD GE   +G  G+P KM  +   ++GE GD+G  G+   + L         KG KG+ GPPG  G  G  G + +E    G  G+ G  G +GI G++GP G  G PG  G  G PGI G P                  G  G  G  G  G +GDTID+ G     RG +G+ G  G+ G RGI G++G+ GD    G++G IGE G  G      + G  G  G +G  GL G  G++G  G  GL G       +G+ G+D + GTK           G KG  GL+G KG  G+A    G  GP G KG  GD G
Sbjct:  832 GIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDE---GEKGPPGPAGMKGLPGELGVG------------------GFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGF-----------QGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGE---QGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGL---------KGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFP------------------GVPGERGKYGDIGERGDTIDLPGE----RGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQG 1253          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Xenopus
Match: med27 (mediator complex subunit 27 [Source:Xenbase;Acc:XB-GENE-6054175])

HSP 1 Score: 246.128 bits (627), Expect = 9.216e-65
Identity = 165/448 (36.83%), Postives = 219/448 (48.88%), Query Frame = 1
Query: 4126 GVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGN------PGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMT-MGHNIKTMQSEDLIAKCLVCMRN 5445
            GVKG  GD    G +G  G KG  GD+G  +  PG  G  G KG KG  G  G  G+ G +G++G +G+ GD+G+ G++GP G  G                                         + GD G KGL+G+ G  G+ G       PG   P G +G+ G  G  G + FKG  G  G  GL                     PG  G +  N G +   HSQ+ + P CP     LW GYS L   G E+AH  DL   GSCLQ FS +PF++C   + C+Y+ RND++YWLS+   + M M +   +++ Y+SRC VCEAP+   A HSQ    P CP+GW +LW G SFLM+T  G  GGGQ LSSPGSCL  F+   F+EC   +G C Y+     FWL   D  + FQ +     +K       I++C VCM+N
Sbjct: 1319 GVKGVIGD---LGLQGNYGAKGIPGDEG-KVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQG----------------VQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGL---------------------PGMPGRSV-NIGYLLVKHSQTDEEPMCPVGMARLWTGYSLLYFEGQEKAHNQDLGLAGSCLQRFSTMPFLYCNPGDVCYYANRNDKSYWLSTTAPLPM-MPVVEEEIRPYISRCSVCEAPAVAIAVHSQDVSIPHCPDGWRSLWIGYSFLMHTAAGDEGGGQSLSSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTID--EPFQSSPPADTLKAGLIRTHISRCQVCMKN 1721          

HSP 2 Score: 211.075 bits (536), Expect = 5.512e-54
Identity = 430/1351 (31.83%), Postives = 548/1351 (40.56%), Query Frame = 1
Query:  163 CQRLMKLVLGLIVAVFWIIISLVQDSE----SAAAICNRSNCTE-CSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGM------QGIPGMQGEKGRKGPKG--FSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGE--------------LGFKGEKG--------------------EPVKMISLDK-----SRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIG----------KHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXI-GAAGNSGLKGYKGLKGDTID--ISGNVTGVRGDRGEKGEK-------------GIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGE---RGDTGLPGKEAEKIPGDKGIQGDV--------------------------------------GELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF------IGFPGEKGDIGVTGVPGDS----ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKG---------------------FTGLRGESGDKGFEGLVGD---PGILAI-GEKGPKGFQGNIGERGNP---GIKGYKGNSGFPDIT------------------------------------------------LKGYKGIPGEIGPKGFQGLPGEKGF----KGEIGPTGTSGLRGRKGDQGPQ------GYKGVQGQKGIIGMIGEMGSQGDKGDTGERG-SIGIQGYQGEKGNQGSLGL---KGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQR--GLKGDK 3546
            C +L    +   +    ++     ++     S    C   +C++ C C         +   G  G+PG  G +G  GPPG +G  G +G KGD+G +G  G  G  G+ G +G  G PG  G  G+TG+ G  GKPG  G  G QG  G+      +G PG+ G  G KG KG  F +  E V    RGD G  GF+G++G        G PG  G IG QG +G  G               LG+ GEKG                      ++++ L        +GE G+ GDKG    T            GQ+G  G  G  G  G+ G  G  G  G  G +G KG  GDLGP G          + G  GE G PG  G+ G  G  G PG  G  G      G  G++GLKG +G KG   D  +     G  G  G  G++             G+ G  G PG +G RG  G +G  G KG +G  R                 G  G  G  G QGH G KG+ G +G+   G  G  G  GL GP      AG  GP GEKGD                                          F    G  G +GD GFPG+PG  G  G NG DG                                                + G  GPSG+ G  G  G  G  GL G +G +GE+G  G        GF G KG++GE   RG +G PG     +PG  G QGD                                       G  G KGF G  G +      L   KGD G   + G  G +G  G++G+ G  GL G+PG  GK G  G  GEKG++G +    L    G QGN G+ G++GL+G +GD+G       +G PG  G+ G+ G PG      I GP    G  G  G  G  G +G +G  G  GQ GD+G                     F G+RG  G+ G  GLVG    PG+  I G  G +GFQG  G +G P   G+KG  GN GFP +                                                 LKG KG+PG  G  G  GLPG + F    KGE G  G  G +G  G+ GP       G+ G +G  GI G  G  G +G  GD GERG +I + G +G KG  G+ GL   +G+ G +G  GD G +G++G+IG  GQ GE G+ G QGL G  G +GFPG   + G KG  G  G  G+ G  G +G  G  GLPG+ G  GQ G    GLKG K
Sbjct:   19 CFQLQHYSVTWCMLFVVLVTCFAGNAHAGDKSYTGPCGGRDCSQGCQC---------LPEKGSRGQPGPLGGQGTSGPPGLIGIAGLQGRKGDKGERGFPGVTGPSGDKGQSGVTGFPGADGVPGHTGQGGPRGKPGHDGCNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIE-VKNRLRGDPGEAGFNGIQGP------RGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGDQGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPA-----GEPGPVGFPGFQGHAGRKGEAGDRGVQ--GLPGAPGTVGLAGP------AGFPGPAGEKGD----------------------------------------KVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDG------------------------------------------------SPGFPGPSGD-GIKGLPGSHGFPGLPGNAGARGETGFPG-------PGFPGSKGLRGEPGNRGVSGFPG-----VPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFG--LKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDR----LGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFK 1233          

HSP 3 Score: 175.252 bits (443), Expect = 3.957e-43
Identity = 254/681 (37.30%), Postives = 319/681 (46.84%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKG-----------EKGLAGFSGPKGIKGERGDTGLPGKEAEK----IPGDKGIQGDVGELGDKGFKGEKG----------------KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPG---------EKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQ-GNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPK------GFQGLPGEKGFKGEIGPTG-TSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLA------GDKGPKGFPGKNIMGSKGEKGNKG----------RIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEM---------------GNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKG 3828
            G  G SG+RGD G  G  GL G+ G SGK G  G+ G+KG           E+G  G  G +G+KG +GD G+PG + +      PG+KGI+G  G  G  G  G                   +           +GD GEKG  G  G  G PG  G  G     G+ G+HG  G  G  G  G  G KG  G  G  G QG  G KG     G+KG  G IGFPG          KGD G  G PGD    P                       +   KG+ GD+G +G +G SG KG +G+ G PG L + G  G + F+ G+ GE G PG+ G +G  G  ++   G  G PG  GP+      GF G+PGE+G  G+IG  G T  L G +G +G  G  G+ GQ+GI    GE G+ GD+G  G  G IG  G  GEKG  G  GL G  G+QG P   G+ G KG  G  G  G+ G+ G++G+A      G KG  G PG +I+G KG KG  G           +G  G  G KG  G  GLPG IG  G  G RGL G    TG  G  G  GP G  G  G  G PG+P   G  G  GD   +   G KG  G++G++               G+ G +G  G+SG  GD+GPKG +G  GE G+KG
Sbjct:  743 GPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGG---FIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMP---------------------EMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILG--EVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGI---HGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKG 1394          

HSP 4 Score: 171.4 bits (433), Expect = 5.779e-42
Identity = 199/548 (36.31%), Postives = 259/548 (47.26%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGE---QGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK-------IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHG-KVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGP--------QGYKGVQGQKG-------IIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG----------------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            +G  GP+G +G PGE+G     G+RG  G  G  G  G+HG  G KG+ G  G +G +G +G  G P     K        PG KG  G  G  GD+G +G  G    +  ++   KG+ G++GV G +G +G  G+KG  G  G  G+PG  G +    G  GE G  G  G  G+ G  G  G +G  G  G  G  G  GF G PGE+G  G  G  GD+I  P                               G +G  G +G +GD+GF G+ G      IGE G  G +G  G++G   + G+ G+ GFP     G  G+PGE G  GF GLPG+ GF G  G  G  GL G KG  G         +G+KG+ G KG       I+GM G  GS+G +GD G  G IG+ G  G +G  G     GL G+ G                P      G+KG+IG  G +G  G KG+    GD+G  G PG   I G+KG KG+ G  G +GV G++GD GP GL G IG  G +G  G  G
Sbjct:  885 KGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLP----------------GQRGIHGEKGTTGDEGFRGIEG-----VIGEHGQTGEKGFPGQQG---LVGFPGSQGFP-----GLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGI---PGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPG 1400          

HSP 5 Score: 169.088 bits (427), Expect = 3.413e-41
Identity = 300/889 (33.75%), Postives = 381/889 (42.86%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGK--KGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKI------------------------PGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF------IGFPGEKGDIGVTGVPGDS----ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKG---FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIG--------MIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMG----VKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG-------RSSNGERGQ-----RGPQGNTGEKGEKGE----FGDAGKRGPQGPAGDQG----IGLLGVKGERGDPGPD---------------------------GYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            +G KG  G  G PG  G  G RG  G+ G    G  G+ G+ G +G++GF G  G+ G +GD      E  +I                        PG  GI+G  G  G  GF G  G        L   KGD G   + G  G +G  G++G+ G  GL G+PG  GK G  G  GEKG++G +    L    G QGN G+ G++GL+G +GD+G       +G PG  G+ G+ G PG      I GP    G  G  G  G  G +G +G  G  GQ GD+G      E G  G  G+ G PG L +G     GF G  G  GNPGI G  G  G P     G KGI G  G +GFQG+ G KG   ++G  GP+G  G  G KG  G  G KG +G++G  G        M+   G  GD+G +G +G  G++G +G  G  G LGL GL G +    GD G  G  G+IG QG  GE G  G+ G  G  GP+G PG +   G  GE+G  G IGE G    + G +G  G  G PG  G +G  G++G  GD                                             E  RG +G IGE G+ G KG  G +GL G  G +G  G  G  GE G  G                                      G+ G  G  G+RGI+G       +  NG+ G      +G +G +G KG+ GE     G  G  G +G  GDQG    IGL G  G RG PG                             G   + G KG  GD G    Y    G  G+ G +G+VG  G  GIPG+KG KG  G +G +G  G RG QG  G R
Sbjct:  609 DGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFG--------LKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDR----LGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEG------EKGPPGPAGMKGLPGELGVG-----GFIGVRGRHGNPGIPGLVGMHGLP-----GVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGD---------------------------------------------EGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSG------------------------------------FPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNY----GAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLR 1384          

HSP 6 Score: 169.088 bits (427), Expect = 3.810e-41
Identity = 293/943 (31.07%), Postives = 368/943 (39.02%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNM--------------------------------------GIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGIL-------AIGEKG--------PKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGL---------------------------RGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN---IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI----GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFS-----ILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNP 4575
            EGD+   G  G+PG VG  G +G  G  G+ G+ G+ G  G  G  G +GP G  G  G+ G      EK  G KG QGD G  G  G  G  G+N             +G KG+ GS G  G PGN G++GETG  G     G  G+ G  GE GN G  G  G+ G  G QG+                                       GI+G KG  G  G  G  G  G KGD G      DS+ GP                                  GF+G RG+ G+ G  GL G PG+          GEKG        P G QGN G  G  G+KG +G+ G P   L+G  G PG  G KG +G PG  G  G  GP    G                             G KG  GP G KG+ G+ G+ G IG  G  G+ G  G  G  G+ G +G KG+ G  G +G+KG +G PA  G+KG  G IG  G KG +G  G +G  G++GP G P K    ++ +KGE G++G  G  G+ G KG  G  G PG      Q G  GL G +                                                    E G+KGE G  G  GN+G+ G+VG +G  G+ G  G  G                                                     GISG    G  G+RG  G+ GE+G+  +    G+RG +G  G  G+    G+ G KG  GD G  G EG  G  G  G+KGF      + +PG QG  G+ G  GE GS G  G+PG  G  G RGI G  G  G +G  G  G   +          G           G  G  G KG+      GD+G  GL+G  G  G +G P
Sbjct:  502 EGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEK--GSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPG----PGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGT-----DSLPGP---------------------------------PGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPG--LQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPG------QLGLPGLPGLRSF--------------------------------------------------EFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTP---------------------------------------------------GISGFP--GVPGERGKYGDIGERGDTIDL--PGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAE-----GDQGLPGLIGLPGTVGVRGLP 1282          

HSP 7 Score: 168.703 bits (426), Expect = 4.910e-41
Identity = 295/927 (31.82%), Postives = 382/927 (41.21%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGD-------------KGFKGEKG-----------------KNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKG----SKGETGLSGIPGKHGKVGNSGKDGEKGNM-GRKGENGLDGRRGRQGNMGIKGVKGLE-------------GVKGDRGFIGFP---------GEKGDIGVTGVPGDS----ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKG-------------EIGPTGT----------------------SGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIG-----PQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKG---------EIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEK---GEFGDAGKRGPQGP-----------------AGDQGI----GLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGI---PGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            +G+KG  G++G P   GE+G  G+ G+ G++G  G  G+ G  G  GF G  G+ G              +PG KG +G+VG+LG              KG++GE G                      N   +++ G  G+ G+KG +G  G+ G+ G      G  G+ G PGK G  G  G  G +  M G  G  G DG+RG  G+ G++G+KG +             G  G+ G +GFP         GE GD GV G+PG      + GP G  G  G+ G      +KG  G +      GD GF G+ G  G  G  G  G PG       G KG  G+ G  G PG  G +G +GFP     G KG+ GE G +G  G PG  G  G             EIG  GT                      +G+RG+KG  GP G+ GV G KGI         +GD+G     G  G  G +G++GN G  GL G+ G  G P   G++G KG +G     P G++G +G  G+QGL G +G +G PG +  +G+ G  GNKG  G  G  G  G  GP  L    GF G  G  G  G +                              G  G  G  G    E E+G  G         E+G  G +G +G  GN G+ G VG  G  G KG  G  GM+G                                               G++G  GR +   RG +GP GN G  G K   G  G  G RG QGP                  GDQG+    G+ G+KG +G PGP    GQ G  G  G + F     G  G  GV G +G +G VGP GI   PG  G +G  GI G  G  G RG  G  GER
Sbjct:  290 QGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPG--------------LPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQ------GDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGI---------KGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAAL---FGFPGMPGNPGTPGPQ------------------------------GSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEG---------------------------------------------FQGMKGAKGRPA--WRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGP---PGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGER 1104          

HSP 8 Score: 163.31 bits (412), Expect = 2.150e-39
Identity = 287/828 (34.66%), Postives = 362/828 (43.72%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGD--KGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKN--QNVNVLLTKYKGDNGEKGV----------------------KGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGL------RGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGK---NIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLK-GDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEK-------GEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSS-NGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGI----GLLGVKGERGDPGPD-----GYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLG 4347
            +G KG  G+ G PG  G  G  G +G  G  G  G  GD  KG  G  GF G  G  G RG+TG PG      PG KG++G+ G  G  GF G  G +  Q      T  + + G++G                        G +G  GFPG  G  G  GL GI             G++G     G  G  G+RG +GN G+ G+ G+ G+ G  GF G  GEKG +      GD +  P                               G++G TGL G  G KG +G  G PG+           QG +G  G PG KG KG+ G P     G  GIPG     GF G+PG  G  G  G  G  G        G KG  GP G KG+ G+ G+ G IG  G  G+ G  G  G  G+ G +G KG+ G  G +G+KG +G PA  G+KG  G IG  G KG +G  G +G  G++GP G P K    ++ +KGE G++G  G  G+ G KG  G  G PG +G  G  G R  + GDKG TG PG  G +G  G  GP G  G PG  G +G+ G SG      ERG  G+IGE+       GE G KG  G  GL GQ G  G KG  G  G  G++G IG  G+ G                                        +G  G+    G  G +G  G  G  GEKG  G  G  G  G  G +GI    GL G KG  G PG D     G++G  G KG  G+    +  PGP G  G +G +G  G +   G+PG+ G +G  G     G
Sbjct:  571 KGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGP---GFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGI------------KGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSV------GDRLGAPS------------------------------GEQGNTGLPGLQGLKGTQGDQGIPGL-----------QGKVGTPGTPGNKGIKGSPGAP-----GVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGE---------------------------------------KGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLI---GLPGTVGVRGLPGFSNKTG 1289          

HSP 9 Score: 157.918 bits (398), Expect = 7.486e-38
Identity = 197/562 (35.05%), Postives = 250/562 (44.48%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDP-----------GEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIK-GERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQG----TAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGN-------PGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQG------------------------------LPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGP--------AGDGIKGMKGLIGPQGQKGESGYKGV---QGLAGDKGPKGFPG----KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIG 3504
            T+GD+G  G  GDP           GE G+QG+ G  G SG KG  G+ G  G+ GL G  G +  + G++G+TG PG     + G++GI G+VG  G  GF G  G      +  + + G  GE+G  G  G    T   PG +G+KG+ G  G+PG+ G  G  G  G++G  G +G  G  G+ G +G  G +G+ G  G +G  G  G PGEKG  G  G+PG                                   Q G  G  G+ G  G  G +G+ G PG   IG KG KG  G  G+ G        PG  G KG  G  D  L G  G+PG +G +G  G                              LP + G KG IG  G  G  G KG  G +G  GV G  GI G  G  GS G +G  G  G  G QG +G +G+ G  GLKG  G  GP        A  G  G  G+IG QG +G+ G KG+    G  G  G +G PG        GS+GE+G  GR G  G KG  G  G  GLPG  G
Sbjct:  977 TKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPG-----VIGNQGILGEVGPDGIIGFPGFTGPRGTPGI--SGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPG-----------------------------------QHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEG--DQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPG 1494          

HSP 10 Score: 145.591 bits (366), Expect = 4.427e-34
Identity = 299/1004 (29.78%), Postives = 389/1004 (38.75%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPG---------EVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAE-KIPGD------KGIQGDVGELGDKGF-----------------------------------------------KGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENG---LDGRRGRQGNMGIKGVKG-LEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLV----GDPGI-----------------LAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFP--------DITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKG------LIGPQGQKGESGY--------KGVQGLAGDKGPKGFPG-KNIMGSKG----EKGNKGRIGEMGV-------------------KGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSN----GERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGY---------------EGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPG 4578
             GDKG SG  G PG         + G +G  G DG +G +G++G+ G  G +G  G SG  G KG++G+      E + ++ GD       GIQG  G  G  GF                                               +GE+ +   + +LL +YKG  G++G KG+ G  G P   G KGE G++G PG+ G  GN G  G  G +G  G NG   L G +G++G +G  G +G +  V G +   G+ GE G  G+ GV                D           +       GQ GD G  G RG  G +G  GL     G PGI                   IG KG  GF G  G+RG PG +G +G  G          D   +G  G PG +G  GFQG  G KG  G+ G  G  G  G  G  GP G+ G  G+KG      E GS+G +GD+G  G  G  GY G  G  GS G  G      P+GDGIKG+ G      L G  G +GE+G+        KG++G  G++G  GFPG   + G +G    E   +  IG+ G                     G+ G  G  G PG  GF G  G +G+KGD                                                RG     G  G  G +GD+GN GL G  G  G  G  G  G  G KG++G +                                           L+G+ G   +    G +G+ G  G  G KG KG  G  G  G  GPA      L G  G  G+PG  G                EG++GP GP G KG         GE GV G  G  G  G  GIPG  G  G  G++G  G  G+ G QG+ G +G   ++G  G  G+ G                        PG KG  G  G++GD+GE+G PG
Sbjct:  115 SGDKGQSGVTGFPGADGVPGHTGQGGPRGKPGHDGCNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGDPGEAGFNGIQGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGDQGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGV-------------YGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPG------PSGDGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGD------------------------------------------------RGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPG----------------------------LQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAA-----LFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLP-------GELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIG-----------------------FPGVKGGNGTSGTKGDRGEQGPPG 988          

HSP 11 Score: 105.145 bits (261), Expect = 1.024e-21
Identity = 164/498 (32.93%), Postives = 225/498 (45.18%), Query Frame = 1
Query:  235 DSESAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGN-------EGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKG---QKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-IPG 1683
            ++ +   I N+    E   +G++G  G  G  G  G  GF GV G+RG  G +GE+G+        G KG  G  G+ G +G+ G  G  G +G  G++G  G  G+ G  G PGQ+G  G  G  G  G+PG+ GEKG  G  G        LP + G  G +G +GL G  G  G  G+PG   +IG +G KG  G    KG+ GE   ++ +    G  G +GD+G      L  T     + G   + G+ G  GP G  G  G  G  GR G     G+KG+ GDLG  G +G  G  G  GK                        +G  G +G+ G KGLKG +    G V GV G RG++G KG+ GD          G+ GL+GP G+ G       ++                 G  G  G  GH+G++GD G KG+       G  G++G+ G+ G     G  GE GP+G  G  G  G S +PG
Sbjct: 1049 ETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPG--------LPGQHGFPGIRGIAGLDGLPGTKGINGQPGAD-IIGLKGFKGLSGG---KGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGK------------------------VGVPGLAGIPGAKGLKG-SAGFQGFV-GVSGYRGDQGPKGLRGD---------IGEYGLKGPPGQPGPMSEPPLITAE--------------QGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPG 1485          

HSP 12 Score: 101.293 bits (251), Expect = 1.520e-20
Identity = 178/488 (36.48%), Postives = 232/488 (47.54%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLD-KSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYE----GRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDS---GLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGD------KGVKGMD-MIGTK-----------GRKGVNGLTGPKGDTGDA----GEAGPIGEKGDIGDVG 1668
            G+ GP    GF G  G PG  G +G  GPPG  G++G+E   G++GP G  G KG+ G  G+                   G  G  G+ G  G+ G  GM G+PG++G KG  G +GF           +G KGAKG    +G  G  G++G PG KG  G  G KGD GE   +G  G+P KM  +   ++GE GD+G  G+   + L         KG KG+ GPPG  G  G  G + +E    G  G+ G  G +GI G++GP G  G PG  G  G PGI G P                  G  G  G  G  G +GDTID+ G     RG +G+ G  G+ G RGI G++G+ GD    G++G IGE G  G      + G  G  G +G  GL G  G++G  G  GL G       +G+ G+D + GTK           G KG  GL+G KG  G+A    G  GP G KG  GD G
Sbjct:  844 GIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDE---GEKGPPGPAGMKGLPGELGVG------------------GFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGF-----------QGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGE---QGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGL---------KGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFP------------------GVPGERGKYGDIGERGDTIDLPGE----RGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQG 1265          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Mouse
Match: Col4a6 (collagen, type IV, alpha 6 [Source:MGI Symbol;Acc:MGI:2152695])

HSP 1 Score: 409.453 bits (1051), Expect = 2.099e-116
Identity = 614/1923 (31.93%), Postives = 796/1923 (41.39%), Query Frame = 1
Query:  205 VFWIIISLVQDSESAAA--------ICNRSNCT-ECSC---------NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGM--------------------IGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMI--------KGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSR----------GVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRG---DKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAE------------------KIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKH---------------GKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGL--------EGVKGDRGFIGFPGEKGDIGVTGVPGDS-ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQG---------YQGEKGNQGSLGLKGLKGNQG--------------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGD----------IGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSS-NGERGQRGPQ----GNTGEKGEKGEFGDAGKRGPQGPAGDQGI----------------GLLGVKGE------------------RGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSF-QMTMGHNIKTMQSEDLIAKCLVCMRN 5445
            ++  ++SL    E A +         C   +C   C+C          G +G +G  G  G  G  G  G+KG+RG PG LG  G+   KGD+GP G      V G  GI+G  G PG  GP+G  G +GC G  G  G  G  GY G+ G PG+ G KG KG     +P +G +   RGD G  G  G+ G  G  G  G+ G  G                     +G+QG+KG  G++G  G  G P     L+      G KG KG          +    +        KG+KGI G PGP G MG  G +G+ GR G KG  G  GI G  G  G+ G  G  G                             G  G+ G+ G  GL+GD         GV+G RG  G  G+    G+PG  G +G  GL+G   ++GN GR+           G+              R  +       E G  GL+G++G KG      +G KGV G +G     G A   GP GE G        +PG QG                      IG +G  F  + GD G+RG     G PG+ G RG  GL G+ GE                                              +  GDKG  G +G PG  G     G DG  G  G  GI GD G           G  GERG  GLPG++                     +PGDKG+ G  G+   +G +G +G      +         G  G  G  G  GFPG+KG++G  G+ G PG H               G  G  G  GEKG  G  G  G DG  G+ G+ G+ G KG          G  G++G  G PG+KG  G +G+PG   + G  G  G KG+ G  G  G  G  G  G     G KG +G  G     G  G+ G PG    G++G  G  G+ G+RG PGIKG  G  G P     G+ G PG  G  G  G+ G+KG KG  GP G  GL G  G  G  G KG  G  G +G  G+ G+ G+KGD G+ G +GI           ++GEKG++GS G  G  G +G               A      +KGL G  G  G  G +G+ GL G  G  GFPG     GS+G  G  G +G  G+ G KGD           GP G PG +GF+G +G+ GL GD+                                               +GD G++G  G+ G  G  G +G+SG  GD G  G  G  G  G  G                                                + G+ G +   G +G+RG      G+ G++G KG+ GD G  G QGPAG  G                 G  G+ GE                  +GDPG  G+ G  G +G KG++G    + G  GE G+KG +GE G +G  G  G  G+ G  G++G  G +G  GPQG  G                               G         IPG  GD G  GS G +G KG PGI G            + G S   G  G +G  GL G  GP G  G  G+ G  G PG  G      G     HSQS ++P CP+    LW GYS L + G E+AH  DL   GSCL  FS +PF++C   E C Y+ RND++YWLS+   + M M +  TQ+  Y+SRC VCEAPS+  A HSQ  + P+CP GW +LW G SFLM+T  GA GGGQ L SPGSCL  F+   F+EC+ A+G C Y+     FWL   +    F +  +   +KT Q    +++C VCM+ 
Sbjct:    5 LWLFLVSLCLTKELAESGQKMSYGKPCGSRDCHGVCTCFPEKGARGHPGPIGTQGPAGPEGFTGPTGLSGLKGERGSPGPLGPYGS---KGDKGPIG------VPGFVGISGIPGHPGQPGPRGPPGPDGCNGTQGAVGFPGPDGYPGILGPPGLPGHKGAKG---EPVPFQGSITGIRGDPGLPGLDGIPGPSGSSGSPGDAGPIGPPGLQGPPGLPGLPGPEGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPPGFPGMSGPPGVPEFGSTGEKGEKGILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGP----------------DSFTDADGAVISGYPGDPGVLGLPGLRGDE--------GVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKG---DQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGH-----QGLKGVKGDSGFCACEGGAPNIGPHGEPG--------LPGIQGP---------------------IGLQG--FKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGS---------------------------------------KMSGDKGDPGPQGTPGLAGTP---GKDGRPGLPGLPGIQGDGGS----------GFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQ---QGLRGAQGVTLPCII--------PGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGA---PGLPGISGHPG--KKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSP-----GFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDR------------------------------------------GYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGP-------------SGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPG-FSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHT-------------------PIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPG------------KDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGHGV-RVGYTLVKHSQSEQVPLCPTGMSRLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPM-MPVGQTQIPQYISRCSVCEAPSQAIAVHSQDIIVPQCPLGWHSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERGQFREEPVSETLKTGQLHTRVSRCQVCMKT 1690          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Mouse
Match: Col4a6 (collagen, type IV, alpha 6 [Source:MGI Symbol;Acc:MGI:2152695])

HSP 1 Score: 409.453 bits (1051), Expect = 2.099e-116
Identity = 614/1923 (31.93%), Postives = 796/1923 (41.39%), Query Frame = 1
Query:  205 VFWIIISLVQDSESAAA--------ICNRSNCT-ECSC---------NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGM--------------------IGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMI--------KGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSR----------GVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRG---DKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAE------------------KIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKH---------------GKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGL--------EGVKGDRGFIGFPGEKGDIGVTGVPGDS-ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQG---------YQGEKGNQGSLGLKGLKGNQG--------------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGD----------IGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSS-NGERGQRGPQ----GNTGEKGEKGEFGDAGKRGPQGPAGDQGI----------------GLLGVKGE------------------RGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSF-QMTMGHNIKTMQSEDLIAKCLVCMRN 5445
            ++  ++SL    E A +         C   +C   C+C          G +G +G  G  G  G  G  G+KG+RG PG LG  G+   KGD+GP G      V G  GI+G  G PG  GP+G  G +GC G  G  G  G  GY G+ G PG+ G KG KG     +P +G +   RGD G  G  G+ G  G  G  G+ G  G                     +G+QG+KG  G++G  G  G P     L+      G KG KG          +    +        KG+KGI G PGP G MG  G +G+ GR G KG  G  GI G  G  G+ G  G  G                             G  G+ G+ G  GL+GD         GV+G RG  G  G+    G+PG  G +G  GL+G   ++GN GR+           G+              R  +       E G  GL+G++G KG      +G KGV G +G     G A   GP GE G        +PG QG                      IG +G  F  + GD G+RG     G PG+ G RG  GL G+ GE                                              +  GDKG  G +G PG  G     G DG  G  G  GI GD G           G  GERG  GLPG++                     +PGDKG+ G  G+   +G +G +G      +         G  G  G  G  GFPG+KG++G  G+ G PG H               G  G  G  GEKG  G  G  G DG  G+ G+ G+ G KG          G  G++G  G PG+KG  G +G+PG   + G  G  G KG+ G  G  G  G  G  G     G KG +G  G     G  G+ G PG    G++G  G  G+ G+RG PGIKG  G  G P     G+ G PG  G  G  G+ G+KG KG  GP G  GL G  G  G  G KG  G  G +G  G+ G+ G+KGD G+ G +GI           ++GEKG++GS G  G  G +G               A      +KGL G  G  G  G +G+ GL G  G  GFPG     GS+G  G  G +G  G+ G KGD           GP G PG +GF+G +G+ GL GD+                                               +GD G++G  G+ G  G  G +G+SG  GD G  G  G  G  G  G                                                + G+ G +   G +G+RG      G+ G++G KG+ GD G  G QGPAG  G                 G  G+ GE                  +GDPG  G+ G  G +G KG++G    + G  GE G+KG +GE G +G  G  G  G+ G  G++G  G +G  GPQG  G                               G         IPG  GD G  GS G +G KG PGI G            + G S   G  G +G  GL G  GP G  G  G+ G  G PG  G      G     HSQS ++P CP+    LW GYS L + G E+AH  DL   GSCL  FS +PF++C   E C Y+ RND++YWLS+   + M M +  TQ+  Y+SRC VCEAPS+  A HSQ  + P+CP GW +LW G SFLM+T  GA GGGQ L SPGSCL  F+   F+EC+ A+G C Y+     FWL   +    F +  +   +KT Q    +++C VCM+ 
Sbjct:    5 LWLFLVSLCLTKELAESGQKMSYGKPCGSRDCHGVCTCFPEKGARGHPGPIGTQGPAGPEGFTGPTGLSGLKGERGSPGPLGPYGS---KGDKGPIG------VPGFVGISGIPGHPGQPGPRGPPGPDGCNGTQGAVGFPGPDGYPGILGPPGLPGHKGAKG---EPVPFQGSITGIRGDPGLPGLDGIPGPSGSSGSPGDAGPIGPPGLQGPPGLPGLPGPEGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPPGFPGMSGPPGVPEFGSTGEKGEKGILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGP----------------DSFTDADGAVISGYPGDPGVLGLPGLRGDE--------GVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKG---DQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGH-----QGLKGVKGDSGFCACEGGAPNIGPHGEPG--------LPGIQGP---------------------IGLQG--FKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGS---------------------------------------KMSGDKGDPGPQGTPGLAGTP---GKDGRPGLPGLPGIQGDGGS----------GFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQ---QGLRGAQGVTLPCII--------PGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGA---PGLPGISGHPG--KKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSP-----GFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDR------------------------------------------GYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGP-------------SGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPG-FSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHT-------------------PIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPG------------KDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGHGV-RVGYTLVKHSQSEQVPLCPTGMSRLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPM-MPVGQTQIPQYISRCSVCEAPSQAIAVHSQDIIVPQCPLGWHSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERGQFREEPVSETLKTGQLHTRVSRCQVCMKT 1690          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Mouse
Match: Col4a2 (collagen, type IV, alpha 2 [Source:MGI Symbol;Acc:MGI:88455])

HSP 1 Score: 374.4 bits (960), Expect = 5.268e-105
Identity = 402/1198 (33.56%), Postives = 530/1198 (44.24%), Query Frame = 1
Query: 2080 QGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTG---------------------------LPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKG------FTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPG-----------------IKGYKGNSGFPDIT----LKGYKGIPGEIGPKGFQGLPGEKGF----KGEIGPTGTSGLRGRKGDQGPQGYKGV---------QGQKGIIGMIGEMGSQGDKGDTGERGSI-GIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEV----GSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMT-MGHNIKTMQSEDLIAKCLVCMRN 5445
            +G+RG+ G+ G  GE G+ G  G+ G  GF GP G  G RG  G                           +PG+     PG +G  G  G+ G KG  GE G           ++G  G  G+ G +G  GFPG  G  G+   SG PG+HG  G  G++G  G  G  G  GL G RG  G+ G+ G  G++G+ GDRG  G  GE+G  G  G  G +                          G+ G  GQ GD+G      F G+ G  G +GF G  G+ G   +   G KG  G  G +GN G                 IKG KG+ G   +     LKG +G+PG  G  GF GLPG  GF    KG+IG  GT GL G  G  GP G  G          +G  G+ G+ GE G  GD GD G+   + G  G +GE+G  G  GLKG  G +G AGD G  G+ G+ G QG  G  G  G  GL G +GP+G PG+  +G  G+KG+ G  G  G+ GF G      + G  G  G  G +G  G  G                                               GD G  G  G+ G++G+     L G VG  G KG +G  GE G  G+ G +G  G+       G  G+ G  G  G +G +G  G  G     G++G  G S + G  GQ+G  G+ G +G+ G  G  G++GP+G   +QG          G+ GP G  G RGPKGPKGD+GF    PG  G  G+ G   ++    G++GP G  G  G  GE G +G  GD G RG  G AG +G  G                                   +PG +GD+G +G +G  G++G PG  G                                                  G PG  G +  + G +   HSQ+ + P CP     LW GYS L   G E+AH  DL   GSCL  FS +PF++C   + C+Y+ RND++YWLS+   + M M +   +++ Y+SRC VCEAP+   A HSQ T  P CP GW +LW G SFLM+T  G  GGGQ L SPGSCL  F+   F+EC   +G C Y+     FWL  T   ++FQ T     +K       I++C VCM+N
Sbjct:  696 KGVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGA--------PGFRGSQGMPGMPGLKGQPGFPGPSGQPGQ---SGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMA--------------------------GMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGV--PGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGR--IGIPGDKGDFGWPGVPGLPGFPG------IRGISGLHGLPGTKGFPGSPGVD-------------------------------------------AHGDPGFPGPTGDRGDRGEANT--LPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKG---EQGF--------MGNTGPSGAVGDRGPKGPKGDQGFPGA-PGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSA--------------------------------VPGFRGDQGPMGHQGPVGQEGEPGRPG------------------------------------------------SPGLPGMPGRSV-SIGYLLVKHSQTDQEPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPM-MPVAEEEIKPYISRCSVCEAPAVAIAVHSQDTSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLT-TIPEQNFQSTPSADTLKAGLIRTHISRCQVCMKN 1706          

HSP 2 Score: 163.696 bits (413), Expect = 1.025e-39
Identity = 233/640 (36.41%), Postives = 283/640 (44.22%), Query Frame = 1
Query: 2023 TEGDKGPSGE------------RGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGF---SGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKD--GEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG----DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGER----GNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGL--KGLKGNQGPAGD-GIKG----MKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG----KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNI 3834
            T G +GP G+            RG+PG+ G  G  G+ G SG +G++G+ G++G  G  GF   +G  GI G++GD G PG +        G QG +G  G +GF G K                 GE G  G  G  G PG  G KG  G  G PG    +    KD  GEKG+ G  G  G  G +G QG  G+ GV G  G+ G  GFI   G KGDIGV G PG      ++GP G                             G  GFTG RGE G  G  G+         GE GP G  G+IG+     G+PG+KG +G +G P   LKG+ G  G  G  GF G+ G  G +G  G  G +G  G  G QGPQG  G  G  G  G  G  G  G  G  G RG  G+ G  G KG  GS G+   G  G  GP GD G +G    + G +G  GQKGE G  G +G AG  G +GFPG     NI GS G+ G  G  G  G +G  G  GP  LPG  G +G  G  G  G K                                    G  GD   + + G  G  GEKG  G +G  GN G SG VGD GPKG KG  G  G  G++
Sbjct:  841 TPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMD--------GFQGMLGLKGRQGFPGTK-----------------GEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIK--GVKGDIGVPGTPGLPGFPGVSGPPGI---------------------------TGFPGFTGSRGEKGTPGVAGV--------FGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPG--LKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQK------------------------------------GWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSM 1380          

HSP 3 Score: 163.31 bits (412), Expect = 1.512e-39
Identity = 307/924 (33.23%), Postives = 394/924 (42.64%), Query Frame = 1
Query:  355 RGVKGDRGPPGALGEKGNEGYKGDQG------PKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGE--------EGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKG------------DIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXX--XXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGE----KGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEA----GPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCS-DGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAG-----------FSGPKGIKGERGDTG-LPGKEAEKIPGDKGIQGDVGE---LGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTA---------GFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFP 2943
            +GV+G  G PGA GE+G +G+ GD G      P G +G +G +G +G+ G  G PG  G  G  G         E    +PG +G AGL G  G++G+PG  G  G +G +G        +P   G KG  GF G  G+ G+ G  G+ G  G  G +G  G            D GE G  G  G PV M  L   RG+ G  G++G+  +           I GQKG RG PG           G++G  G KG +G  G +G+ G  G  G  G  G PG  G  G  G  GPP          +G+ G  G  GLKGY GLKG  I     V GV G  G  G     KG+ GD G+PG  G  G  G+ GP G                        + G  G TG RGE+G                 T G  GV G TGP GD GD G+     G  G KG+ G  G  IPG +G                     F GEKG+  +    G  G  G +G PG+ G+ G  GL G  G                                                 +G+ G  G  GD G+ G  G+ GL G+ G +G SG+HG  G KG  G           F GP G +G+RG+   LPG     +PG KG +G  GE    G  G +G  G +   N+  +   GD G  G+ G QG             PG KG +G +G +G PG+ G VG+ G  G+ G +G  GE G  G +G  GN G  G  G  G KG +G  GFPG  G +G  G+PG     P       G +G  G +G  G +G  G +G  GD GF G  G++G +G  G+   PG    G++GP G QG +G+ G PG  G  G  G P
Sbjct:  696 KGVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQG--------MPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPG-PVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPG---------MDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKG--IQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPG------------------------ITGFPGFTGSRGEKG-----------------TPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITG--IPGLKG---------------------FFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQG------------------------------------------------PQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVG--VPGQKGERGTPGERGPAGSPGLQGFPGISPPSNI--SGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGI----PQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFR--GDQGPMGHQGPVGQEGEPGRPGSPGLPGMP 1477          

HSP 4 Score: 162.54 bits (410), Expect = 2.709e-39
Identity = 203/558 (36.38%), Postives = 260/558 (46.59%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGV---PGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVG------DPGIL-AIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIG-----------PTGTSGLRGRKGD-QGPQGYKGVQGQKGIIGMIGEMGS---------------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIG---PQGQKG------ESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGL-PGSIGFQGQEGQRGLKGD 3543
            G KG SG+RGD G  GE+G  G  G+ G  G  GI G KG++G  G  G +G+ G +G  G PG + E     +PG KG+ G+ G  G++G +G  G    +   +   KG+ G++G  G +G  G  G +G  G  G+SG PG  G+ G     G KG++G  G  GL G  G  G  GI G  G  G +G++G  G  G  G+ G TG     GD++  P                               G KGF G +G +GD GF G+ G       PG+    G  G  G QG  GE G  GI G KG+ G+P +   G  G PG  G  G  GLPG KGF G  G           PTG  G RG      GP G  G +G++G  G  G  GS                G  GD G  G  G+QGYQG  G  G   L G+KG++G +G  G  G KG +G   PQGQ G      E G KG QG  G+ GP G  G +   G KG++G  G  G MG  G  G    I + PG++G QG+ G  G  G+
Sbjct:  876 GMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFI--KGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIP----------------GLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGV--PGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGE 1413          

HSP 5 Score: 150.214 bits (378), Expect = 1.368e-35
Identity = 294/966 (30.43%), Postives = 378/966 (39.13%), Query Frame = 1
Query: 2044 SGERGDPGEVGEQGLRGLDGYS---------GKKGESGIHGDKGEKGLAGFSG-----------PKGIKGERGDTGLPGKEAEKIPGDKGIQGDV--------GELGDKGFKGEK-----------------GKNQNVNVLLTKYKGDNGEKGVK--------------------GSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDG-----------------------------------------------EKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDS-ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSG-----------------LRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGK-----NIMGSKGEKGNKGRIGEMGVKGF---KGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGE-------------KGEFGDAGKRGPQGPAGDQGI-------------------GLLGVKGERGD---------PGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGV------KGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAG 4383
             G +G PG  G  G +G+ G S         G+ G  G+HG KG+ G+ G  G             GIKG  GD GLPG     +PG KG  GD+        G  G++GF G+                     ++ +  + +  G   +  V+                    G++G  G PG  G+ GE GL G PG  G+ G  G  G                                                +G+ G  G+ GL G  G  G  G +G +G+ G+ G +G  GFPG  G  G +G PG     G  G +G  G  G  G  G  GD G  G+ G  G  G  GL G+ GD G  G  G PG     G  G  G  G  G+RG+PG+ G++G  G     LKG +G PG  G  GF G+PG KG  GE G  G  G                 ++G KGD+GP G KG  G KGI GM G  G  G  G  G  G   I+G +G+ G  G+ GL G  G  GP   GI G  G     G +GE G  GV G+ G+ GP G  G      ++ GS G KG +G  G  G+KGF   KG  G IG PG  G  G +G  GLKG                                                  G +G  GE G +G  GDKG+ G  G  G  G  G +G +G +G+ G                                               G  G  G  ++G+ G  GP G+ G++GE             KGE G  G+RGP G  G QG                    G+ G++G +G          PG  G EG  G  G  G KG+ +  PGPQG+ GV      KGPKGE G +G TG  G+ G++G +G +GD G  G  G  G  G
Sbjct:  524 PGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGLPG-----VPGTKGFPGDIGPPGQGLPGPKGERGFPGDAGLPGPPGFPGPPGPPGTPGQRDCDTGVKRPIGGGQQVVVQPGCIEGPTGSPGQPGPPGPTGAKGVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLG-----LKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGF--IKGVKGDIGVPGTPGLPGFPGVSGPP--GITGFPGFT---GSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQT------------------------------------------GFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGT---------------------------------------------KGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGW-VGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPG 1384          

HSP 6 Score: 127.102 bits (318), Expect = 1.405e-28
Identity = 178/451 (39.47%), Postives = 219/451 (48.56%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKG-LAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKG----KNQNVNVLLTKYKGDNGE---------KGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQ----GNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGF---EGLVGDPGILAI-GEKGPKG---FQGNIGERG---NPGIKGYKGNSGFP----DITLKGYKGIP-------GEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQ 3264
            G  GP G  G PG  G +G +G  G +G  GE+G  GD G+ G      G  G+KGERG TG+PG +     G+KG  GD+G  G  G  G +G    K Q     LT  +G  GE         KG  G  G  G PG  G +G +GL G+PG  G  G+ G D   G+ G  G  G  G RG      G +G+ G KG  G  G+RG  G PG +G  G++  P  +I+G  GD G  G  G+ G +G  G  G     G  GD+G +G  G  G KG+    G  G PG+L + GEKGPKG   F GN G  G   + G KG KG+ GFP     +   G  GIP       G +GP+G +GLPG  G  G  GP G  G RG  G  GPQG  GV    G  G  G MG QG  G  GE G  G  G  G  G   S+G   +K +Q
Sbjct: 1047 GVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKG--FFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAH-GDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGIS--PPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQ 1492          

HSP 7 Score: 126.331 bits (316), Expect = 3.079e-28
Identity = 192/602 (31.89%), Postives = 246/602 (40.86%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGD---------------KGIQGDVGEL------------GDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTA-----------------------------------GFPGNKGSK---GETGLSGIPGKHGKVGNSGK----DGEKGNMGRKGENGLDG--RRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITL---KGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTS-------------------------GLRGRKGDQGPQGYKGVQGQKGIIGMIGEM----------GSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG----DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGS------------KGEKGNKGRIGEMGVKGFKGDI 3474
            G RG PG VG QG  G  G  G  G  G  GDKGE+G+ G +GPKG  G RG +G PG  A+ IPG                 G +GD G              G +G KG+KG+   ++     KY+G+ GE G+ G QG                                     GF G KG K   G+ G +GIP     VG +      D  KG  G +GE G+ G   +G +G MG  G++G  G+ G++G +   G+KG  G+ G  G S                                   G +G  G RGE G  G       P  LA G +G  GFQG  GE G+ G  G  G +G P  ++      +G+PGE+GPKGF G PG       +GP G                           G  GR G  GP G+ G +GQKG  G  G+           G  G KG  G  G +G +G QG+ G  G  G  G KG  G AG     GIKG    I  +G++G+ G  GV G+ GD    G PG++ +              KG  G+ G  G  G KGF GDI
Sbjct:   58 GARGQPGAVGPQGYNGPPGLQGFPGLQGRKGDKGERGVPGPTGPKGDVGARGVSGFPG--ADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLGFYGQKGEKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVV---GQKGSRGLDGFQGPS-----------------------------------GPRGPKGERGEQGPPGPSVYSPHPS-LAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARY--LGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMKGD---DGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGLPGVPGTKGFPGDI 613          

HSP 8 Score: 112.464 bits (280), Expect = 4.991e-24
Identity = 183/564 (32.45%), Postives = 229/564 (40.60%), Query Frame = 1
Query:  313 GEMGFGGHEGKPGFRGVKGDRGPP------GALGEKGNEGYKGDQGP---------KGMIGDKGVQGNSG--INXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGF--------SLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGEL----------GFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-IDISGN--VTGVRGDRGEKGEKG-IDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-------IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSD-GDAGNRGDKGFPGIPGERGIDGL 1863
            G  GF G  G PG  G KGDRG P      G LG KG +G+ G +G          KG+ G+ GV+GN G           L G K   GE+G  G  G KG  GL+G  GM G+PG+ G  G  G  GF         +P    LP   G  G  G +G  G  G  G+ G PG  G+ G  G  GD G++          G KGE+G    +  L    GE G  GD G+   T +        +KGQ G                 G  G  G +G  G  GI GD G  G  G PG  G PG                          G +G  GL G KG  G   +D  G+    G  GDRG++GE   + G  G+PG +G RG  G +GP G  G +G                    G+   +   G  G  G  G  G++G       G  G N L G KGD G +G AG  G+KG +GD G         +PG +               G  GE+GF+G  G      D G  G +GD+GFPG PG  G  G+
Sbjct:  897 GSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGI-TGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGF---------------PGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIR------------------------GISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQG------------------FPGISPPSNISGSPGDVGAPGIFGLQGYQG--PPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEK---------------GPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGI 1385          

HSP 9 Score: 109.383 bits (272), Expect = 3.810e-23
Identity = 170/489 (34.76%), Postives = 215/489 (43.97%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKG---MIGYQGDKGDIGELGFKGEKGE-------PVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGN--------VTGVRGDRGEKGEKGIDGDRGIPG---------DEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGE-AGPIGEKGDIGDVGTS 1674
            GL G  G  G  G  G PGFRG +G  G PG  G+ G  G  G  G  G  G  G  G  G  G  G PG  G  G  G+ G  G PG  G  G++G  G +G  GM GE+G  G  GF  +     +P ++GD+G+ G  G +G +G  G  G PG KG     G  G KG  GE G KG +G+       P+ +  +   +GE GD+G  G      L        + G  G      P         KG +G  G  G  GL G  G  GP G  G PG  GS G+ G  G+                   G  G +G  G  G  GDT+D+ G+        +TG+ G +G  GEKG  GD G PG           G +G +G  G  G +G +G    +  PG+KG  G  G+ GL G  G RG  G  GL G KG  G   +   G  G  G TG +GD G+A    GP+G  G  G+ GT 
Sbjct:  783 GLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGF-----PGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGV------------------AGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTP 1248          

HSP 10 Score: 108.227 bits (269), Expect = 9.963e-23
Identity = 197/583 (33.79%), Postives = 253/583 (43.40%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGN--------------------EGYKGDQGP---KGMIGDKGVQGNSGINXXXXXXXXXXXXXYT----GEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS--------------------LPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGF------KGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDL-GPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGN-VTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG----------TSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGE 1845
             G+LG KG  GF G +G+ GF GV G +G PG  G KGN                    +G KGD+GP   KG +G KG+QG  G+ G  G PGL G  G+     G+ G  G PG  G  G+ G  G+ G PG  G +G KG  G +                    LP    L  ERG  G  G  G  GE G  GD+G PG  GM G QG  G  G+ GF      +G +GEP ++       G  GDKGD G+     L        I G  G+              A G  G  G  G  G +G    L GP+G  G+ GE G+PG+ G  G PG +G PG        G  G  G  G+ G +G +G       N + G++GD G  G  G  G +G  GD G +G  G+ G  GEKG KG                 G  G  G +G  G++G KG KGD+G  G    G+ G  G+ G+  P+      G  GP G +G  G +G              GA G  G +GR G     G  G++G +G +G      +G+ G  G  G PG+PG 
Sbjct:  926 QGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRI-------GIPGDKGDFGWPGVPGLPGFPGIRGISGLHGL-PGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQ---------------GFMGNTGPSGAVGDRGPKGPKGDQGFPGAP--GSMGSPGIPGI--PQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPV--GQEGEPGRPGSPGLPGMPGR 1479          

HSP 11 Score: 87.0409 bits (214), Expect = 2.476e-16
Identity = 173/523 (33.08%), Postives = 220/523 (42.07%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGF---RGVKGDRGPPGALGEKGNEGYKGDQG-------PKGMIGDK-GVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKG------------------EIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP--------------------------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXX-----AKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDS-GLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS 1674
             GL G  G+ G  G  G PGF   RG KG  G PG  G  G  G  G  G       P  ++G + G +G++G+                G+ G  G PG+ GA G +G  GM G+PG++G+ G  GP G         P + G  G  GF G  G                  + GE GD G PG  GM G  GD+GD G  G +G  G P                            M+ L   +G  G KG+ G+     L     E  +KG +G RGPPGP   +          KG EG  G KG  GLKGI+G  G  G  G PG  G PG                   +G +GDIG  G  GL G+ G+ G   I      TG RG++G  G  G+ G+ G  GD G  GD+  L G  G KG +G +            G  GL+G  G+ G  G+ G  G+ G  G +G    G KG+ G  GLTG +G  G+ G  G  G+KGD G  G  
Sbjct:  711 QGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGL---------------PGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSG--------QPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPG-----------------FIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGIT------------GIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSP--GLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVP 1179          

HSP 12 Score: 86.6557 bits (213), Expect = 3.270e-16
Identity = 160/504 (31.75%), Postives = 204/504 (40.48%), Query Frame = 1
Query: 2245 DKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFP------------GEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPA---GDGIKGMKGLIGPQGQKGES-----------------------------------GYKGVQGLAGDKGPKGFPGKN--------------------IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            +KG +G  G +G +G+ G  G        L  + G  G KG KG +G  G  G KG  G  G+SG PG  G  G+ G+ G +G  G  G NG  G  G QG  G  G  GL G +G +G  G P            GE G+ G+ G  G         +                    +     LG   F G +GE GD G  G  G P  + +   GP      I      G KG +G  G P +  KG +GI G  G +GF GL GEKG  G+ G  G  G +G  G +GP+G +G QG  G       + S       G RG  G QG  GE G++G  G  G  G  GP+    D ++G+ G +GP+G  GE                                    G KG +G  G  GP GFPG                      + G  G KG  G  GE+G KG +GD G  G+PG  GF+G  G  G  G K
Sbjct:   56 EKGARGQPGAVGPQGYNGPPG--------LQGFPGLQGRKGDKGERGVPGPTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLG---FYGQKGEKGDIGQPGPNGIPSDITL--VGPT--TSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGP-----SVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPK 539          

HSP 13 Score: 78.1814 bits (191), Expect = 1.142e-13
Identity = 92/270 (34.07%), Postives = 116/270 (42.96%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGE------VGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFS----GPKGIKGERGDTGLPGKEAEK----IPGDKG--------------IQGDVGELGDKGFKGEKGKNQNV------------------------NVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGET----------GLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGV 2649
            EG  G  G RG PG       VG++G RGLDG+ G  G  G  G++GE+G  G S     P   KG RGD G  G   E      PG+ G              ++G  GE+G KGF GE G                             +  L   KG  G  G  G  G  G  G KG KGE           GL G+PG  G  G +G+ G+KG+ G  G +G+ G  G +G  G+ G  G +G+KGD   I   GE+G  G+ GV
Sbjct:  293 EGIMGFPGIRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGV 562          

HSP 14 Score: 76.6406 bits (187), Expect = 3.137e-13
Identity = 177/563 (31.44%), Postives = 236/563 (41.92%), Query Frame = 1
Query:  172 LMKLVLGLIVAVFWIIISLVQDSESAAAICNRSNCTE-CSC---NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGE---------------------PGNKGMIGYQGDKGDIGELGFKGEKGEP---------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGD--------RGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXX--------------LRGLDGKTGKRGEQGHKGLKGDKGVKGM--DMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-IPG 1683
            L   +L   V V  +  S++   +     C   +C+  C C    G  G  G +G  G+ G PG +G  G +   G  G+KG  G  G  GPKG +G +GV G  G +G  G PG  GP+G  G +GC G  G  G  G  G  G  G+PG QG KG+KG + ++L +E      RG+ G  G  G +G  G  G +G+                     PGN+G+ G+ G KG+ G++G  G  G P            I  D  +GE GD+G++G         +  E  I G  GIR         G  G  G +G  G KG+ GL G +G  GP G  G+ GE G PG       P                   A G  G  G++G  G+         G RG+ GE G  G  G         RG+PG+ G +G S      GE G+  R  G      +                     L+G +G+ G  G  G  G +G KG KG   D    +   G+ GL GPKG  G  GE   +G+KGD GD G   IPG
Sbjct:   13 LRGWLLLATVTVGLLAQSVLGGVKKLDVPCGGRDCSGGCQCYPEKGARGQPGAVGPQGYNGPPGLQGFPGLQ---GRKGDKGERGVPGPTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKG-EPYALSKEDRD-KYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGL-GFYGQKGEKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVI----SKGEEGIMGFPGIR---------GFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSL-----------------AKGARGDPGFQGAHGE--------PGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFS------GEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGE---LGKKGDQGDPGLHGIPG 522          

HSP 15 Score: 75.0998 bits (183), Expect = 1.091e-12
Identity = 144/446 (32.29%), Postives = 175/446 (39.24%), Query Frame = 1
Query:  412 GYKGDQGPKGMIGDKGVQG-NSGINXXXXXXXXXXXXXYTGE---EGCCGKPG--QKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPG----------NKGMIGYQGDKGDIGELGFKGEKGEP-------VKMISLDKSRGEIGDKGDKGYS-----FTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDV 1665
            G+ G +G KG IG  G  G  S I           P  Y GE   EG  G PG   KG  G+ G+ G++G PG+ GEKG  G KG            RG  G +G SG +G  GE G+ G PG           KG  G  G +G  GE G +GE GEP         +   D  RG  G+ G KG+S        +L     +     Q        P  D    G KG EGR G  G  G  G RG  G  G+ G                                  IG     GL G  G KG          GV G+ G+KG++G  G  GIPG  G +G  G+ G  G KG KG SR ++                 G+ G+ G  G  G+KGD GV G D +            G KG  GDAG  G  G KG  GD+
Sbjct:  234 GFYGQKGEKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVVGQKG-----------SRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGD---------------------------CQCGQVIG-----GLPGLPGPKG--------FPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTIT---------------TKGERGQPGIPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGLPGVPGTKGFPGDI 613          

HSP 16 Score: 65.855 bits (159), Expect = 6.144e-10
Identity = 161/500 (32.20%), Postives = 203/500 (40.60%), Query Frame = 1
Query:  532 EEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGEL------------------GFKGEKGEPVKMI--SLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGH----KGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDT--------GDAGEAGPIGEKGDIGDVGTSI--PGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGS----CFNCSDGDAGNRGDKGF----------------PGIPGERGIDGLN 1866
            E+G  G+PG  G  G  G  G+QG PG+QG KG KG +G   P        +GD GA+G SG  G  G  G  G+ G +G  GY G  G  G+                   G KG+KGEP  +     DK RGE G+ G  GY           ++   G  G  GPPGP G  G  G +G        G  G KG +GD+G      +PG NG P                          I      G KG +G +G    IS    G+ G  G +G  G+DG++G+ G +GSRG  G QGP G +G KG                   RG  G  G      H    KG +GD G +G     G++G  G  G  GP G +        G  GE GP G  G+ G     +  PGA G  G +G PG  G  G  G     G KGS     +    G  G RG KG+                PG+PG +G  G+N
Sbjct:   56 EKGARGQPGAVGPQGYNGPPGLQGFPGLQGRKGDKGERGVPGPT-----GPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGL-------GFYGQKGEKGDIG------QPGPNGIP--------------SDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGE------------------RGEQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGF--LFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVN 503          

HSP 17 Score: 65.0846 bits (157), Expect = 1.098e-9
Identity = 86/285 (30.18%), Postives = 111/285 (38.95%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNV------------------------NVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETG----------LSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGI------------------------KGVKGLEGVKGDRGFIG-----------------FPGEKGDIGVTGVPG 2655
            +G +GPSG RG  GE GEQG  G   YS     S   G +G+ G  G  G  G +GE G+ G  G     +  +  ++G  GE+G KGF GE G                             +  L   KG  G  G  G  G  G  G KG KGE G          L G+PG  G  G +G+ G+KG+ G  G +G+ G  G +G  G+                         G+ G+ G+KGD G  G                   G  GD G+ GVPG
Sbjct:  323 DGFQGPSGPRGPKGERGEQGPPGPSVYSPHP--SLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGLPGVPG 605          

HSP 18 Score: 61.6178 bits (148), Expect = 1.231e-8
Identity = 101/305 (33.11%), Postives = 128/305 (41.97%), Query Frame = 1
Query:  289 CNGLLGPKGEMGFGGH-----EGKPGFRGVKGDRGP-------------PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGL---QGYDGMQGIPGMQGEKGRKGPKGFSLPQEGV--LPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDL---GPIGKHGKPGENGSPG 1125
             +GL G  G  GF G       G PGF G  GDRG              PG  GE+G  G +G  G  G+ G  G+   S I+G  G  G  G  G  G +G  G PG     G+   +G  G  G PG +G  G  GP+G    Q GV  LP E+G KG +GF G  G  G  GD G  G KG  G+ G  G +G  G     G P K+     + G  G +G  G            +   +G  G                 G +GR G     G +G +G +   GP+G+ G+PG  GSPG
Sbjct: 1190 ISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQG----QPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGI---PGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPG---------------KAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPG 1472          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Mouse
Match: Col4a1 (collagen, type IV, alpha 1 [Source:MGI Symbol;Acc:MGI:88454])

HSP 1 Score: 248.054 bits (632), Expect = 1.579e-65
Identity = 101/234 (43.16%), Postives = 141/234 (60.26%), Query Frame = 1
Query: 4747 GNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRN 5445
            G  G    + G +   HSQ+T  P CP  T++L+ GYS L + G+ERAH  DL + GSCL+ FS +PF+FC     C ++ RND +YWLS+   M MSM  I+   ++ ++SRC VCEAP+   A HSQ+   P+CPNGW++LW G SF+M+T  GA G GQ L+SPGSCL  F+   F+EC  +G C YY     FWL   +  + F+      +K  +    +++C VCMR 
Sbjct: 1435 GPPGTPSVDHGFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRR 1668          

HSP 2 Score: 189.889 bits (481), Expect = 1.061e-47
Identity = 208/531 (39.17%), Postives = 277/531 (52.17%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTK-YKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGN---MGRKGENGLDGRRGRQGNMGIKGV---KGLEGVKGDRGFIGFPGEKG---DIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKG---------VQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIG---EMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            ++G  G +G+ G PG  G+QG  G+ G+ G KGE G+ G  G+ G  G +G  G+ GE+GD GLPG    +  GD G +GD G   D G  G  G  ++V++   K  KGD GEKG  G  G      +KGS+G+ G  G+PGK G+ G+ G+ G KG+    G  G  GL G +G  G MG+ G    KG+ G+ G +G  G PGEKG   + G +G+PG  I G                             G  GD+G  G  G  G+KG +G  G PG+   G  GP+G  GNIG  G+PG+ G KG+ G P     G  G+PG  G  G  G PG  G  G+ G  G+ G+ G  G++G QG  G +G  G  G  G+ GS+G+ G  G  GS GI G +GE+G  G  G +G  G  G  G  ++G KG  GPQGQ G  G+ G         + G  GDKG +G+PG   + G KG+ G +G  G     G+ G KGD+G  G+P   GFQGQ+G  GL+G K
Sbjct:  847 SQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPR--GDPGFKGDKG---DVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTG------DKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPG---------------------------RPGDKGDQGLAGFPGSPGEKGEKGSAGTPGM--PGSPGPRGSPGNIGHPGSPGLPGEKGDKGLP-----GLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPG-RGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVP---GFQGQKGLPGLQGVK 1328          

HSP 3 Score: 158.688 bits (400), Expect = 3.510e-38
Identity = 288/901 (31.96%), Postives = 347/901 (38.51%), Query Frame = 1
Query:  526 TGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGE--LGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXL------RGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLV------------GDPGILAIGEKGPKGFQ---------------------GNIGERGN------PGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQG 3087
             G  G  G PG  G  G +G+ G  G PG+ GEKG  G  G   P         G  G KG  GL GEIG  G  G PG  G+ G  G +G  GE  +G  G KG+P     L    G  G+KG  G                                      G  G  G  G  GL+GIRGD GP G          P      G PG  GPPG +G  G  G  G  G  G  G+ GL         ++ G +GD+G +G  G+ G  G+PG  G +G  G+ G  G KG  G      +PG  GP G  GL       GL G +G RG+ G KG KGD G+ GM   G+     +  + G KGD G+ G+ GP G+KG  GD GT                                         G  G  G  G PG PG +G  GL+G                                                   T G  G  G +G    VG  GL G        GE G+ G  G +G+ G  G KG KGE+G +GLPG      PGDKG QG  G  G  G KGEKG        +    G  G  G  G  G+ G PG KG KG  GL G+PG  G+ G  G  G  G  G+KGE G DG  G  G  G +GV G       RGF GFPG KGD G  G                                      ++G  G  G  G  G KG +G +            G PG    G KG +G Q                     G  G++GN      PG+ G KG+ GF    + G  G PG  G KG  GLPG  GF+G+ G  G  G++G +GDQG
Sbjct:  648 PGAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFP---------GLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGIGLPGLKGQP----GLPGIPGTPGEKGSIG------------------------------------GPGVPGEQGLTGPPGLQGIRGDPGPPGVQ----GPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGL---------DMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMP--GSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTP----------------------------------------GVPGKDGQAGHPGQPGPKGDPGLSG---------------------------------------------------TPGSPGLPGPKGS---VGGMGLPG------SPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPG--MPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPG-------RGFPGFPGSKGDKGSKG--------------------------------------EVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGF--QGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQG 1335          

HSP 4 Score: 153.68 bits (387), Expect = 1.342e-36
Identity = 277/800 (34.62%), Postives = 348/800 (43.50%), Query Frame = 1
Query: 2146 GEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGL--RGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKG---FKGEIGPTGTSGLRGRKGDQGPQGYKG---------VQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGR--IGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLG---------------VKGERGDPGP------------------------------DGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGV 4359
            G  G AG  G  G  G +GD G PG      PG  GI G+ G +G  G                 + G  G KGV G  G  G PG+ G  G  GL G PG  G+ G  G  G  G  G+ G  G+ G  G +G++G  GV G +G+ G  G  G    +GD G  GV G +    V   G  G +G  G +G  G  G  G KG+ G  GF GL   G  GDKG +GL   PG+      G  G  G  G++G PG+ G+ G+ G  ++ + G  G PG  GP G  GLPGEKG     G  GP G  G +G KGD G  G  G         ++GQKG  G  G++G  GDKG  G+ G+ G+ G  G+ G+ G  G KG  G  G P   G+ G KG +G  G  G  G KGV G+ G +G  G PG+   G+KGEKG  G   IG  G  G KGD G  G PGS G +G++G  G  G                            PG PG +GS G+ G        G+KG+ G  G  G  G KG  GL G  G  GP G KG+ G +G+ G+ G KGE                                          +G+ GR   G  G +G   + G KGE G  G AG  G  G  G+QG                    V+G +GD GP                               G+ G  G  GPKGD GF  + PG  G  G+ G KG++G  G  G  G KG  G +G++GD GD+GV
Sbjct:  646 GPPGAAGLPGSPGFPGPQGDRGFPG-----TPGRPGIPGEKGAVGQPGIG---------------FPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGI-GLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGI---RGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGL---PGLT-----GQSGLPGLPGQQGTPGVPGFPGSKG--EMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEK--GAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPG---------------------------MPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGE------------------------------------------QGVPGRGFPGFPGSKG---DKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGM-PGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGV 1336          

HSP 5 Score: 151.754 bits (382), Expect = 4.271e-36
Identity = 294/919 (31.99%), Postives = 373/919 (40.59%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKG------ERGD-------------------------------TGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGL--SGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGF---PGEKGDIGVTGVPGDS-ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFE--------------------------------------GLVGDPGILAIGEKGPKGFQ---GNIGERGNPGIKGYKGNSGFP-------DITLKGYKGIPGEIGPKGFQGLPGEK---GFKGEIGPTGTSGLRGRKGDQGPQGYKG---------VQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGR--IGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLG---------------VKGERGDPGPDGYEGQ---------------RGPKGPKGDKGF--SILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G++GDPG  G+ G+ G  G  G+ G  G+ G KG  G  G  G +G  G       RGD                                  P  EA K+    G  G  G  G  GF G +                 G++G  G+ G  G PG KG+ G+ G+   G+PG  G  G  G+ G  G+ GR G NGL G  G QG  G  G+ GL G+KG  G  G    PGEKG IG  GVPG+  +TGP                                  G  G+RG+ G  G +                                      G  G PG+   G KG KG Q   G  G+ G PG+ G +G  G P       ++ + G  G PG  GP G  GLPGEK   G  G  GP G  G +G KGD G  G  G         ++GQKG  G  G++G  GDKG  G+ G+ G+ G  G+ G+ G  G KG  G  G P   G+ G KG +G  G  G  G KGV G+ G +G  G PG+   G+KGEKG  G   IG  G  G KGD G  G PGS G +G++G  G  G                            PG PG +GS G+ G        G+KG+ G  G  G  G KG  GL G  G  GP G KG+ G +G+ G+ G KGE                                          +G+ GR   G  G +   G+ G KGE G  G AG  G  G  G+QG                    V+G +GD GP G  G                 GPKG KG++G+  +   PGP+G+ G +G  G  GS    GI GSKG+ G  G+ G  G KG+ G QG+ G++
Sbjct:  541 GDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQ-----------------GDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGI-GLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGP---------------------------------PGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEK--GAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPG---------------------------MPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGE------------------------------------------QGVPGRGFPGFPGSK---GDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGS---PGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQ 1331          

HSP 6 Score: 142.124 bits (357), Expect = 3.620e-33
Identity = 176/482 (36.51%), Postives = 220/482 (45.64%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSG------------------------PKGIKGERGDTG---LPGKEAEK-IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPG--------------KHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGF---PGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGD--PGIL-AIGEKGPKGFQGNIGERGNPGIKGYKGNSGF---------------PDITLKGYKGIPGEIGP---------------KGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQG 3231
            T G  G  G  G PG  GE+G  GL G SG +G+ G  GDKG+ GL G  G                        P G KG RGD G   +PGK+ +   PG  G +GD G  G  G  G  G   +V  + L    G+ G  G+ GSQG  G PG KG+KGE G SG+PG                G  G+ G+ GEKG+ G  G  G  G RG  GN+G  G  GL G KGD+G  G    PG KG+ G+ G PG   TGP G                           Q G+ G  G+ G +G+KG +G+ G   PG   + G+KG KG  G  G  G+PGI G KG  GF               P   ++G KG   + GP                GF G+ G KG KG  G  G  G+ G KGD G QG  G+ G  GI G  G+MG  G  G  G++G  G+QG +G++G+QG
Sbjct:  886 TPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGP--TGPAG---------------------------QKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKG---DRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQG 1335          

HSP 7 Score: 141.354 bits (355), Expect = 6.269e-33
Identity = 277/837 (33.09%), Postives = 345/837 (41.22%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESG-------IHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKG--------------------------EKGKNQNVNVL--------------LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGF-----IGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI---------------GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGN---------QGPAGDGIKGMKGLIGPQGQKGESGYKGVQGL---------AGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVG 4275
             +GD+G  G  G  G  G QG  GL G  G KGE G       + GDKG+ G  G  G  G  G  G  G PG     +PG KG  G +G  G++G  G                          EKG+                     +    G  G  G+ GS G  G  G++G  G  G  GIPG+ G VG  G  G  G  G KG +GL G  GR G+ G  G  GL G  G +G      IG PG KG  G+ G+PG                               GEKG +G  G  G +G +G  G +G+ GDPG   +               G  GP G QG  G  G PGIKG KG  GFP + + G KG   + G +G  GL G+ G  G  G  GT G+ G  G +G  G  G  GQ G  G  G  G  G+KGD G  GS G +G  G KG++G +GL G+ G+         +G  GD  +G KG IGP G KG  G  G  G+          G  GPKG PG +   GS G  G KG +G MG+ G  G+ G  G+PGS G  G  G++G KG+K                                +  +   G   +  ++GD+G  G  G  G KG+KG+ G  G  G  GP+G  G  G  G  G                                    + G +G KG  GL G+ G    GE G  G  G TG  G+KGE           P  D   G  G KGE+G PG  G+ G  G KG KG KG  + +PG  G  G+ G KGE G
Sbjct:  496 AKGDRGLPGRDGLEGLPGPQGSPGLIGQPGAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGRDGHPG-----LPGPKGSPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGI-GFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGIGLPGLKGQPGLPGIPGTP-----------------------------GEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKG---DKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGD--QGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEK-------------------------------GQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPG------------------------------------LPGEKGDKGLPGLDGVPG--VKGEAGLPGTPGPTGPAGQKGE-----------PGSDGIPGSAGEKGEQGVPG-RGFPGFPGSKGDKGSKG-EVGFPGLAGSPGIPGVKGEQG 1210          

HSP 8 Score: 122.865 bits (307), Expect = 3.403e-27
Identity = 217/658 (32.98%), Postives = 273/658 (41.49%), Query Frame = 1
Query: 2800 SGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG---------------------------------DGIKGMKG--------LIGPQGQKG---------ESGYKGVQGLAGDKGPKGFPGKN----IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKG--------LLGSEGDKGEKGNPGITG 4587
             G  G  GL G PG       GP+G +G  G  G PGI G KG  G P I      G PG  GPKG  GLPGE G  G  G  G +GL G  G QG +G  G+    G+ G+ G+ G  G  G  GE+GSIG  G  GE+G  G  GL+G++G+ GP G                                  GIKG KG        + GP+G KG         +SG  G+ G  G  G  GFPG      +MG+ G+ G+ G  G  G+ G KGD G   LPGS G +G  G +G KGD G  G PGS                                     + +G KG+ GEKG++G  GDKG+RG  G  G  G  G  G  G+ G KG+ G  G  G  GL G KG                                 + G    G  G++G  G  G +G  G  G+ G +G +G +G  GIG+ G  G++GD G  G+ G  G KG KG  G         G  G  GP+G  G++G  G PG  GEKG++G+ G  G  GV+G  GL G                               G +       IPG  G+KG          G  G KG+KG+ G  G
Sbjct:  645 PGPPGAAGLPGSPGF-----PGPQGDRGFPGTPGRPGIPGEKGAVGQPGI------GFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGI----GLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHG---LPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMG------------------------------SMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGS--------------------------------VGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTP-------GMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGT-----------------------PGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVG 1192          

HSP 9 Score: 117.087 bits (292), Expect = 1.722e-25
Identity = 277/892 (31.05%), Postives = 334/892 (37.44%), Query Frame = 1
Query:  298 LLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGV-LPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIG---YQGDKGDIGELG-----------------------------------FKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNC----SDGDAGNRGDKGFPG---IPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPG---------EVGEQGL--RGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERG------------DTGLPGKEAEKIPGDKGIQ------------------------------------GDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIP-------------------------------------GKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQ 2544
            L GP G  G     G PGF G +GDRG PG  G  G  G KG  G  G IG  G+ G  G++                  G  G+ G+ G+ G  G++G+ G PG QG+KG          + G+ LP  +G  G  G  G  GE G  G  G PG +G+ G    QG +GD G  G                                    KGEKG P     LD      G KGDKG      LT  +    + GQ+G  G PG  G  G+ G  G  G+ GS G  G  G+ G+ G  G  G  G  G PG  G  G  G  G PG   +       G  G+ G KG  G  GD         G RGD G  G  G DG  G PG  G +GD GL G  G  G  G    V   G  G  GEKG+ G+ G  G  G  G KG KG+KG  G+  IG  GR G       KGD G AG  G  GEKG+ G  GT  +PG+                         G +GS  N     S G  G +GDKG PG   +PG +G  GL G                                                   T G  GP+G++G+PG         E GEQG+  RG  G+ G KG+ G  G+ G  GLAG  G  G+KGE+G              G PG   E   GD+G Q                                    G  G  GD GF+G  G   +  +  T  KGD G  GV G QG  G PG +G KG+ G  G+P                                     G  G  G  G  G  G  G  G  G DG  G++
Sbjct:  644 LPGPPGAAGL---PGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPG-IGFPGLPGPKGVD------------------GLPGEIGRPGSPGRPGFNGLPGNPGPQGQKG----------EPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFP-GFPGLDMP----GPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDK--------GSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGD------KGDQGLAGFPGSPGEKGEKGSAGTPGMPGSP------------------------GPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPG---------------------------------------------------TPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGI--TGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPKGQQGVTGSVGLPGPPGVPGFDGAPGQK 1407          

HSP 10 Score: 103.99 bits (258), Expect = 1.737e-21
Identity = 207/595 (34.79%), Postives = 256/595 (43.03%), Query Frame = 1
Query:  295 GLLGPKG------EMGFGGHEGKPGFRGVKGDRGP-----------PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQ--------------------------------------KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGV--LPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGI-----PGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGP------IGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG------------------SCFNCSDGDAGNRGD 1818
            GL GPKG      E+G  G  G+PGF G+ G+ GP           PG  G+ G  G  G  G KG IG  GV G  G+ G              G +G  G PG                                       KG  G  G+ G+  +PG +G+KG +G  G +  Q G+  LP ++G  G  GF G KGE+G  G  G+PG+ G  G  G  G+ G+ G  G  G           RG+ G KGDKG      +  +   V +   KG                KG +G  G  G  G KG RGD G  G  GK G+ G PG+PG  G PG  G PG  G  GP+G +G  G  G  G KG+ G  I  S  V G  G++G KGEKG  G  GI     PGD+G +G +G  G  GEKG KG +      G  G  G  G RG  G  G  G  G  G KGDKG+ G+D + G KG  G+ G  GP G  G  GE G        GEKG+ G  G   PG  GSKG KG  G +G  G+ G  G  G KG                  +  +  +G  G+RG 
Sbjct:  693 GLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGP------------PGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLD-MPGPKGDKGSQGLPGLTG-QSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSG----------PRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKG---------------QKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPG--IPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSA------GTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGP 1240          

HSP 11 Score: 102.449 bits (254), Expect = 4.429e-21
Identity = 148/419 (35.32%), Postives = 181/419 (43.20%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKG-----LEGVKGDRGF---IGFPGEKGDIGVTGV---------------------PGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKG------FTGLRGESGDKGFEGLVG---DPGIL-AIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGY-----------------------------KGIPGEIGPKG------------------FQGLPGEK 3021
             +GD G SG  G PG  G +G  G  G  G  GE G+ G  G +G+ G  G KG KGE+G +GLPG      PGDKG QG  G  G  G KGEKG        +    G  G  G  G  G+ G PG KG KG  GL G+PG  G+ G  G  G  G  G+KGE G DG  G  G  G +GV G       G KGD+G    +GFPG  G  G+ GV                     PG  + GP GD+G +G  G+ G  G  G  G  G  G  GDKG        G+ G  GD GF+G+ G    PGI  + G+ G  G  G  G++G PG++G KG+ G   +                                  KG+ G  GPKG                  F G PG+K
Sbjct:  991 PKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPG--MPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPKGQQGVTGSVGLPGPPGVPGFDGAPGQK 1407          

HSP 12 Score: 94.7449 bits (234), Expect = 1.196e-18
Identity = 161/490 (32.86%), Postives = 197/490 (40.20%), Query Frame = 1
Query:  286 SCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSG--------------------LQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGL---KGDKGVKGMDMI----GTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGT 1671
            S  G  G +GE G  G  G  G RG  G    PG  G+ G  G+ G  GPKG  G  G  G+ G+ G              G  G  G PG  G  G+ G  G QG+PG  GEKG KG KG S LP  G+ P   GDKG +G +G  G  GE G+ G  G  GM G  G +G  G +G  G  G P             G+KGDKG                                      G +G  G KG  GL G  G  GP G+ G+PG +G P                              G++G KG +G+ G          G +GD+G KGE G  G  G PG  G +G+ G                    ++GP G++G +G+      PG  GP G  G+ G  G  G +G  G  G+   KGD G +GM  I    G  G KG  GL G  G  G  G  G  G KGD GD G 
Sbjct:  945 SMKGQKGDQGEKGQIGPTGDKGSRGDPGT---PGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGP------------KGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGI-PGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLP-------------GEKGDKGLP------------------------------------GLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIP------------------------------GSAGEKGEQGVPGRGFP---GFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGV 1336          

HSP 13 Score: 73.1738 bits (178), Expect = 4.006e-12
Identity = 162/459 (35.29%), Postives = 199/459 (43.36%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGD---RGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGY--EGRAGSKGAEGLKG---------------IRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSX-------XXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMI-GTKGRKGVN 1584
            G  GPKG+ G  G  G PG  G KG     G PG+ GEKG  G  G QG  G  G+KG +G  G +G  G      P    G++G  G PG  G  G +G  G  G+PG  G +G  G      P    LP E+GDKG  G  G+ G  GE G  G PG  G  G +G+ G  G  G  GEKGE  V         G  GDKG KG      L  +     +KG++G  GPPGP G  G  G  G+  EG  G +G +G  G               I G  G  G  G PG  G PG                             G+ G +G  G+ G     S  +TG +GD G  G  G  G +G+PG +G +GD G QG  G KG +G              PG  GP+G  GL+GL G  G +G+QG  G  G  G  G+    G  G+KG  
Sbjct:  987 GQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGD-KGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPG--NIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPG---------------------------PKGDPGFQGMPGIGG-----SPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPKGQQGVTGSVGLPGPPGVPGFDGAPGQKGET 1410          

HSP 14 Score: 65.855 bits (159), Expect = 6.274e-10
Identity = 132/398 (33.17%), Postives = 166/398 (41.71%), Query Frame = 1
Query: 2341 YKGDNGEKGVKGSQGTAGFPGNKG---------SKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE---------KGDIG--VTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGL-------------VGDPGILAIGEKGPKG--FQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGF--KGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIG-IQGYQ--GEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKG 3414
             KG  GE+G+ G QG  GFPG +G          KG+ G  G+PG  G  G  G  G  GN G  G  G DG  G  G  G  G KG  G  G  G  GF G          KGD G  +  VPG  +                                  G++GF G+ G  G  G  GL                      GEKG  G  FQG  G++G  G+ G  G  G   +  KG     GE G KG  G PG  G+  KGE G  G  G  G+ G++G +G  G+ G  G  G+ G  G QG+KG+ G  G  G + G    GEKG++G  G  GL+G  GP G      +         G++G  G  G  G+KG +GFPG ++ G  G
Sbjct:   44 VKGQKGERGLPGLQGVIGFPGMQGPEGPHGPPGQKGDAGEPGLPGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGEILGHVPGTLLK---------------------------------GERGFPGIPGMPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPKGDKGEQGVSGPPGVPGQAQVKEKGDFAPTGEKGQKGEPGFPGVPGYGEKGEPGKQGPRGKPGKDGEKGERGSPGIPGDSGYPGLPGRQGPQGEKGEAGLPGPPGTVIGTMPLGEKGDRGYPGAPGLRGEPGPKGFPGTPGQPGPPGFPTPGQAGAPGFPGERGEKGDQGFPGVSLPGPSG 408          

HSP 15 Score: 60.077 bits (144), Expect = 3.695e-8
Identity = 83/262 (31.68%), Postives = 107/262 (40.84%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGI--PGKHGK--------------------------------------VGNSGKDGEKGNMGRKGEN----------------------GLDGRRGRQGNMGIKGVKGLEGVKGDR---GFIGFPGEKGDIG 2637
            GE+G+PG+ G +G  G DG  G++G  GI GD G  GL G  GP+G KGE G  G PG     +P   G +GD G  G  G +GE G         T  +         G  G  GFPG +G KG+ G  G+  PG  G+                                       G  G  GE G  G+KGE+                      G  G+ G +G+ G+ G  GLEG+ G +   G IG PG KG+ G
Sbjct:  275 GEKGEPGKQGPRGKPGKDGEKGERGSPGIPGDSGYPGLPGRQGPQGEKGEAGLPGPPGTVIGTMP--LGEKGDRGYPGAPGLRGEPGPKGFPG---TPGQPGPPGFPTPGQAGAPGFPGERGEKGDQGFPGVSLPGPSGRDGAPGPPGPPGPPGQPGHTNGIVECQPGPPGDQGPPGTPGQPGLTGEVGQKGQKGESCLACDTEGLRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIGQPGAKGEPG 531          

HSP 16 Score: 59.3066 bits (142), Expect = 6.441e-8
Identity = 172/478 (35.98%), Postives = 220/478 (46.03%), Query Frame = 1
Query: 2182 GIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKG-----LEG--VKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKG---PKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPI--------------GLPGSIGFQGQEGQRGLKGD 3543
            G+KG++G+ GLPG +   + G  G+QG  G  G  G KG+ G+            G  G KG +G  G AG+PGN G  G  G  G PG  G  G +G  GE+G +G  G  G  G  G  G  G+KG  G     + G  +KG+RGF G PG  G  G+ G+           +G  G  G  G  G  G  G  GEKGQ+G   F G +G+ G++G  G  G PG   + EKG   P G +G  GE G PG+ GY            G KG PG+ GP+G  G  GEKG +G  G  G SG  G  G QGPQ      G+KG  G+ G  G+            IG     GEKG++G  G  GL+G  GP G      +         G++G  G  G  G+KG +GFPG ++ G  G  G  G  G  G  G  G    I              G PG  G  G+ GQ+G KG+
Sbjct:   43 GVKGQKGERGLPGLQG--VIGFPGMQGPEGPHGPPGQKGDAGE-----------PGLPGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGEILGHVPGTLLKGERGFPGIPGMPGSPGLPGL-----------QGPVGPPGFTGPPGPPGPPGPPGEKGQMGSS-FQGPKGDKGEQGVSGPPGVPGQAQVKEKGDFAPTGEKGQKGEPGFPGVPGY------------GEKGEPGKQGPRGKPGKDGEKGERGSPGIPGDSGYPGLPGRQGPQ------GEKGEAGLPGPPGT-----------VIGTMPL-GEKGDRGYPGAPGLRGEPGPKGFPGTPGQPGPPGFPTPGQAGAPGFPGERGEKGDQGFPGVSLPGPSGRDGAPGPPGPPGPPGQPGHTNGIVECQPGPPGDQGPPGTPGQPGLTGEVGQKGQKGE 465          

HSP 17 Score: 58.9214 bits (141), Expect = 8.433e-8
Identity = 86/254 (33.86%), Postives = 103/254 (40.55%), Query Frame = 1
Query: 2890 GERGNPGIKGYKGNSGFPDI------------------------------TLKGYKGIPGEIGPKGFQGLPGEKGFK--GEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGI---QGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            GERG PGI G  G+ G P +                              + +G KG  GE G  G  G+PG+   K  G+  PTG  G +G  G  G  GY    G+KG  G  G  G  G  G+ GERGS GI    GY G  G QG  G KG  G  GP G  I  M     P G+KG+ GY G  GL G+ GPKG         +         G+ G  GF G+                  RG KGD+
Sbjct:  173 GERGFPGIPGMPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPKGDKGEQGVSGPPGVPGQAQVKEKGDFAPTGEKGQKGEPGFPGVPGY----GEKGEPGKQGPRGKPGKDGEKGERGSPGIPGDSGYPGLPGRQGPQGEKGEAGLPGPPGTVIGTM-----PLGEKGDRGYPGAPGLRGEPGPKG---FPGTPGQPGPPGFPTPGQAGAPGFPGE------------------RGEKGDQ 396          

HSP 18 Score: 52.7582 bits (125), Expect = 7.128e-6
Identity = 114/349 (32.66%), Postives = 141/349 (40.40%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEK------GLAGFSGPKGIKGERGDTGLPGKEAEKIP-----GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKV-----GNSGKDGEKGN-----------MGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFP------GEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKG 2970
            T+G +GP G  G PG  G  G+ G DG  G  G  G +G KGE+      GL GFSG  G  G  G  G PG+    +P     G++G  G  G  G  G  G +G                     +  Q  + F G KG KGE G+SG PG  G+      G+    GEKG             G KGE G  G RG+ G  G KG +G  G+ GD G+ G P      GEKG+ G+ G PG  I                                 LG+KG  G  G  G +G  G  G PG             G  G  G PG +G KG+ GFP ++L G  G
Sbjct:   89 TKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGEILGHVPGTLLKGERGFPGIPGMPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPKGDKGEQGVSGPPGVPGQAQVKEKGDFAPTGEKGQKGEPGFPGVPGYGEKGEPGKQGPRGKPGKDGEKGERGSPGIPGDSGYPGLPGRQGPQGEKGEAGLPGPPGTVI-----------------------------GTMPLGEKGDRGYPGAPGLRGEPGPKGFPGTPGQPGPPGFPTPGQAGAPGFPGERGEKGDQGFPGVSLPGPSG 408          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Mouse
Match: Col4a3 (collagen, type IV, alpha 3 [Source:MGI Symbol;Acc:MGI:104688])

HSP 1 Score: 246.128 bits (627), Expect = 6.785e-65
Identity = 102/240 (42.50%), Postives = 144/240 (60.00%), Query Frame = 1
Query: 4741 HPGNQGETRGNT---GSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRNQ 5448
            +PG++G     T   G IF  HSQ+T IP CP  T+ L+ G+S L + G++RAH  DL + GSCLQ F+ +PF+FC     C ++ RND +YWLS+   M M M  I+   ++ Y+SRC VCE P+   A HSQ+T  P CP  W +LW G SF+M T  G+ G GQ L+SPGSCL  F+   F+EC  +G C YY     FWL + +  + F+  +   +K    E +I++C VCM+ +
Sbjct: 1429 NPGDRGTPATGTRMRGFIFTRHSQTTAIPSCPEGTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVHSQTTAIPPCPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGDLEKIISRCQVCMKKR 1668          

HSP 2 Score: 87.4261 bits (215), Expect = 1.670e-16
Identity = 172/561 (30.66%), Postives = 213/561 (37.97%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYS--GKKGESGIHGDKGEKGLAGFSGP--------------------------------------KGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGV------------------KGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI----GEKGPKGFQGNIGERGNPGIKGYKGNSGFP---------------------DITLKGYKGIP------GEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRK---------------------------GDQGPQGYKGVQGQKGIIGMIGEM----GSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKG 3345
            T+G  G  GE G PG  GE G+ G  G    G+ G+ G  G  GE+G AG +G                                       + I G RG  GLPG    K  G  G +GD G  GD G  G        +       G  GE G                   KG  G  G+PG  G  G  G  G  G+ G +G  G  GEKG  G KGE G  G+ G      +KG KG  G+K   GF+G PGEKG+ G  G+PG                            G+ G  G  G +G TG RG  G  G  G+ G  GI+ +    G KG  G  G  G  G  GI G +G+ G P                     D   KG +G+P      G  GP G  G PG  G  G+ GP G  GL+G+K                           GDQG  G  G  G+KG  G++G      GS G  G  G+RG  G+ G  G KG  G +G +G  G  G  G        + GP+G +G  G +G
Sbjct:  714 TKGSPGCPGEMGKPGRPGEPGIPGAKGEPSVGRPGKPGKPGFPGERGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLNGLK--GQPGRRGDTGPKGDPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTTGPPGLPGKPGSQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLK---GFVGNPGEKGNRGNPGLPGPKGL-----------------------EGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRG 1246          

HSP 3 Score: 85.8853 bits (211), Expect = 5.479e-16
Identity = 189/574 (32.93%), Postives = 243/574 (42.33%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESG------IHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKG-----------------------NMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEI--------------GPKGFQGLPG-----------------------EKGF------------------KGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERG------SIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGS 3498
            G  G PG  GE+G  G  G  G+KG+ G      + GDKGE GL GF G  G KG RG+ GLPG +  +     G+ G  G  GD G +G  G+               G  G+ GS G  G PG KG KG +GL G+ G+ G  G  G  G+KG                       + G+KGE G+ G  G+ G  G  G     G  G  G  G PG  GD+G+ G            KG  G  G  G  G  G  G+ G  G  GD+G  G+ G  G+KG  GL+G       G KG  G  G  G+RG PG+ G  G  G   +   G +G PG                GPKG +GLPG                       +KGF                   G  G  GT GL G +GD G  G+ G++G+KG  G +G +G  G  G  G  G      ++ +    G  G  G  G  G+KG+ GP G  + G+ G  GP+G+ G+ G  G  G AG KG           +KG KG +G  G  G+ G KG+ G  G P +
Sbjct:  914 GSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEG--LPGLPGPPGPRGDTGSRGNPGRP--------------GPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGA---PGSPGSPGHPGKPGPAGDLGLKG-----------QKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLG----AYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGV--MGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKGNPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLG--LPGIPGPCGPRGKPGKDGKPGTPGPAGTKG-----------NKGLKGQQGPPGLDGLPGLKGNPGDRGTPAT 1438          

HSP 4 Score: 79.7221 bits (195), Expect = 3.765e-14
Identity = 190/580 (32.76%), Postives = 242/580 (41.72%), Query Frame = 1
Query: 2077 EQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGP------KGIKGERGDTGLPGKEAEK-------IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKG-----------------------NMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT-LKGYKGIPGEIGPKGFQG--------------LPGEKGFKGEIGPTGTSGLRGRKGDQGP--------------QGYKGVQGQKGIIGMIGEMGSQGD---------KGDTGERGSIGIQGYQGEKGNQGSLG----------------------LK-----------------GLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIG 3477
             QG RG  G  G KGE G  G KGE+G  G  GP      KG KGE G  G  G   EK       +PG KG++G  G  G  G +G+ G   N         G  G  G+ GS G  G PG KG KG +GL G+ G+ G  G  G  G+KG                       + G+KGE G+ G  G+ G  G  G     G  G  G  G PG  GD+G+ G            KG  G  G  G  G  G  G+ G  G  GD+G  G+ G  G+KG  GL+G                   G +G+PG+ G KG+ G P ++ L G KG+ G++GP+G  G              +PG KG +      G  GLRG  G+ GP              +G+ G  G KG+ G +G+MG  G           G  G+ G  G  G +GEKGN G LG                      LK                 G+KG+ GP   G+ G+ G  GP+G+ G+ G  G  G AG KG KG         KG++G  G  G  G+KG  GD G
Sbjct:  909 SQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGN--------PGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGA---PGSPGSPGHPGKPGPAGDLGLKG-----------QKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLG----------------AYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDR------GLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKGNPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPL--GLPGIPGPCGPRGKPGKDGKPGTPGPAGTKGNKGL--------KGQQGPPGLDGLPGLKGNPGDRG 1434          

HSP 5 Score: 78.9518 bits (193), Expect = 7.203e-14
Identity = 161/478 (33.68%), Postives = 196/478 (41.00%), Query Frame = 1
Query: 2056 GDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFS-----------------GPKGIKGERGDTGLPGKE-------AEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKG----VKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESG-----------------DKGF-EGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGL---------------RGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLI 3306
            G PG  G +G  GL G +G+ G +GIHG +G+KG  G+S                 G KG KGERG  G PG+        A   PG  G  G  G  GD G KG+KG                        ++G QG  G PG  G KGETGL G                    G KG  G+ G +G +G  G+ G+ G +GV GD G  G PG  G  G  G+PG  I GP                               GD+G  GLRG  G                 DKGF            +G+ GP GF G  G  G PG++G  G  GFP I  KG KG PG +GP G  G  G KG  G  G  GT  +                G KGD GP G  G+ G  G  G  G+ G  G  G  G +G+ G++G QG  G  G  GLKG  G++G    G + M+G I
Sbjct: 1019 GVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGA-----------------YPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPK------------------------------GDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGI--KGEKGNPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLGLPGIPGPCGPRGKPGKDGKPGTPGPAGTKGNKGLKGQQGPPGLDGLPGLKGNPGDRGTPATGTR-MRGFI 1446          

HSP 6 Score: 74.7146 bits (182), Expect = 1.263e-12
Identity = 193/529 (36.48%), Postives = 237/529 (44.80%), Query Frame = 1
Query:  313 GEMGFGGHEGKPGFRGVKGDR--------GPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS------------------LPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNK------GMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGI------------------RGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGD------------TIDISGNVTGVRGDRGEKGEKGIDGDR---------GIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKG-MDMIGT-KGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIP 1680
            GEMG  G  G+PG  G KG+         G PG  GE+GN G  GD G  G+ G  G  G  G++G  G PG  G  G  G  G C  PG +G  GL G +G++G PG +G+ G KG  G                     P E   P ++G  GA GF G  GE GE G +G PG        G  G QG +G +G  G KGEKG P        ++GE G+KG  G S TT         ++KG KG            + G KG+ G  G KG  G  G+                  RGD G  G  G+PG +G PG  GI G+PG +G  G  G        G AG  GL G  G +GD                     G+ GD+G+KGE+G+ G           G PG  GS G  G  GP G+ G KG+      PG  GP G  GL GL G  G RG+QG  G+ G  G KG   ++G   G KG  G+ G KGD G  G +G  G KG +GDVG   P
Sbjct:  722 GEMGKPGRPGEPGIPGAKGEPSVGRPGKPGKPGFPGERGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPGRC-IPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTTGPPGLPGKPGSQGQRGSLGIPGMKGEKGRP-------GAKGERGEKGKPGPSQTT---------LLKGDKG------------EPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLP------GLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGP 1215          

HSP 7 Score: 73.559 bits (179), Expect = 3.385e-12
Identity = 173/503 (34.39%), Postives = 208/503 (41.35%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGI---------HGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKY---------KGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEK---------------------------GNMGRKGENGLDGRRGRQGNMGI----KGVKGLEGVKGDR---GFIGFPGEK---GDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGE-----------------SGDKGF-EGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKG 3300
            +GDKG  G +G  G  GE+G RG  G  G KG  G+          GD G +G  G  GP G+ G  G  G+PG +  K    +PG  G  G  G  G +G KGE G ++                  KG  GE+GV G  G +G  G  G+ G  G  G PGK G  G+ G  G+K                           G+ GR G  G  G +G  G +G     KG  G+ G KGDR   G  G PG K   GD+G  G PG +                         +      G  GD+G  GLRG                   GDKGF            +G+ GP GF G  G  G PG++G  G  GFP I  KG KG PG +GP G  G  G KG  G  G  GT  +    G  GP G  G  G KG  G +G     G  G  G RG  G  G  G  G  G+ G KGLKG QGP G DG+ G+KG
Sbjct:  949 KGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTAGL------------------PGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGI--KGEKGNPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLG---LPGIPGPCGPRGKPGKDGKPGTPGPAGTKGNKGLKGQQGPPGLDGLPGLKG 1428          

HSP 8 Score: 60.8474 bits (146), Expect = 2.487e-8
Identity = 102/309 (33.01%), Postives = 127/309 (41.10%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLD------GYSGKKGESGIHGDKGEKGLAGFSGPKGI------KGERGDTGLPGKEAEKIPGD---------------KGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRK--------------GENGLDGRRGRQGNMGIKGVKGLEGVKGDR---GFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFE 2820
            +G  G  G RG PG+ G  G  G +      G+ G +GE+GI G KG+ G  GF GP         KGERG  GLPG +  + P                  G++G +G  G KG KGE+G      V      G  G  G  G  G  G PG+   K   G  G+PG  G  G  G DG KG  G                G  GLDG +G  G  G+ G+KG  G  G     GF GFPG++G  G+ G  GD+                                GQ+G+ G  GLRG  G KGF+
Sbjct:  287 KGAPGEPGPRGKPGKDGAPGFPGTEGAKGNRGFPGLRGEAGIKGRKGDIGPPGFPGPTEYYDAYLEKGERGMPGLPGPKGARGPQGPSGPPGVPGSPGLSRPGLRGPIGWPGLKGSKGERGPPGKDTVGPPGPLGCPGSPGPPGPPGPPGCPGDIVFKCSPGEHGMPGDTGPPGVPGLDGPKGEPGSPCTECHCFPGPPGVPGFPGLDGIKGIPGGRGVPGLKGNPGSPGSAGLPGFAGFPGDQGHPGLKGDKGDTPL----------------------------PWGQVGNPGDPGLRGLPGRKGFD 567          

HSP 9 Score: 58.5362 bits (140), Expect = 1.095e-7
Identity = 138/409 (33.74%), Postives = 165/409 (40.34%), Query Frame = 1
Query: 2032 DKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGER-------GDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNM--------------GRKGENGLDGRRGRQ-----------------------------------GNM------GIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGR 3072
            DKG  GERG PG  G+ G  G DG  G  G  G  G  G  G  G      +KG++                   +PG  G++GD G  G  G  GEKG+      LL  Y G  G  GV         PG KG +G  GLSG+PG+ G +G+ G  G  G                G KG+ GL G RG                                     G+M      G  G  GL GV+GD GF GFPG KG+ G  G       GP+G  G  G  G  G +G  G + +    G  G  G  G  G  GD G  GL G PG       GP+G  G  G+ G PG  G KGN           KG+ G+ GP G  GLPG KG  G+ G T  +G R R
Sbjct: 1076 DKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLG------LKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETG----LLGAYPGPKGSPGV---------PGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKGNPG-----FLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLGLPGIPGPC-----GPRGKPGKDGKPGTPGPAGTKGN-----------KGLKGQQGPPGLDGLPGLKGNPGDRG-TPATGTRMR 1443          

HSP 10 Score: 58.151 bits (139), Expect = 1.654e-7
Identity = 204/668 (30.54%), Postives = 255/668 (38.17%), Query Frame = 1
Query: 2023 TEGDKGPSGE-----------RGDPGEVGEQGLRGLDG---YSGKKGESGIHGDKGEKGLAGFSGPKGIKGER--------------------GDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFP-GNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQ-----------------GNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESG--DKGFEGLVGDPGILA---------------IGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEI-----------------------------------------GPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIG--------------------EMGSQGDK---------GDTGERGSIGIQGYQG------------EKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGP------QGQKGESGYKGVQGLAGDKGPKGFPG----KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            ++G++GP G+            G PG  G  G  G  G   +    GE G+ GD G  G+ G  GPKG  G                      G  G+PG     +PG KG  G  G  G  GF G              + GD G  G+KG +G    P G  G+ G+ GL G+PG+ G  G  G  G KG  G +GE  L GR+G Q                       G +G  G KG +G  G  G  G+ G+ G P  S                     D G  G  G  GQ G +G  GL G  G  D G  G  G+PGI                  G KG  G  G +G+ G PG  G  G  G P +      G PG+ G  GF G  G  G  G+I                                         GP GT GL G  G +G  G +G  G KG  G+ G                    EMG  G K         G  GE+G +G+ GY G             +G +GSLG+ G+KG +G P   G +G KG  GP      +G KGE G KG  G  G+KG +G PG    K + G  G  G  G  G+ G +G  G  GP G+PGS+G  G  G +G KG
Sbjct:  402 SKGERGPPGKDTVGPPGPLGCPGSPGPPGPPGPPGCPGDIVFKCSPGEHGMPGDTGPPGVPGLDGPKGEPGSPCTECHCFPGPPGVPGFPGLDGIKGIPG--GRGVPGLKGNPGSPGSAGLPGFAG--------------FPGDQGHPGLKGDKGDTPLPWGQVGNPGDPGLRGLPGRKGFDGTPGGPGAKGPPGPQGEPALSGRKGDQGPPGPPGFPGPPGPAGPAGPPGYGPQGEPGPKGAQGVPGVLGPPGEAGLKGEPSTSTP-------------------DLGPPGPPGPPGQAGPRGLPGLPGPVGKCDPGLPGPDGEPGIPEAGCPGPPGPKGNQGFPGTKGSPGCPGEMGKPGRPGEPGIPGAKGEPSV------GRPGKPGKPGFPGERGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTTGPPGLPGKPGSQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKG 1028          

HSP 11 Score: 57.3806 bits (137), Expect = 2.695e-7
Identity = 88/253 (34.78%), Postives = 110/253 (43.48%), Query Frame = 1
Query: 2965 KGIPGEIGPK---------GFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGV---------QGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQ--GEKGNQGSLGLKGLKGNQGPAG-DGIKG--------------------------MKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSK------------GEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            KG PGE GP+         GF G  G KG +G  G  G +G++GRKGD GP G+ G          +G++G+ G+ G  G++G +G +G  G  G  G    G +G  G  GLKG KG +GP G D +                             K   G  G  G++G  GV GL G KG  G P                    G KG  G  G  G+KG  G  G  GLPG  GF G +G  GLKGDK
Sbjct:  287 KGAPGEPGPRGKPGKDGAPGFPGTEGAKGNRGFPGLRGEAGIKGRKGDIGPPGFPGPTEYYDAYLEKGERGMPGLPGPKGARGPQGPSGPPGVPGSPGLSRPGLRGPIGWPGLKGSKGERGPPGKDTVGPPGPLGCPGSPGPPGPPGPPGCPGDIVFKCSPGEHGMPGDTGPPGVPGLDGPKGEPGSPCTECHCFPGPPGVPGFPGLDGIKGIPGGRGVPGLKGNPGSPGSAGLPGFAGFPGDQGHPGLKGDK 539          

HSP 12 Score: 56.9954 bits (136), Expect = 3.529e-7
Identity = 93/287 (32.40%), Postives = 107/287 (37.28%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK------------IPGDKGIQGDVGELG--------------------DKGFKGEKGKNQNVNVL-------LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGI---------------------------------------PGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVP 2652
             GD+G  G  G PGE GE GL  L  Y G KG  G+ G KG++G+ G SG  G KG  GD G  G                 IPG KG +G  G  G                    DKGF G  G       +            G  G  GV+G  G  GFPG KG KG  G  G                                        PG  G  G  G  G  G  G +G+ G DG+ G  G  G KG KGL+G +G  G  G PG KG+ G  G P
Sbjct: 1152 RGDQGRDGIPGPPGEKGETGL--LGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKGNPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLGLPGIPGPCGPRGKPGKDGKPGTPGPAGTKGNKGLKGQQGPPGLDGLPGLKGNPGDRGTP 1436          

HSP 13 Score: 54.299 bits (129), Expect = 1.901e-6
Identity = 203/664 (30.57%), Postives = 238/664 (35.84%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKG-----------------------------------EKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTA--------------GFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGI------------------KGVKGLEGVKGD-----------------------RGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLR-GRKGDQGPQGYKGVQGQKGI------------IGMIGEMGSQGDKGDTGERGSI--------------------------GIQGYQGEKGNQGSLGLKG-------------------------LKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGD--IGPIGLPGSIGFQGQEGQRGLKGD 3543
              G KG  G  G PG  G  GL G DG  G+KGE     D+G                                     GL G  GP+G KG  GD+               + G  GE G KG  G  G    V   LT+    +  KG KG +G                 +   KG+ GE G  G PGK G  G  G +G KGN G  G  G  G +GR+G++G                   +G+ GL G KG                        RG IG+PG KG  G  G PG    GP G  G  G  G  G  G  G  G    K   G+ G  G  G  G  G +G  G+PG          G  G  G  G  GIKG  G  G P   LKG  G PG  G  GF G PG++G  G  G  G + L  G+ G+ G  G +G+ G+KG              G  GE    G KGD G  G                            G QG  G  G  G  GLKG                         L G  GP G   K   GL GP G+ G                +GFPG K   G  GE G  GR GE G+ G KG+  +G  G PG  GF G+ G  G  GD
Sbjct:  125 CNGSKGEQGFPGFPGTPGYAGLPGPDGLKGQKGEPAQGEDRGFNGKGDPGPPGVPGFQGFPGLPGFPGPAGPPGPPGFFGLPGAMGPRGPKGHMGDS---------------VIGQKGERGMKGLTGPPGPPGTVIFTLTQPYNKSDFKGEKGDEGERGEPGPPGPSGPPGDSYGSEKGAPGEPGPRGKPGKDGAPGFPGTEGAKGNRGFPGLRGEAGIKGRKGDIGPPGFPGPTEYYDAYLEKGERGMPGLPGPKGARGPQGPSGPPGVPGSPGLSRPGLRGPIGWPGLKGSKGERGPPGKDTVGPPGPLGCPGSPGPPGPPGPPGCPGDIVFKCSPGEHGMPGDTGPPGVPGLDGPKGEPGSPCTECHCFPGPPGVPGFPGLDGIKGIPGGRGVPG--LKGNPGSPGSAGLPGFAGFPGDQGHPGLKGDKGDTPLPWGQVGNPGDPGLRGLPGRKGFDGTPGGPGAKGPPGPQGEPALSGRKGDQGPPGPPGFPGPPGPAGPAGPPGYGPQGEPGPKGAQGVPGVLGPPGEAGLKGEPSTSTPDLGPPGPPGPPGQAGPRGLPGLPGPVG---KCDPGLPGPDGEPGIPEAGCPGPPGPKGN-QGFPGTKGSPGCPGEMGKPGRPGEPGIPGAKGEPSVGRPGKPGKPGFPGERGNAGENGD 767          

HSP 14 Score: 54.299 bits (129), Expect = 2.268e-6
Identity = 106/338 (31.36%), Postives = 135/338 (39.94%), Query Frame = 1
Query: 2782 TGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT-LKGY------------------KGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD--------------------------------------------------QGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGI--------QGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGF------QGQEGQRGLKGDK 3546
             G +GE G+KG  G  G PG    G  GP+G  G  G +G+PG+ G  G  G   IT L G+                   G+PG  G KG QG PG  G  G  G  G  GL+G+KG+                                                   GP+G KG  G   +IG  GE G +G  G  G  G++            ++GEKG++G  G  G  G  GP GD     KG  G  G +G+ G  G  G  G +           G+KG +G  G  GE G+KG KGDIGP G PG   +      +G+ G  GL G K
Sbjct:   42 AGTKGEKGEKGVPGSPGFPG--QKGFPGPEGLPGPQGPKGSPGLPGLTGPKGIRGITGLPGFAGPPGLPGLPGHPGPRGLAGLPGCNGSKGEQGFPGFPGTPGYAGLPGPDGLKGQKGEPAQGEDRGFNGKGDPGPPGVPGFQGFPGLPGFPGPAGPPGPPGFFGLPGAMGPRGPKGHMGDS-VIGQKGERGMKGLTGPPGPPGTVIFTLTQPYNKSDFKGEKGDEGERGEPGPPGPSGPPGDSYGSEKGAPGEPGPRGKPGKDGAPGFPGTE-----------GAKGNRGFPGLRGEAGIKGRKGDIGPPGFPGPTEYYDAYLEKGERGMPGLPGPK 365          

HSP 15 Score: 52.373 bits (124), Expect = 8.225e-6
Identity = 59/151 (39.07%), Postives = 73/151 (48.34%), Query Frame = 1
Query: 4006 ERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGP---------------------QGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDK---GVRGPQGLAGE 4386
             +GQRG  G  G KGEKG  G  G+RG +G  G     LL  KG++G+PG  G+ G  G KG +G+ G     PGP                     +G  G  GP G  GS+G  G+PG KG KG  G+ G  G     G+ GPQG  GE
Sbjct:  909 SQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLL--KGDKGEPGLKGFVGNPGEKGNRGNPGL----PGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGE 1053          
BLAST of Collagen IV NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P08120|CO4A1_DROME (Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3)

HSP 1 Score: 493.426 bits (1269), Expect = 2.058e-143
Identity = 656/1902 (34.49%), Postives = 827/1902 (43.48%), Query Frame = 1
Query:  232 QDSESAAAICNRSNCTECSCNGLLGP------KGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVL-------PAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGD----------IGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXX----------IGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGE--------KGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGF---KGEKGKNQNVNVLLTKY-----KGDNGEKGVKGSQGTAGFPGNKGS---KGETGLSGIPGKHGKVGNSGKDGEKGNMGR---------------KGENGLDGRRG-----RQGNMGIKGVKGLEGVKGDRGF---IGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGD------------------------QGPQGYKGVQGQKGIIGMIGEMGSQG---------------DKGDTGERGSIGIQGYQGEKGNQGSLGLKGL-----KGNQGPAGD----GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG----------------KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGE---KGEFGDAGKRGPQGPAGDQG-------------IGLLGVKGERGDPGPDGYEGQRG------PKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRNQ 5448
            ++  +  A C      E    GL GP      KGEMGF G EG  G +G KGD GP G  G+KG  G  G  G  G+ G +G  GN G              G  G++GC G   Q G  GL+G  GM G  G  G+ G KG KG    + G         P  RG  G  G  G  GE GE GD G  G KG  G  G KG+           G  G KGEKGEP     +  +   +G +GD G      L     E   +G  G+ G  G  G  G  G +G +G  G  G+ G KG RG+ G  G  G PG+ G PG+ G  G PG  GPPGP G                 +GA G  GL G  GL G          G  G +G  G  G  G+ G PG +G +G +GL GP G                +G +     G +G KG  G+ G  G +G +G +G KG+ G  G   +G  G  G  G  G KGD G  G  G  G+ G  GDVG                                  G C +C    AG +GDKG  G+PG  G DG  G  GE+G  GE+G DG  G  G  G+KG+ G  G  G  G  G+  + + +  E  KG  G  G PG  G QG +G +G  G  G  G  G KGEKGL+G  G  G  G  G  G PG   + I G+ G  G  G  GDKG     GEKG+  +  +   K      KG+ G+ G+ G  G  G PG +G    KG TG  G PG  G  G +G  GEKGN G                 G NG  G RG     R G MG  G+ GL+G KGDRG    IGFPG  G +G  G  GD+                             G  G  G  G  G +G+ G  G  G+ G PG+  I   G +G  G  GE G+PG+ G  GN        KG +G PG  GPKGF G+ G  G +G  G  G SG +G KG                         +G QG  G  GQ+G+ GM GE G+QG               +KG  GE G  G++G  G  G  G  G KGL      G  GP G+    G  G+ G  G  G+KGE G +GV G  G+KG  G PG                   +G  G++G+KG  G  G+ G KG+ GP+GL G  G  G +G+RG++G  G                +                            E+G++GE G  G  G  G KG+RGL G  G  G  G  G  G+ G +G IG  G                                           +G+ GR   NG +G  G  G  GE+G     GE G  G  GP GPAG +G              G  G  G +GD GP G++G+RG       KG KGD+G      GP G  G+ G KG+ G  G  G  G  G  GERG  G  G  G  G  GL G++G  G     G KG+ G  G  G +G  G  GE+G IG  I G++G+KG  G  G+ G  G PG  G +G+ G+ G  G  G    KGE G   P  L                               TG +   HSQS  +P C +    LW GYS L + G++ AH  DL SPGSC+  FS +P + C +   C Y+ RND+T+WL++   + M M +   +++ Y+SRCVVCEAP+   A HSQ+   P CPNGW  LW G SFLM+T  G  GGGQ L SPGSCL  F+   F+EC  AKG C +YE    FW+   +S + F+      IK  + +  +++C VCM+N 
Sbjct:   71 KNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGA------------PGINGKDGCDG---QDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQ--------GYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVG----------------------------------GKCSSCR---AGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDA-----------------------------GLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGI--DGVRGRDGAKGEPGSPGLVGMPGN--------KGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGY-----------------------TGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGE-------------------------------------KGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQ----GPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIG--IQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYL----------------------------TGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIPM-MPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKAGERQSHVSRCQVCMKNS 1778          

HSP 2 Score: 297.36 bits (760), Expect = 8.970e-80
Identity = 494/1513 (32.65%), Postives = 622/1513 (41.11%), Query Frame = 1
Query:  220 ISLVQDSESAAAICNRSNCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGF-----SLPQEGVLPAERGD-----------------KGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKG-------DIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXX----------IGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGE--------KGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGI---------------PGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQG------------LRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAG--------FP--GNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDR---GFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGIL-AIGEKGPKGFQGNIGERGNPGIKGYKGN------------SGFPDIT-LKGYKGIPGEIGPKGFQGLPGEKGFKGEI---GPTGTSGLRGRKGDQGPQGYKGV---QGQKGIIGMIGE---------------MGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
              +V  +  A       NCT      +     E G  G  G  G  G+KG+ G PG  G  G++G KGD GP G  GDKG +G+ G++         G  G  G +G  G PG  G  G  G DG  GIPG++G  G  GP+G+     S  ++G    E GD                  G +GF G KGE G+ G  G  G +G  G +G+KG         G  G KGEKGEP     +  +   +G +GD G      L     E   +G  G+ G  G  G  G  G +G +G  G  G+ G KG RG+ G  G  G PG+ G PG+ G  G PG  GPPGP G                 +GA G  GL G  GL G          G  G +G  G  G  G+ G PG +G +G +GL GP G                +G +     G +G KG  G+ G  G +G +G +G KG+ G  G   +G  G  G  G  G KGD G  G  G  G+ G  GDVG                                  G C +C  G  G++G  G PGI               PGERG DG+NG+ G                                                  G+KG  G  G PG  GE G            L+G  GY G  G  G+ G KG +GL G  GPKG  G +G+ GL G      PG+ G  G  G  G  G  G+  K +         KGD G  G  G +G  G         P  GNKG  G+TG+ G PG+ G  G  G  G KGN G +G  G++G RG  G  G KG +G  GV G+    G  G PG  G  G  G PG S  GP                              +G  G  GL+GE GD+G  G +G PG   ++G  G +G  G  G  G PGI G KG+             G P I  ++G  G  GE G  G  G+PG KG +G     GP G +G+ G  G +GP G  GV   +G KG  G+ G                MG +GD+G  G  G  G+ G  GEKGNQG  GL G  G  G A +  KG KG  GP G +G++G  G  G  G+KG  G       G  GEKG++GR G  G  G  G+ G  GL G  G  G++G  G  G                          G PG+ G  G+ G  G      +RGDKGE G  G  G KG+ G  GL G  G  GPKG +G  G+ G+   +     +     E                                   RG++G +   G +G RG QG  G  G  G  G  G  GP+G  G  G+ + G KG  G PG +G +G  G  G  G++G   L  G  G  G+ GP G  GS G  G+ GS G+ G+ G  G  G KG  GPQG  GER
Sbjct:   55 YDIVDSAGVARGDLPPKNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLH---------GQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGP--------QGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVG----------------------------------GKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTG------------------------------------------------PPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSG-----APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGP------------------------------MGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASE--KGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPG------------------------IPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGE-----------------------RGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLA-GEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGER 1383          
BLAST of Collagen IV NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q14031|CO4A6_HUMAN (Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3)

HSP 1 Score: 388.652 bits (997), Expect = 8.340e-109
Identity = 405/1194 (33.92%), Postives = 522/1194 (43.72%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT-LKGYKGIPG---EIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIG-------IQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS----SNGERGQRG----PQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLG-VKGERGDPGPDGYEGQ------------------------------RGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSF-QMTMGHNIKTMQSEDLIAKCLVCMRN 5445
              G  GPSG  G PG  G +G RGL G  G+ G SG  G+ G  GL       G  G RG+ GLPG      PG  G  G  G +G  G  G KG   ++            E G  G QG  G  G+KG  G++GL G+ G HGK G  G  GE+G+ G  G+ G  G  G  G  GIKG  GL G  G  G  G PG+KG  G  G PG  +                                    KG  GL+G  G+ G  GL G PG  + G  G     G  GE+G+ G  G+ G  G P I   +G KGIPG   ++GP G  G PGEKG +G  GP G    R    +   +G KG QG  G  G  G  G +G+ G  G  G  G       I+G  G+ G  G +G++GL G +G +G  G  GM G  G QG +G  G  G  GL G KG  G     I GS G KG  G  G  G KG  G IG IG PG+   +G++G+ G+ GD                                    VG  G        G +GE G  G  G++G  G  G  G +G +G  G+ G +G NG+ G                                                + G+ G +      GE+G  G      G  G +G+KG+ G  G +GP G  G  GI L   + G+ GDPG  G +G+                               GPKGPKGD+G    + G  GE G+KG +GE G +G  G  G  G+ G  G++G  G +G  G QG  G+                                        IPG  GD G  G  G +G KG PGI G  G  G  G  G  G+    G +G  G +G  G+ GP G             PG  G++    G     HSQS ++P CP     LW GYS L + G E+AH  DL   GSCL  FS +PF++C   E C Y+ RND++YWLS+   + M M ++ TQ+  Y+SRC VCEAPS+  A HSQ    P+CP GW +LW G SFLM+T  GA GGGQ L SPGSCL  F+   F+EC+ A+G C Y+     FWL   +  + F ++ +   +K  Q    +++C VCM++
Sbjct:  659 IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPG-----FPGLPGKDGLPGMIGSPGLPGSKGATGDIF---------GAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIV-----------------------------------KKGLPGLKGLPGNPGLVGLKGSPG--SPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQ-TVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGN---KGEDGKVGVSGD------------------------------------VGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGT-------------------------------------KGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPG-FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDG-------------------IPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFG------------MPGMPGQSM-RVGYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPM-MPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKS 1690          

HSP 2 Score: 147.902 bits (372), Expect = 4.579e-34
Identity = 278/866 (32.10%), Postives = 342/866 (39.49%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGE------KGLAGFSGPKGIKGERGDTGLPGKEA---------------EKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKG------SKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGL---VGDPGILAI-GEKGPKGFQGNIGERGNP------GIK---GYKGNSGFPDIT----------------------LKGYKGIPGEIGPKGFQGLPGE------------KGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKG-------------VQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG-RSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPD-----GYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRG 4365
            G RGD G  G QG  G  G  G  G SG  G KGE      +G+ G  G  G +G RG  G PGK+                +  PG+KG+ G  GE G  G  G  G             GD G+ G+ G QG    PG+KG        G  G SG PG  G  G  G  G  G  G+ G +G  G  G  G + +  + G  G +G++G  GFPG  G  G+ G+ G               +               G  G+ G +G TG +G  GD G  GL    G PG+L   GE+G  G  G +G+ G P      GIK   G  G  GFP I+                      L G KG+PG  G  G +G PG             KG KG +G  G  G+ G  G  G +G KG+ G  G +G  G  G+ G+KGD G  G +GI   +    N   L LKG KG+QG AG       G  GP+G KGE+G  G             ++G++G  GP GF     MG +G  G KG  G  G  G  G+ G  G+ GS G  G  G  GLKGD G T                                             G  G  G+ GE G KG KG  GL G +G     G KG++G+ G+ G++                                       G+ G  G  G++G R   G  G  G QG  G  G  G  G  G  G  G  G    GL G KG  G PGP      G  G  GPKG KG  G  I  PG  G  G KG +G  G  GP G+PG+ G      I G  GD G  G
Sbjct:  513 GARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQG---LPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSP------------GLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSN---LWLKGDKGSQGSAGS-----NGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGF-----MGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEI-----------------------------------------SGSPGPKGQPGESGFKGTKGRDGLIGNIGFP---GNKGEDGKVGVSGDV---------------------------------------GLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLN--GLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPG 1265          

HSP 3 Score: 145.976 bits (367), Expect = 2.131e-33
Identity = 331/974 (33.98%), Postives = 423/974 (43.43%), Query Frame = 1
Query:  322 GFGGHEGK---PGFRGVKGDRG------PPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIP------------GDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXX-LRGLDGKTGKRGEQGHKGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDT 3174
            G  G +GK   PG +G+ G +G       PG+ G  G  G  G  GPKG  G  G  G  G +G KG PG  G        G  G  G+KG  G  G  G  G+PGM G  G  G KG +     +  AE G  G +G  GL G  G  GD G PG KG+       G  G LG KGE+G P        + G++G  G  G S    +   +    + G  G  G  G  G  G  G KG  G    KG  GLKG+ G+ G +G  G P   GSPG  G+  + G +G  G  G+ G  G  G  G  G +G KG+ G T  +    +G  G  GEKG++G  G  GIP            GD+GS+G +G  G  G +G+KG +     PG  G  G  G ++G+ GK G  G  G +GL G KG  G+    G  G  G  G+ G  G  G +G  G  G+ G   ++  S PG +G  G  G  G  GR G+ G  GF G KG      DG  G  GD G PG PG  G+ G+ G                                                     G  G SG +G  G +G  GL G  G+ G  G  G++G  G KG  G  GP  I G  G  GLPG + EK  G  GI   +G  G  G +G+K                 G++G  G QG AG PG  G    + ++G PG  G+ G  G+ G  G  G  G  G    +G  G+ G  G+ G +G KGD+G  GF G  G++G+ G+ G+                        G +G  G+ G  GD GF G++G++G +G  GL GDPG     E      Q   G  G PGI G  G +G P     G +G  G  G KG  G+PG+ G  G  GP G  G  G  G QGP G++G  GQ+G  GM G  G     G T
Sbjct:  631 GLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGAT---GDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGV------HGKPGLLGPKGERGSP-------GTPGQVGQPGTPGSSGPYGIKGKSG---LPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSP---GSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM--GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGS-PGPKGQPGESGFKGTKGRDGLIGNIGFPGNKG-----EDGKVGVSGDVGLPGAPGFPGVAGMRG---------------------------------------------------EPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPS-ITGVPGPAGLPGPKGEK--GYPGI--GIGAPGKPGLRGQK-----------------GDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEP-----------------------GFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEA----VQVPPGPLGLPGIDGIPGLTGDP-----GAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYT 1469          

HSP 4 Score: 136.732 bits (343), Expect = 1.351e-30
Identity = 287/848 (33.84%), Postives = 360/848 (42.45%), Query Frame = 1
Query:  313 GEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQG--YDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGE------IGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMI---------SLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGD---LGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTG--------VRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKG--VKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS----IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYS----GKKGESGIHGDKGEKGLAGFSGPKG------------IKGERGDTGLPGKEAE-------KIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQ----------GNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG 2655
            G  G  G  G PGF G KG RG PG  G+ G+ G KG+ G  G++    + G  G  G+KG PG  G  G  G  G  G PG  G+ G  G  +    G PG QG +G  G KGF    +  LP  +G  G  G  G KGE       G+ G  G PG+ G  G +G  G  G  GF G  G P K           S+ K +G  G KG  G      L  +     + G   + GP G  G +G  G  G  G  G  G  GLKGI G    +GP G+ G PGE G  G PG  GIP  R P      +G +G  G+AG++G  G +G KG+                  ++G  G+ G  G  G RG+PG +GS G +G  G  GE G+                     +G+ G  G  G  G  GLKGD G  V+     G KG+ G +G  G KG  G  G  G  G KG+ G VG S    +PGA G  G+ G  G  G  G  G +G IG  GS         G  G KGFPG P   G+ GLNG  G +G                                             T G  GPS   G PG  G  G +G  GY     G  G+ G+ G KG++G  G  GP G            I G+ GD G PG + E         PG  G   + G+ GD GF G  G            KG  G++G+ G  G  G  G KG +GE G  G PGK G  G+ G  G KG  G +G +GL G  G+           G +G+ G+ G+ G+ GD G  G  G +G  G+ G+PG
Sbjct:  661 GSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFL--GDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVK-KGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGS---------------------QGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGS--------PGLIGPKGFPGFP---GLHGLNGLPGTKG---------------------------------------------THGTPGPS-ITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGP-----------KGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPG 1416          

HSP 5 Score: 130.954 bits (328), Expect = 6.566e-29
Identity = 277/892 (31.05%), Postives = 349/892 (39.13%), Query Frame = 1
Query: 2074 GEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEA---------EKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHG------------KVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGIL-AIGEKGPKG---------FQGNIGERGNPGIKGYKG-----------------------NSGFPDITLKGYKGIPGEI-----------------------------GPKGFQGLPGEKG------FKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGS---------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKN-IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISG-RSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQG-PAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGD-------------------KGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G  G RG  G  G +G  G  G KG  G  G +G +GI+G++GD GLPG +             PGD G+ G  G  GD+G +G +G         +   G     GV G+ G  GFPG KG +G  G + I G  G              G    + E   +  K E+G  G RG QG    KG  GL+G+KGD GF    G        GVP                          G+ G  G  G +G  G  G RG+ G  G +G  G PG++  +G  GPKG          QG  G+RG+ G +G++G                         GFP    KG  G+PGE                              G  G QGLPG KG        G  GP+G  G  G  G +G +G  G  GQ G  G  GE GS          G  G  GE+G  G  G  G+ G  G +G  GL G++G  GD      G  G QG +G +G+KG  G +G  G KG  GK  ++G KGE+G+ G  G++G  G  G  GP G+ G  G  G  G  G+ G                             G  G +G  G  G   K+   G KG  G  G +G KG  G+ G++G     GPKG KG  G  G  G                                               GL GI G R   G  G  G  G +G  G  GE GD G  GP G P+  + +  L +KG++G  G  G  G  GP+G KG+                   KG S   PGP G  G++G  G  GS G TG PG  GE G +GI G  G  G  G  GL G+ 
Sbjct:  297 GLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGP--------SGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTI-GAAGLPGRDGLPGPPGPPGPPSPEFETETLHNK-ESGFPGLRGEQGP---KGNLGLKGIKGDSGFCACDG--------GVPNTGPP---------------------GEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPG--EKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHP---------------------------GKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPG---------------------------------------------IPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSG-KPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDN 1071          

HSP 6 Score: 122.865 bits (307), Expect = 1.973e-26
Identity = 294/951 (30.91%), Postives = 371/951 (39.01%), Query Frame = 1
Query: 2065 GEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIP-GDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTA---------------GFP-GNKGSKGETGLSGIPGKHGKVGNSGK-----------------DGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE--------------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKG-------------------------------YKGNSGFPDITLKGYKGIPGEIGPKGFQG------------------------------LPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKG--IIGMI-GEMGSQGDKGDTGERGSIG--------------------IQGYQGEKGNQGSLGLK--------------------GLKGNQG----PAGDGIKGMKGLIGP---QGQKGESGYKGVQGLAGDKGPKGFPGKN----IMGSKGEKGNKGRI------------GEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQG-IGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGER 4389
            G  G  G  G DGY G  G  G+ G KG KG    + P   KG +GD GLPG +    P G  G  G VG  G  G +G  G    +        G  GEKGVKG  G                 GFP G KGSKGE G  G PG  G  G  G                   G +G MG +G  G  G++G++G +G  G+ G +G++G +G IG PG                GD GV G+PG                                     GD+G  GLRG SG  G   L G PG L     GP+GF G  G++GNPG                                  +   SGFP   L+G +G  G +G KG +G                              LPG KG +G+ G  G  G  G  G  GP G  G +G+KG  I+  I G  G +GD G  G RG IG                     QG+ GEKG  G  G K                    GL G++G    P   G+ G KG+  P    G  G SG+ G  G  G KG +G PG        GSKGE G+ G +            GE G+ GF G  G  GLPG IG  G  G +G  GD                                         ++    E+G +G  G KG +G+ G  G +G+ G+ G  GPKG +G  G  G  G  G  G +G  G++G+ GL G  G  G  G+ G KG +G +G  G +  +G+ G      +G  G  G  G KG  G  G AG     GP G++G +G +G  G  G PG  G  G +G  G  G         GP G  G  G KG+ G+ GP GIP  +       ++GD G +G  G  G  G R
Sbjct:  128 GTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLA-PGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLK-----------------------------------GDEGIQGLRGPSGVPGLPALSGVPGAL-----GPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPG--LRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGD-------------------------------------IFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGL-----KGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM-------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPR 986          

HSP 7 Score: 109.383 bits (272), Expect = 2.769e-22
Identity = 209/713 (29.31%), Postives = 260/713 (36.47%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPK------------------GIKGERGDTGLPGKEAEK--------------------IPGD-KGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYK---------------------GDNGEKGVKGSQGT---------------AGFP-GNKGSKGETGLSGIPGKHGKVGN-----------------SGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGE--------------KGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSG--------------------FPDITL----KGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSG---------------------LRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG---------------PAGDGIKGMKGLIGPQGQ--------------------------KGESGYKGVQGLAGDK------------GPKGFPGKN----IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            G +GP+G +G  G  G  GL+G  G+ G  G  G  GDKG  G+ GF G                    G  G +G  G PG +                        PG  KG++GD G  G  G  G +G       +                          G  GEKGVKG  G                 GFP G KGSKGE G  G PG  G  G                   G  G +G MG +G  G  G++G++G +G  G+ G +G++G +G IG PG                GD GV G+PG                                     GD+G  GLRG SG  G   L G PG L     GP+GF G  G++GNPG +   G +G                    F   TL     G+ G+ GE GPKG  GL   KG KG+ G     G                     L G KG +G +G  G QG  G  G++G +G  G KG  GE     IQG  G++G+ GS G +G+ G  G                 G G  G KGL G  G+                          KG+ G  G QGL G K            GP GFPG        GS+G  G  G+ G  G KG  G  G + LP   GF G  G++GL G
Sbjct:   56 GIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLK-----------------------------------GDEGIQGLRGPSGVPGLPALSGVPGAL-----GPQGFPGLKGDQGNPG-RTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGL---KGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPG 724          

HSP 8 Score: 102.064 bits (253), Expect = 4.786e-20
Identity = 186/541 (34.38%), Postives = 226/541 (41.77%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGE--------PVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXX----AKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNV-----TGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPK--GDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDG 1860
            G LG  G  G  G  GKPG  G KG+RG PG  G+ G  G  G  GP G+ G  G+ G  G  G  G PG KG +G  G  G   K         +G  G++G+PG  G  G KG  G   P    LPA  G KG KG  G  G  G  G  G PG +G+ G  G  G +G  G  G  GE        PV + S  +    +  KGDKG   +            KG+ G  GPPG  G  G  G      G  G  G  G  GL G++G  G  G  G PGE+GS G  G                       G  G SGL G KG  G T++ISG+       G  G +G KG  G+ G+ G PG++G  G  G+ G +G  G  G        GE G  G  G +G  G  G  G  G KG  G  G+ G++  G  G KG +G  GP   G  G AG  GP GEKG  G +G   PG                                     G  G +GD+GFPG+ G  G+ G
Sbjct:  774 GFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVK---------KGLPGLKGLPGNPGLVGLKGSPGS--PGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSP---------------------GLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLN--GLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPG-IGIGAPG-----------------------------------KPGLRGQKGDRGFPGLQGPAGLPG 1244          

HSP 9 Score: 92.8189 bits (229), Expect = 2.665e-17
Identity = 168/485 (34.64%), Postives = 210/485 (43.30%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS----LPQEGVLPA---ERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMIS-LDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGD---------------EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKG 1650
            G+ G  G  GF G  G PG +G  G  G PG  GE G++G +G  G  G  G  G++G++G   +            +G  G  G+PG+ G  G +G DG+ G  G  G KG  G  G S    LP     P     RG+ G  G SG +G IG  G  G  G KG  G+ G  G  G  G KG  G P   I+ +    G  G KG+KGY            +   G+ G+RG             KG  G  G +G  GL G  G   P    G+PG+ G PG  G  G PG  GPPGP G    +GD G  G  G+ G KG KGD   I G  +G+ G+ G KG +G  G  G PG                 G RG SGLQG   + G    +  V  P          + G+ G TG  G QG  GL+G KG+ G+             G  G  G+ GL GP G  G  G+ GP G  G
Sbjct: 1012 GVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVE-----------ISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG--------IGAPGKPGLRG------------QKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQ-GIPG-FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQG---DPGQTPTAEAVQVPPGPLGLPG--IDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPG 1458          

HSP 10 Score: 86.2705 bits (212), Expect = 2.655e-15
Identity = 186/549 (33.88%), Postives = 228/549 (41.53%), Query Frame = 1
Query:  298 LLGPKGE---MGFGGHEGKPGFRGVKGDR------------GPPGALGEKGNEGYKGDQGPKGMI------------GDKGVQGNSGINXXXXXXXXXXXXXYTGE-------------EGCCGKPGQ------KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVLPAERGDKGA----------------KGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDI---------GELGFKGEKGEPVK-----MISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKG--IRXXXXXXXXXXXXXAKGYEGR-AGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGD-------TIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPG 1683
            L GPKGE   +GF G  G PG  G+ G R            GP G  G  G +G +G+ GP G+             GDKG QG++G NG  G  G KG  G  G              +G  GKPG       +G  GL+G  G+ G PGM GE G +G +G   LP    LP  +GD G                  GF G KG  G  G++G PGNKG  G  G  GD+         G  G +GE G P        I    S G IG KG  G+     L          G  G  I G PGP G  G  G KGY G   G+ G  GL+G +GD G  G  G  G  G+PG                            AG  G  G  GL G+               +  +GD G+ G  GI G +G  GD+G  G SGL G +G KG +G    +  PG+ GP G+ G  G+ GK G RG  G +G  G         +   G  G+ G+ G  G TGD G  GP+G +G  G  G  IPG
Sbjct:  892 LSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSL---------------------IAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQV-PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPG--IPG 1416          

HSP 11 Score: 86.2705 bits (212), Expect = 2.746e-15
Identity = 163/499 (32.67%), Postives = 205/499 (41.08%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGI---NXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQG---IPGMQGEKGRKGPKGFS----LPQEGVLPAERGDKGAKGFSGLKGEIGE--------------FGDVGEPGNKGMIGYQGDKGDIGEL--------------GFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGI---RXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD----------------------MIGTKGRKGVNGLTGPKGDTGDAGEA------GPIGEKGDIGDVGTS-IPG 1683
            E G  G +G+QGPKG +G KG++G+SG    +G     G  G  G  G  G  G PG KGA G +G  G QG    PG+ G  G  GPKG      L     +P +RGD G++GF G+ GE G+               G  G PG KG+ G  G+KG  G                G  G+KG+       D   G+ G  G KG +    +  +       G  G    +G  G  G  G  G+ G +G  GS G   L  + G  GP G+ G PG  G PGK G+                      G  G+ GL G KG  GD         G +G +G  G KG  GD G+PG +G  G  GL GP GE+G+ G    V +             G  G +G  G +G  GL G  G  G+                       + G KG  G  GL G KG  G  G A      GP GEKG +G VG   IPG
Sbjct:  454 ESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGK-------DGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLP---------------------GMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQ------------PGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPG 912          

HSP 12 Score: 85.1149 bits (209), Expect = 6.324e-15
Identity = 211/662 (31.87%), Postives = 264/662 (39.88%), Query Frame = 1
Query: 2101 GYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPG---------------NKGSKGETGLSGIPGKH-GKVGNSGKDGEKGNMGRKGENGLDGR------------------RGRQGNMGIKGVKGLEGVKGDRG---------------FIGFP----GEKGDIGVTGVPGDSITGPX-----------XXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGF--------QGNIGERGNPGIKGYKGNSGFPDIT-------LKGYKGIPGEIGPKGFQGLPGEKGFKGE--IGPTGT-----------------------------SGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGS---------------------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG-PAGDGIKGMKGLIGPQGQKGESGYKGV-----------------------QGLAGDKGPKGFPGKNIM------------------GSKGEKGNKGRIGEMGVKGFK---------GDIGPIGLPGSIGFQGQEGQRGLKG 3540
            G  G+ G  GI G  G +G  G +G  G+KGERG  GL G    K        GD G +G  GF G  G   +        +G  G  G  G+QG  GFPG                KGSKG+  L+  PG   G  G+ G  G  G  G +G  G  G                    G  GNMG+ G +G +GVKGD G               F+GFP    G KG+ G  G PG  I+GP            G+KG+KG  G+ G +G  G  G++G  GQ G KG  G  G +G +G EG  GD     IG  GP  F         GN G+ G PG+ G KG+ G   +        L    G+PG +GP+GF GL G++G  G   IG  G                              SG  G +G+QGP+G  G++G KG  G     G                       G KG  G+RGS G QG  G  G  G LG  G KG +G P    I+GM G    +G  G  G++GV                       QG  G+KG  G PG+                     G  G+KG  G  G+ G+ G K         G  GP G PG+ GF G +G RGL G
Sbjct:   47 GARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPK--------GDKGPMGVPGFLGINGIPGHPGQ--PGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLA--PGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGL-GFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPG--ISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGD-----IGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGD---RGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPG 685          

HSP 13 Score: 75.0998 bits (183), Expect = 6.713e-12
Identity = 143/424 (33.73%), Postives = 184/424 (43.40%), Query Frame = 1
Query: 2344 KGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVT---------GVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGI---------------------LAIGEKGPKGFQGNIGERGNPGIKGYKGN---SGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKG--------EIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQG-----------YQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGR--IGEMGV 3453
            KG  G  G  G QG  G  G  GS G +GL G  G  G +G  G  G+KG MG  G  G++G  G  G  G +G  GL+G  G +G +GFPG  G  G+          G  GD +  P   KG K                        GD G  GL G +G +G  G  G  G                      + +G +G KG +G++G  G  G     G     GFP    KG KG  GE GPKGF G+ G  GF G        E G  G  GL G +G  G +G +G  GQ+G  G +G  G  G +G  G++G IG+ G             G  G+ G  GL GLKG+     +GI+G++      G  G  G   + G+ G  GP+GFPG      KG++GN GR  IG  G+
Sbjct:   46 KGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMK------------------------GDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFP----KGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGD-----EGIQGLR------GPSGVPGLPALSGVPGALGPQGFPGL-----KGDQGNPGRTTIGAAGL 425          

HSP 14 Score: 66.6254 bits (161), Expect = 2.399e-9
Identity = 131/408 (32.11%), Postives = 172/408 (42.16%), Query Frame = 1
Query:  271 NCTECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP-VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKG--LKGDTIDISGN---------VTGVRGDRGEKGEKGIDGDRGIPGDE---------------GSRGDSGLQGPIGEKGNKGR 1413
            N      +G  GPKG+ G  G +G  G  G+ G+ G PG  GE G  G  GD G   + G  G  G +G+ G+ G PG  G +G  G  G  G  G KG  G  G  G+ G+PG +G  G  GP    +P    LP  +G+KG  G             +G PG  G+ G +GD+G  G  G  G  G P + + SL       G  GD G                 G  G     G  GD G  G  G +G  G +G  G  G+ G+LG  G  G+PG  G+PGK G  G PG  G  G           G  G+SGL+G  G     + + +            + G+ GD G +G  G+ G +G+PG                 G  G  GLQGP G +G  G+
Sbjct: 1071 NGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVG---LPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG-----------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIA-----GQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKA---------GPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQ 1450          

HSP 15 Score: 65.0846 bits (157), Expect = 8.067e-9
Identity = 164/531 (30.89%), Postives = 199/531 (37.48%), Query Frame = 1
Query:  397 EKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXX--------XXXXXYTGEEGCCGKPGQ---KGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGF---KGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-------IDISGNVTGVRGDRGEKGEKGIDGDRGIPGD-----------------EGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMI----GTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGL 1863
             KG +G KG+ GPKG  G  G  G  G+                  GP+G  G EG  G PGQ   KG  G  G +G QGI G +G+ G  GP  F      V+    GD G  G  GLKG+ G  G  G  G  G+    G  G +G  GF   KG++G P +                              E +   + G                 G  G  G KG  GLKGI+GD G     G     G PG+PG  G  G  G PG +G +G  G  GA G +G  G  G  G +         I   + G+ GDRG+ G +G  G  G PG                  +G  G+ GL G  GEKG+ G            P      RGL G  GK G  G +GL G KG+    +I    G  G  G  G  GPKG  G  G  G  G  G  G+ G+  PG                                     G  G RG+KG PG PG  G DGL
Sbjct:  254 PKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGF---------------PGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGP----RGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGS--PGLVH-----------------------------LPELPGFPGPRGEKGLPGFPGLPGKDGL 734          

HSP 16 Score: 60.8474 bits (146), Expect = 1.524e-7
Identity = 198/632 (31.33%), Postives = 245/632 (38.77%), Query Frame = 1
Query:  241 ESAAAICNRSNCT-ECSCNGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGE--------------LGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEV----MIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGA--------EGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT--------IDISGNVT-------GVRGDRGEKGEKGIDGDRG------------IPGDEGSRGDSGLQGPIGEKGNKGRSR----------------------GVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMD-------------MIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKG----SCFNCSDGDAGNRGDKGFPGIPGERGID 1857
            +S    C   +C+  C C    G +G  G  G +G  G +G  G  G  G  GE+G  G  G  GPKG  G  GV G  GING  G PG  GP+G  G +GC G  G  G  G  GY G+ G PG+ G+KG KG        + VL A    KG KG  GL G  G  G  G PG  G +G  G  G  G               LGF+GEKG                 KGD G         +T E+      KG+KG +G PGP G  G +G  G+ G   +            GL G RG +G  G  G PG+ G  G                         +G  G +G +G +G KGD         IDI G V        GV G  G KG++GI G RG            +PG  G +G  GL+G   ++GN GR+                             E     E G  GL G+ G +G  G KG+KGD G    D               G  G  G+ GL G +GD G  G  GP G  G +G +G S P                           G+KG    S      GD G+ G +GF G+ GE G D
Sbjct:   25 KSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKG--------DPVL-APGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGV----------------KGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGT------------------------LGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKG---DQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP--------------------------KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKD 578          
BLAST of Collagen IV NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P08122|CO4A2_MOUSE (Collagen alpha-2(IV) chain OS=Mus musculus OX=10090 GN=Col4a2 PE=1 SV=4)

HSP 1 Score: 374.4 bits (960), Expect = 3.685e-104
Identity = 402/1198 (33.56%), Postives = 530/1198 (44.24%), Query Frame = 1
Query: 2080 QGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTG---------------------------LPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKG------FTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPG-----------------IKGYKGNSGFPDIT----LKGYKGIPGEIGPKGFQGLPGEKGF----KGEIGPTGTSGLRGRKGDQGPQGYKGV---------QGQKGIIGMIGEMGSQGDKGDTGERGSI-GIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRS-SNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEV----GSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMHINVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECT-AKGHCGYYEEHKHFWLVATDSMKSFQMT-MGHNIKTMQSEDLIAKCLVCMRN 5445
            +G+RG+ G+ G  GE G+ G  G+ G  GF GP G  G RG  G                           +PG+     PG +G  G  G+ G KG  GE G           ++G  G  G+ G +G  GFPG  G  G+   SG PG+HG  G  G++G  G  G  G  GL G RG  G+ G+ G  G++G+ GDRG  G  GE+G  G  G  G +                          G+ G  GQ GD+G      F G+ G  G +GF G  G+ G   +   G KG  G  G +GN G                 IKG KG+ G   +     LKG +G+PG  G  GF GLPG  GF    KG+IG  GT GL G  G  GP G  G          +G  G+ G+ GE G  GD GD G+   + G  G +GE+G  G  GLKG  G +G AGD G  G+ G+ G QG  G  G  G  GL G +GP+G PG+  +G  G+KG+ G  G  G+ GF G      + G  G  G  G +G  G  G                                               GD G  G  G+ G++G+     L G VG  G KG +G  GE G  G+ G +G  G+       G  G+ G  G  G +G +G  G  G     G++G  G S + G  GQ+G  G+ G +G+ G  G  G++GP+G   +QG          G+ GP G  G RGPKGPKGD+GF    PG  G  G+ G   ++    G++GP G  G  G  GE G +G  GD G RG  G AG +G  G                                   +PG +GD+G +G +G  G++G PG  G                                                  G PG  G +  + G +   HSQ+ + P CP     LW GYS L   G E+AH  DL   GSCL  FS +PF++C   + C+Y+ RND++YWLS+   + M M +   +++ Y+SRC VCEAP+   A HSQ T  P CP GW +LW G SFLM+T  G  GGGQ L SPGSCL  F+   F+EC   +G C Y+     FWL  T   ++FQ T     +K       I++C VCM+N
Sbjct:  696 KGVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGA--------PGFRGSQGMPGMPGLKGQPGFPGPSGQPGQ---SGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMA--------------------------GMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGV--PGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGR--IGIPGDKGDFGWPGVPGLPGFPG------IRGISGLHGLPGTKGFPGSPGVD-------------------------------------------AHGDPGFPGPTGDRGDRGEANT--LPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKG---EQGF--------MGNTGPSGAVGDRGPKGPKGDQGFPGA-PGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSA--------------------------------VPGFRGDQGPMGHQGPVGQEGEPGRPG------------------------------------------------SPGLPGMPGRSV-SIGYLLVKHSQTDQEPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPM-MPVAEEEIKPYISRCSVCEAPAVAIAVHSQDTSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLT-TIPEQNFQSTPSADTLKAGLIRTHISRCQVCMKN 1706          

HSP 2 Score: 163.696 bits (413), Expect = 7.168e-39
Identity = 233/640 (36.41%), Postives = 283/640 (44.22%), Query Frame = 1
Query: 2023 TEGDKGPSGE------------RGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGF---SGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKD--GEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPG----DSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGER----GNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGL--KGLKGNQGPAGD-GIKG----MKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPG----KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNI 3834
            T G +GP G+            RG+PG+ G  G  G+ G SG +G++G+ G++G  G  GF   +G  GI G++GD G PG +        G QG +G  G +GF G K                 GE G  G  G  G PG  G KG  G  G PG    +    KD  GEKG+ G  G  G  G +G QG  G+ GV G  G+ G  GFI   G KGDIGV G PG      ++GP G                             G  GFTG RGE G  G  G+         GE GP G  G+IG+     G+PG+KG +G +G P   LKG+ G  G  G  GF G+ G  G +G  G  G +G  G  G QGPQG  G  G  G  G  G  G  G  G  G RG  G+ G  G KG  GS G+   G  G  GP GD G +G    + G +G  GQKGE G  G +G AG  G +GFPG     NI GS G+ G  G  G  G +G  G  GP  LPG  G +G  G  G  G K                                    G  GD   + + G  G  GEKG  G +G  GN G SG VGD GPKG KG  G  G  G++
Sbjct:  841 TPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMD--------GFQGMLGLKGRQGFPGTK-----------------GEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIK--GVKGDIGVPGTPGLPGFPGVSGPPGI---------------------------TGFPGFTGSRGEKGTPGVAGV--------FGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPG--LKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQK------------------------------------GWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSM 1380          

HSP 3 Score: 163.31 bits (412), Expect = 1.058e-38
Identity = 307/924 (33.23%), Postives = 394/924 (42.64%), Query Frame = 1
Query:  355 RGVKGDRGPPGALGEKGNEGYKGDQG------PKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGE--------EGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKG------------DIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXX--XXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGE----KGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEA----GPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCS-DGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAG-----------FSGPKGIKGERGDTG-LPGKEAEKIPGDKGIQGDVGE---LGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTA---------GFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFP 2943
            +GV+G  G PGA GE+G +G+ GD G      P G +G +G +G +G+ G  G PG  G  G  G         E    +PG +G AGL G  G++G+PG  G  G +G +G        +P   G KG  GF G  G+ G+ G  G+ G  G  G +G  G            D GE G  G  G PV M  L   RG+ G  G++G+  +           I GQKG RG PG           G++G  G KG +G  G +G+ G  G  G  G  G PG  G  G  G  GPP          +G+ G  G  GLKGY GLKG  I     V GV G  G  G     KG+ GD G+PG  G  G  G+ GP G                        + G  G TG RGE+G                 T G  GV G TGP GD GD G+     G  G KG+ G  G  IPG +G                     F GEKG+  +    G  G  G +G PG+ G+ G  GL G  G                                                 +G+ G  G  GD G+ G  G+ GL G+ G +G SG+HG  G KG  G           F GP G +G+RG+   LPG     +PG KG +G  GE    G  G +G  G +   N+  +   GD G  G+ G QG             PG KG +G +G +G PG+ G VG+ G  G+ G +G  GE G  G +G  GN G  G  G  G KG +G  GFPG  G +G  G+PG     P       G +G  G +G  G +G  G +G  GD GF G  G++G +G  G+   PG    G++GP G QG +G+ G PG  G  G  G P
Sbjct:  696 KGVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQG--------MPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPG-PVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPG---------MDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKG--IQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPG------------------------ITGFPGFTGSRGEKG-----------------TPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITG--IPGLKG---------------------FFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQG------------------------------------------------PQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVG--VPGQKGERGTPGERGPAGSPGLQGFPGISPPSNI--SGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGI----PQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFR--GDQGPMGHQGPVGQEGEPGRPGSPGLPGMP 1477          

HSP 4 Score: 162.54 bits (410), Expect = 1.895e-38
Identity = 203/558 (36.38%), Postives = 260/558 (46.59%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGV---PGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVG------DPGIL-AIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIG-----------PTGTSGLRGRKGD-QGPQGYKGVQGQKGIIGMIGEMGS---------------QGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGD-GIKGMKGLIG---PQGQKG------ESGYKGVQGLAGDKGPKGFPG-KNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGL-PGSIGFQGQEGQRGLKGD 3543
            G KG SG+RGD G  GE+G  G  G+ G  G  GI G KG++G  G  G +G+ G +G  G PG + E     +PG KG+ G+ G  G++G +G  G    +   +   KG+ G++G  G +G  G  G +G  G  G+SG PG  G+ G     G KG++G  G  GL G  G  G  GI G  G  G +G++G  G  G  G+ G TG     GD++  P                               G KGF G +G +GD GF G+ G       PG+    G  G  G QG  GE G  GI G KG+ G+P +   G  G PG  G  G  GLPG KGF G  G           PTG  G RG      GP G  G +G++G  G  G  GS                G  GD G  G  G+QGYQG  G  G   L G+KG++G +G  G  G KG +G   PQGQ G      E G KG QG  G+ GP G  G +   G KG++G  G  G MG  G  G    I + PG++G QG+ G  G  G+
Sbjct:  876 GMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFI--KGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIP----------------GLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGV--PGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGE 1413          

HSP 5 Score: 150.214 bits (378), Expect = 9.572e-35
Identity = 294/966 (30.43%), Postives = 378/966 (39.13%), Query Frame = 1
Query: 2044 SGERGDPGEVGEQGLRGLDGYS---------GKKGESGIHGDKGEKGLAGFSG-----------PKGIKGERGDTGLPGKEAEKIPGDKGIQGDV--------GELGDKGFKGEK-----------------GKNQNVNVLLTKYKGDNGEKGVK--------------------GSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDG-----------------------------------------------EKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDS-ITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSG-----------------LRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGK-----NIMGSKGEKGNKGRIGEMGVKGF---KGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPKGYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGE-------------KGEFGDAGKRGPQGPAGDQGI-------------------GLLGVKGERGD---------PGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGV------KGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAG 4383
             G +G PG  G  G +G+ G S         G+ G  G+HG KG+ G+ G  G             GIKG  GD GLPG     +PG KG  GD+        G  G++GF G+                     ++ +  + +  G   +  V+                    G++G  G PG  G+ GE GL G PG  G+ G  G  G                                                +G+ G  G+ GL G  G  G  G +G +G+ G+ G +G  GFPG  G  G +G PG     G  G +G  G  G  G  G  GD G  G+ G  G  G  GL G+ GD G  G  G PG     G  G  G  G  G+RG+PG+ G++G  G     LKG +G PG  G  GF G+PG KG  GE G  G  G                 ++G KGD+GP G KG  G KGI GM G  G  G  G  G  G   I+G +G+ G  G+ GL G  G  GP   GI G  G     G +GE G  GV G+ G+ GP G  G      ++ GS G KG +G  G  G+KGF   KG  G IG PG  G  G +G  GLKG                                                  G +G  GE G +G  GDKG+ G  G  G  G  G +G +G +G+ G                                               G  G  G  ++G+ G  GP G+ G++GE             KGE G  G+RGP G  G QG                    G+ G++G +G          PG  G EG  G  G  G KG+ +  PGPQG+ GV      KGPKGE G +G TG  G+ G++G +G +GD G  G  G  G  G
Sbjct:  524 PGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGLPG-----VPGTKGFPGDIGPPGQGLPGPKGERGFPGDAGLPGPPGFPGPPGPPGTPGQRDCDTGVKRPIGGGQQVVVQPGCIEGPTGSPGQPGPPGPTGAKGVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLG-----LKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGF--IKGVKGDIGVPGTPGLPGFPGVSGPP--GITGFPGFT---GSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQT------------------------------------------GFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGT---------------------------------------------KGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGW-VGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPG 1384          

HSP 6 Score: 127.102 bits (318), Expect = 9.827e-28
Identity = 178/451 (39.47%), Postives = 219/451 (48.56%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKG-LAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKG----KNQNVNVLLTKYKGDNGE---------KGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQ----GNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGF---EGLVGDPGILAI-GEKGPKG---FQGNIGERG---NPGIKGYKGNSGFP----DITLKGYKGIP-------GEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQ 3264
            G  GP G  G PG  G +G +G  G +G  GE+G  GD G+ G      G  G+KGERG TG+PG +     G+KG  GD+G  G  G  G +G    K Q     LT  +G  GE         KG  G  G  G PG  G +G +GL G+PG  G  G+ G D   G+ G  G  G  G RG      G +G+ G KG  G  G+RG  G PG +G  G++  P  +I+G  GD G  G  G+ G +G  G  G     G  GD+G +G  G  G KG+    G  G PG+L + GEKGPKG   F GN G  G   + G KG KG+ GFP     +   G  GIP       G +GP+G +GLPG  G  G  GP G  G RG  G  GPQG  GV    G  G  G MG QG  G  GE G  G  G  G  G   S+G   +K +Q
Sbjct: 1047 GVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKG--FFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAH-GDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGIS--PPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQ 1492          

HSP 7 Score: 126.331 bits (316), Expect = 2.154e-27
Identity = 192/602 (31.89%), Postives = 246/602 (40.86%), Query Frame = 1
Query: 2047 GERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGD---------------KGIQGDVGEL------------GDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTA-----------------------------------GFPGNKGSK---GETGLSGIPGKHGKVGNSGK----DGEKGNMGRKGENGLDG--RRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITL---KGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTS-------------------------GLRGRKGDQGPQGYKGVQGQKGIIGMIGEM----------GSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG----DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGS------------KGEKGNKGRIGEMGVKGFKGDI 3474
            G RG PG VG QG  G  G  G  G  G  GDKGE+G+ G +GPKG  G RG +G PG  A+ IPG                 G +GD G              G +G KG+KG+   ++     KY+G+ GE G+ G QG                                     GF G KG K   G+ G +GIP     VG +      D  KG  G +GE G+ G   +G +G MG  G++G  G+ G++G +   G+KG  G+ G  G S                                   G +G  G RGE G  G       P  LA G +G  GFQG  GE G+ G  G  G +G P  ++      +G+PGE+GPKGF G PG       +GP G                           G  GR G  GP G+ G +GQKG  G  G+           G  G KG  G  G +G +G QG+ G  G  G  G KG  G AG     GIKG    I  +G++G+ G  GV G+ GD    G PG++ +              KG  G+ G  G  G KGF GDI
Sbjct:   58 GARGQPGAVGPQGYNGPPGLQGFPGLQGRKGDKGERGVPGPTGPKGDVGARGVSGFPG--ADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLGFYGQKGEKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVV---GQKGSRGLDGFQGPS-----------------------------------GPRGPKGERGEQGPPGPSVYSPHPS-LAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARY--LGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMKGD---DGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGLPGVPGTKGFPGDI 613          

HSP 8 Score: 112.464 bits (280), Expect = 3.491e-23
Identity = 183/564 (32.45%), Postives = 229/564 (40.60%), Query Frame = 1
Query:  313 GEMGFGGHEGKPGFRGVKGDRGPP------GALGEKGNEGYKGDQGP---------KGMIGDKGVQGNSG--INXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGF--------SLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGEL----------GFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-IDISGN--VTGVRGDRGEKGEKG-IDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-------IPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSD-GDAGNRGDKGFPGIPGERGIDGL 1863
            G  GF G  G PG  G KGDRG P      G LG KG +G+ G +G          KG+ G+ GV+GN G           L G K   GE+G  G  G KG  GL+G  GM G+PG+ G  G  G  GF         +P    LP   G  G  G +G  G  G  G+ G PG  G+ G  G  GD G++          G KGE+G    +  L    GE G  GD G+   T +        +KGQ G                 G  G  G +G  G  GI GD G  G  G PG  G PG                          G +G  GL G KG  G   +D  G+    G  GDRG++GE   + G  G+PG +G RG  G +GP G  G +G                    G+   +   G  G  G  G  G++G       G  G N L G KGD G +G AG  G+KG +GD G         +PG +               G  GE+GF+G  G      D G  G +GD+GFPG PG  G  G+
Sbjct:  897 GSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGI-TGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGF---------------PGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIR------------------------GISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQG------------------FPGISPPSNISGSPGDVGAPGIFGLQGYQG--PPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEK---------------GPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGI 1385          

HSP 9 Score: 109.383 bits (272), Expect = 2.665e-22
Identity = 170/489 (34.76%), Postives = 215/489 (43.97%), Query Frame = 1
Query:  295 GLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS-LPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKG---MIGYQGDKGDIGELGFKGEKGE-------PVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGN--------VTGVRGDRGEKGEKGIDGDRGIPG---------DEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGE-AGPIGEKGDIGDVGTS 1674
            GL G  G  G  G  G PGFRG +G  G PG  G+ G  G  G  G  G  G  G  G  G  G  G PG  G  G  G+ G  G PG  G  G++G  G +G  GM GE+G  G  GF  +     +P ++GD+G+ G  G +G +G  G  G PG KG     G  G KG  GE G KG +G+       P+ +  +   +GE GD+G  G      L        + G  G      P         KG +G  G  G  GL G  G  GP G  G PG  GS G+ G  G+                   G  G +G  G  G  GDT+D+ G+        +TG+ G +G  GEKG  GD G PG           G +G +G  G  G +G +G    +  PG+KG  G  G+ GL G  G RG  G  GL G KG  G   +   G  G  G TG +GD G+A    GP+G  G  G+ GT 
Sbjct:  783 GLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGF-----PGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGV------------------AGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTP 1248          

HSP 10 Score: 108.227 bits (269), Expect = 6.969e-22
Identity = 197/583 (33.79%), Postives = 253/583 (43.40%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGN--------------------EGYKGDQGP---KGMIGDKGVQGNSGINXXXXXXXXXXXXXYT----GEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFS--------------------LPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGF------KGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDL-GPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGN-VTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVG----------TSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGE 1845
             G+LG KG  GF G +G+ GF GV G +G PG  G KGN                    +G KGD+GP   KG +G KG+QG  G+ G  G PGL G  G+     G+ G  G PG  G  G+ G  G+ G PG  G +G KG  G +                    LP    L  ERG  G  G  G  GE G  GD+G PG  GM G QG  G  G+ GF      +G +GEP ++       G  GDKGD G+     L        I G  G+              A G  G  G  G  G +G    L GP+G  G+ GE G+PG+ G  G PG +G PG        G  G  G  G+ G +G +G       N + G++GD G  G  G  G +G  GD G +G  G+ G  GEKG KG                 G  G  G +G  G++G KG KGD+G  G    G+ G  G+ G+  P+      G  GP G +G  G +G              GA G  G +GR G     G  G++G +G +G      +G+ G  G  G PG+PG 
Sbjct:  926 QGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRI-------GIPGDKGDFGWPGVPGLPGFPGIRGISGLHGL-PGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQ---------------GFMGNTGPSGAVGDRGPKGPKGDQGFPGAP--GSMGSPGIPGI--PQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPV--GQEGEPGRPGSPGLPGMPGR 1479          

HSP 11 Score: 87.0409 bits (214), Expect = 1.732e-15
Identity = 173/523 (33.08%), Postives = 220/523 (42.07%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGF---RGVKGDRGPPGALGEKGNEGYKGDQG-------PKGMIGDK-GVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKG------------------EIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEP--------------------------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXX-----AKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDT-IDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDS-GLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS 1674
             GL G  G+ G  G  G PGF   RG KG  G PG  G  G  G  G  G       P  ++G + G +G++G+                G+ G  G PG+ GA G +G  GM G+PG++G+ G  GP G         P + G  G  GF G  G                  + GE GD G PG  GM G  GD+GD G  G +G  G P                            M+ L   +G  G KG+ G+     L     E  +KG +G RGPPGP   +          KG EG  G KG  GLKGI+G  G  G  G PG  G PG                   +G +GDIG  G  GL G+ G+ G   I      TG RG++G  G  G+ G+ G  GD G  GD+  L G  G KG +G +            G  GL+G  G+ G  G+ G  G+ G  G +G    G KG+ G  GLTG +G  G+ G  G  G+KGD G  G  
Sbjct:  711 QGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGL---------------PGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSG--------QPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPG-----------------FIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGIT------------GIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSP--GLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVP 1179          

HSP 12 Score: 86.6557 bits (213), Expect = 2.287e-15
Identity = 160/504 (31.75%), Postives = 204/504 (40.48%), Query Frame = 1
Query: 2245 DKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFP------------GEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPA---GDGIKGMKGLIGPQGQKGES-----------------------------------GYKGVQGLAGDKGPKGFPGKN--------------------IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            +KG +G  G +G +G+ G  G        L  + G  G KG KG +G  G  G KG  G  G+SG PG  G  G+ G+ G +G  G  G NG  G  G QG  G  G  GL G +G +G  G P            GE G+ G+ G  G         +                    +     LG   F G +GE GD G  G  G P  + +   GP      I      G KG +G  G P +  KG +GI G  G +GF GL GEKG  G+ G  G  G +G  G +GP+G +G QG  G       + S       G RG  G QG  GE G++G  G  G  G  GP+    D ++G+ G +GP+G  GE                                    G KG +G  G  GP GFPG                      + G  G KG  G  GE+G KG +GD G  G+PG  GF+G  G  G  G K
Sbjct:   56 EKGARGQPGAVGPQGYNGPPG--------LQGFPGLQGRKGDKGERGVPGPTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLG---FYGQKGEKGDIGQPGPNGIPSDITL--VGPT--TSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGP-----SVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPK 539          

HSP 13 Score: 78.1814 bits (191), Expect = 7.986e-13
Identity = 92/270 (34.07%), Postives = 116/270 (42.96%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGE------VGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFS----GPKGIKGERGDTGLPGKEAEK----IPGDKG--------------IQGDVGELGDKGFKGEKGKNQNV------------------------NVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGET----------GLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGV 2649
            EG  G  G RG PG       VG++G RGLDG+ G  G  G  G++GE+G  G S     P   KG RGD G  G   E      PG+ G              ++G  GE+G KGF GE G                             +  L   KG  G  G  G  G  G  G KG KGE           GL G+PG  G  G +G+ G+KG+ G  G +G+ G  G +G  G+ G  G +G+KGD   I   GE+G  G+ GV
Sbjct:  293 EGIMGFPGIRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGV 562          

HSP 14 Score: 76.6406 bits (187), Expect = 2.194e-12
Identity = 177/563 (31.44%), Postives = 236/563 (41.92%), Query Frame = 1
Query:  172 LMKLVLGLIVAVFWIIISLVQDSESAAAICNRSNCTE-CSC---NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGE---------------------PGNKGMIGYQGDKGDIGELGFKGEKGEP---------VKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGD--------RGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXX--------------LRGLDGKTGKRGEQGHKGLKGDKGVKGM--DMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDVGTS-IPG 1683
            L   +L   V V  +  S++   +     C   +C+  C C    G  G  G +G  G+ G PG +G  G +   G  G+KG  G  G  GPKG +G +GV G  G +G  G PG  GP+G  G +GC G  G  G  G  G  G  G+PG QG KG+KG + ++L +E      RG+ G  G  G +G  G  G +G+                     PGN+G+ G+ G KG+ G++G  G  G P            I  D  +GE GD+G++G         +  E  I G  GIR         G  G  G +G  G KG+ GL G +G  GP G  G+ GE G PG       P                   A G  G  G++G  G+         G RG+ GE G  G  G         RG+PG+ G +G S      GE G+  R  G      +                     L+G +G+ G  G  G  G +G KG KG   D    +   G+ GL GPKG  G  GE   +G+KGD GD G   IPG
Sbjct:   13 LRGWLLLATVTVGLLAQSVLGGVKKLDVPCGGRDCSGGCQCYPEKGARGQPGAVGPQGYNGPPGLQGFPGLQ---GRKGDKGERGVPGPTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKG-EPYALSKEDRD-KYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGL-GFYGQKGEKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVI----SKGEEGIMGFPGIR---------GFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSL-----------------AKGARGDPGFQGAHGE--------PGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFS------GEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGE---LGKKGDQGDPGLHGIPG 522          

HSP 15 Score: 75.0998 bits (183), Expect = 7.633e-12
Identity = 144/446 (32.29%), Postives = 175/446 (39.24%), Query Frame = 1
Query:  412 GYKGDQGPKGMIGDKGVQG-NSGINXXXXXXXXXXXXXYTGE---EGCCGKPG--QKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPG----------NKGMIGYQGDKGDIGELGFKGEKGEP-------VKMISLDKSRGEIGDKGDKGYS-----FTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGHKGLKGDKGVKGMDMIGTKGRKGVNGLTGPKGDTGDAGEAGPIGEKGDIGDV 1665
            G+ G +G KG IG  G  G  S I           P  Y GE   EG  G PG   KG  G+ G+ G++G PG+ GEKG  G KG            RG  G +G SG +G  GE G+ G PG           KG  G  G +G  GE G +GE GEP         +   D  RG  G+ G KG+S        +L     +     Q        P  D    G KG EGR G  G  G  G RG  G  G+ G                                  IG     GL G  G KG          GV G+ G+KG++G  G  GIPG  G +G  G+ G  G KG KG SR ++                 G+ G+ G  G  G+KGD GV G D +            G KG  GDAG  G  G KG  GD+
Sbjct:  234 GFYGQKGEKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVVGQKG-----------SRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGD---------------------------CQCGQVIG-----GLPGLPGPKG--------FPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTIT---------------TKGERGQPGIPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGLPGVPGTKGFPGDI 613          

HSP 16 Score: 65.855 bits (159), Expect = 4.297e-9
Identity = 161/500 (32.20%), Postives = 203/500 (40.60%), Query Frame = 1
Query:  532 EEGCCGKPGQKGAAGLQGYDGMQGIPGMQGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGEL------------------GFKGEKGEPVKMI--SLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEKGIDGDRGIPGDEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGH----KGLKGDKGVKGMD-MIGTKGRKGVNGLTGPKGDT--------GDAGEAGPIGEKGDIGDVGTSI--PGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGS----CFNCSDGDAGNRGDKGF----------------PGIPGERGIDGLN 1866
            E+G  G+PG  G  G  G  G+QG PG+QG KG KG +G   P        +GD GA+G SG  G  G  G  G+ G +G  GY G  G  G+                   G KG+KGEP  +     DK RGE G+ G  GY           ++   G  G  GPPGP G  G  G +G        G  G KG +GD+G      +PG NG P                          I      G KG +G +G    IS    G+ G  G +G  G+DG++G+ G +GSRG  G QGP G +G KG                   RG  G  G      H    KG +GD G +G     G++G  G  G  GP G +        G  GE GP G  G+ G     +  PGA G  G +G PG  G  G  G     G KGS     +    G  G RG KG+                PG+PG +G  G+N
Sbjct:   56 EKGARGQPGAVGPQGYNGPPGLQGFPGLQGRKGDKGERGVPGPT-----GPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGL-------GFYGQKGEKGDIG------QPGPNGIP--------------SDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGE------------------RGEQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGF--LFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVN 503          

HSP 17 Score: 65.0846 bits (157), Expect = 7.683e-9
Identity = 86/285 (30.18%), Postives = 111/285 (38.95%), Query Frame = 1
Query: 2026 EGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNV------------------------NVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETG----------LSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGI------------------------KGVKGLEGVKGDRGFIG-----------------FPGEKGDIGVTGVPG 2655
            +G +GPSG RG  GE GEQG  G   YS     S   G +G+ G  G  G  G +GE G+ G  G     +  +  ++G  GE+G KGF GE G                             +  L   KG  G  G  G  G  G  G KG KGE G          L G+PG  G  G +G+ G+KG+ G  G +G+ G  G +G  G+                         G+ G+ G+KGD G  G                   G  GD G+ GVPG
Sbjct:  323 DGFQGPSGPRGPKGERGEQGPPGPSVYSPHP--SLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGLPGVPG 605          

HSP 18 Score: 61.6178 bits (148), Expect = 8.611e-8
Identity = 101/305 (33.11%), Postives = 128/305 (41.97%), Query Frame = 1
Query:  289 CNGLLGPKGEMGFGGH-----EGKPGFRGVKGDRGP-------------PGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGL---QGYDGMQGIPGMQGEKGRKGPKGFSLPQEGV--LPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQGDKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDL---GPIGKHGKPGENGSPG 1125
             +GL G  G  GF G       G PGF G  GDRG              PG  GE+G  G +G  G  G+ G  G+   S I+G  G  G  G  G  G +G  G PG     G+   +G  G  G PG +G  G  GP+G    Q GV  LP E+G KG +GF G  G  G  GD G  G KG  G+ G  G +G  G     G P K+     + G  G +G  G            +   +G  G                 G +GR G     G +G +G +   GP+G+ G+PG  GSPG
Sbjct: 1190 ISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQG----QPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGI---PGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPG---------------KAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPG 1472          
BLAST of Collagen IV NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P17139|CO4A1_CAEEL (Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5)

HSP 1 Score: 268.085 bits (684), Expect = 7.921e-71
Identity = 186/485 (38.35%), Postives = 238/485 (49.07%), Query Frame = 1
Query: 4003 GERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFS--ILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERGIEGDLGDKGVRGPQGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPGDKGDKGLLGSEGDKGEKGNPGITGPQXXXXXXXXXXXXXXSAFKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPGNQGETRGNTGSIFATHSQSTKIPDCPSRTRMLWQGYSFLGMTGSERAHINDLSSPGSCLQMFSPIPFVFCEKQEQCFYSVRNDRTYWLSSANFMGMSMH-INVTQVQMYLSRCVVCEAPSKPYAFHSQSTMFPKCPNGWTNLWSGNSFLMNTGYGAAGGGQQLSSPGSCLMSFKRHLFLECTAKGHCGYYEEHKHFWLVATDSMKSFQMTMGHNIKTMQSEDLIAKCLVCMRNQ 5448
            GERG  G  G  G  G  G  G  G  G  G  GD   G  G  G  G PG +GY G+RG  G  G +G S    YPG  G+ G+KGP+G+ G  G  G+ G  G  G  G+ G +    VR P G  GE G  G KG                                 PG  GD GL G  G  G  G PG  G  G  G  G  G  G+  F+G  G  G  GL G PG               +PG+ G    + G  FA HSQ+T +P CP     LW+GYS L + G+ RA   DL  PGSCL  F+ +PF+FC     C  S RND ++WLS+   M   M+ +  T ++ Y+SRC VCE P++  A HSQ T  P+CP GW+ +W+G SF+M+T  GA G GQ L SPGSCL  F+   F+EC  +G C YY  +  FWL   D  K F+  M   +K    +D +++C VC++N+
Sbjct: 1325 GERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGD--CGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMA-MAVRNPPGQPGENGYPGEKG--------------------------------YPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPG---------------YPGSPGGWAPSRGFTFAKHSQTTAVPQCPPGASQLWEGYSLLYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNSVCHVSSRNDYSFWLSTDEPMTPMMNPVTGTAIRPYISRCAVCEVPTQIIAVHSQDTSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHGRGTCNYYATNHGFWLSIVDQDKQFRKPMSQTLKAGGLKDRVSRCQVCLKNR 1759          

HSP 2 Score: 204.912 bits (520), Expect = 2.187e-51
Identity = 365/1190 (30.67%), Postives = 463/1190 (38.91%), Query Frame = 1
Query:  292 NGLLGPKGEMGFGGHEGKPGFRGVKGDRGPPGALGEKGNEGYKGDQGPKGMIGDKGVQGNSGINXXXXXXXXXXXXXYTGEEGCCGKPGQKGAAGLQGYDGMQGIPGM-QGEKGRKGPKGFSLPQEGVLPAERGDKGAKGFSGLKGEIGEFGDVGEPGNKGMIGYQG-----DKGDIGELGFKGEKGEPVKMISLDKSRGEIGDKGDKGYSFTTHLTRTTNEVMIKGQKGIRXXXXXXXXXXXXXAKGYEGRAGSKGAEGLKGIRGDLGPIGKHGKPGENGSPGKXXXXXXXXXXXXXXXXXXXXXXXXIGAAGNSGLKGYKGLKGDTIDISGNVTGVRGDRGEKGEK------GIDGDRGIPG------------DEGSRGDSGLQGPIGEKGNKGRSRGVSXXXXXXXXXXXXLRGLDGKTGKRGEQGH-----------KGLKGDKGVKGMDMIGTKGRKGVNG------------LTGPKGDTGDAGEAGPIGEKGDIGDVGTSIPGAQXXXXXXXXXXXXXXXXXXXXXXFIGEKGSCFNCSDGDAGNRGDKGFPGIPGERGIDGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSG---PKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDIT----------LKGYKGIPGEIGPKGFQGLPG---EKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQG---------------QKGIIGMIGEMGSQGDK--GDTGERGSIGIQGYQG---------------EKGNQGSLGLKGLKGNQGPAGDGIKGMKGLIGPQGQ------KGESGYKGVQGLAGDKGPKGFPGKN----IMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546
            +G +GP G +G  G  G PG +G KGD G  G  G++G +G  G+ G KG  G++G+ G  G               Y G +G  G+PG  G  G +G  G +G  G   GE G  G +GF    +GV    +G KG  G  GL G +G  G VG PG  G  G  G     +KGD GE G+ G  GEP          G  G+ GD GY     L        I+G  G+                      G  G +G  GI GD   IG  G  GE G PG                         +G  G +GL G  G+ G  I + G   G  G+ GE+GE       G+ G+ G PG              G  GD G+ G  G+ G+ G S G+S            L G+ G  G +GE G             GLKGD G+ G+      GR G +G              G +G+ G AG  G  G +G +G     IPG QG  G                  F G+ G+      G  G RG  G PG+PG +G  G+                                               +   N+  G  G  G  G PG+ G  GL GL G  G  G  G  G++G  GL GF G     G++G++G+ G             GI GD GE G  G+ G  G           + G  G  G  G  G AG PG  G  G  GL G PG  G+ G +G+DG  G  G +GE+GL         +GI G KG +G  G RG  G PG  G+ G  G                                           G  G  G  GD+G+ G  G       G  GP G  G  G  G PG++G  G++G P +           L G  G PGE G  G  GLPG   + GF GE G  GT G RG+ G+ G   Y G  G               Q G+ G+ GE G  GD   G+ G  G  G  GY G                 G +G  GL GL G QG   DGI G  GL G  G+       G+ GY G QG  G+KG  G PG+N    + G  G+ G KG  G  G  G+ G  G +G PG +G+ G  G+ G  G++
Sbjct:  272 DGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPG---------------YPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGF----DGV----QGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEP----------GLPGEPGDCGYPGEDGLPGYD----IQGPPGLD---------------------GQSGRDGFPGIPGD---IGDPGYSGEKGFPGTGVNK--------------------VGPPGMTGLPGEPGMPG-RIGVDG-YPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAG-SDGLSGSPG--------LPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGL-----PGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLG-----IPGLQGPPGDS----------------FPGQPGT-----PGYKGERGADGLPGLPGAQGPRGI--------------------------------------------PAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGF-----------NGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGL---------VGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPG-----------------------------------------QNGMDGYPGAPGDQGYPGSPGQ-----DGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQG--NDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQ 1226          

HSP 3 Score: 154.451 bits (389), Expect = 5.665e-36
Identity = 195/547 (35.65%), Postives = 240/547 (43.88%), Query Frame = 1
Query: 2023 TEGDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGF------------SGPKGIKGERGDTGLPGKEAEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL-LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETG---LSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGD---------------PGILAIGEKGPKGFQGNIGERGNPGIKGYKGNSGFPDITLKGYKGIPGEI---------GPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQGPAG-DGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKG 3540
            T+G  G  G  G PG VGE G  G  GY G+ GE G     G+ G  G+             G  G+ GERGD G      +  PG+ G+ G  G+ G  G  G  G      +  +   KG++G  G+ G QG  G PG  G +GE G     G PG+ G  G  G++GEKG  G  GENGL G RG+ G  G+KG  GL+G  G  G  G  G  GD+G  G PG++                             G+ G  G  G  GLRGESG  G  GL G                PG       GP    G  G+ G PG+ G  G  G     L G  G PG+          G  G  G PGE+G  G  G  G  GL G  G  G +G  G++G  G  G  G  G+ G  G  GERG  G+ G QG  G+ G  G  G  G +GP G DG  G  GL G  G+ G  G  G   +A  + P G PG+N  G  GEKG  G  G+ G+ G  G  G  G PG+ G+ G  G  G+ G
Sbjct:  998 TDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNG------DSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGEN-----------------------------GDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPP---GQAGQDGYPGLDGLPGAPG-----LNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMA-VRNPPGQPGEN--GYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPG 1498          

HSP 4 Score: 150.599 bits (379), Expect = 7.835e-35
Identity = 265/795 (33.33%), Postives = 331/795 (41.64%), Query Frame = 1
Query: 2029 GDKGPSGERGDPGEVGEQGLRGLDGYSGKKGESGIHGDKGEKGLAGFSGPKGIKGERGDTGLPGKEAEK----------IPGDKGIQGDVGELGDKGFKGEKGKNQNVNVLLTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKGNMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILA-IGEKGPKGFQGNIGERGNPGIKGYKGNSGFP-DITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGPTGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKG----LKGNQGPAGDGIKGMKG--LIGPQGQKGESGYKGVQGLAGDKGPKGFPGK-------NIMGSKGEKGNKGRIGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAERGDKGEIGEKGEMGNKGDKGNRGLSGQVGDEGPK---GYKGQNGENGMKGNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGISGRSSNGERGQRGPQGNTGEKGEKGEFGDAGKRGPQGPAGDQGIGLLGVKGERGDPGPDGYEGQRGPKGPKGDKGFSILYPGPQGETGVKGPKGEVGSVGPTGIPGSKGEKGERG 4329
            G+ G +G+ G PG+ G +G  GL G  GKKG  G  G +G+ G  G+SG  G  G+ G  G PG   ++           PG  GI G+ G +G  G +GE G N      L   +G+ GE+G +G  G  G+PG  G+ G  GL G  G+ G VG +G+ G  G  G+ GE G     G+ G++G  G  G  G+ G  G  G  GE+GD       GDS  G                          G  GQ GD G+ GL G  G  G+ G+ G PG+    G  G  G QGN G  G PG++G  G  GFP      GY G  G  G KG+ G+PGE G  G  G  G  GL+G  G  G  GY G  GQ G  G +G  G+ G+ GD G +G  G  G +GE G  G  GL G          P  DG  G  G  + GP GQ G+ GY G+ GL G  G  G PG         + G  GE G  G  GE G+ G  G  G  GLPG+ G  G EG  GL+GD                               G+ G  G  G        G++G  G  G+ G  GD G  G  GQ G +GP+   G+ G++G +G+ G                                            G  GL G    +     GQ G  G  GEKG  G  GD G  GP G A     G  G  G  G PGP G  G     G  GD+GF                +G  G  G  G+PG+ G  G  G
Sbjct:  865 GEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNG-----LPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDN------GDSYPG------------------------NPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGD------------------------------CGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRP------------------------------------------GREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKA-----GYPGAPGTDGYPGPPGLSGM---PGHGGDQGF----------------QGAAGRTGNPGLPGTPGYPGSPG 1528          

HSP 5 Score: 142.51 bits (358), Expect = 2.422e-32
Identity = 187/511 (36.59%), Postives = 239/511 (46.77%), Query Frame = 1
Query: 2131 IHGDKGEKGLAGFSGPKGIKGERGDTGLPGKE----AEKIPGDKGIQGDVGELGDKGFKGEKGKNQNVNVL----LTKYKGDNGEKGVKGSQGTAGFPGNKGSKGETGLSGIPGKHGKVGNSGKDGEKG--NMGRKGENGLDGRRGRQGNMGIKGVKGLEGVKGDRGFIGFPGEKGDIGVTGVPGDSITGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLGDKGFTGLRGESGDKGFEGLVGDPGILAI-GEKGPKGFQGNIGERGNPGIKGYKGNSGFP----------DITLKGYKGIPGEIGPKGFQGLPGEKGFKGEIGP-------TGTSGLRGRKGDQGPQGYKGVQGQKGIIGMIGEMGSQGDKGDTGERGSIGIQGYQGEKGNQGSLGLKGLKGNQG----------PAGDGIKGMKGLIGPQGQKGESGYKGVQGLAGDKGPKGFPGKNIMGSKGEKGNKGR-IGEMGVKGFKGDIGPIGLPGSIGFQGQEGQRGLKGDK 3546