P/Homo B domain-containing protein

Overview
NameP/Homo B domain-containing protein
Smed IDSMED30001371
Length (bp)2594
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of P/Homo B domain-containing protein (SMED30001371) t-SNE clustered cells

Violin plots show distribution of expression levels for P/Homo B domain-containing protein (SMED30001371) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of P/Homo B domain-containing protein (SMED30001371) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for P/Homo B domain-containing protein (SMED30001371) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001371

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30001371SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001371SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001371SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001371SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001371SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001371SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001371SMESG000074551.1 Contig52038newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001371SMESG000074551.1 SMESG000074553.1 Contig22339uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001371SMESG000074551.1 SMESG000074553.1 Contig22339newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001371SMESG000074551.1 SMESG000074553.1 Contig8657uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001371SMESG000074551.1 SMESG000074553.1 Contig8657newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30001371SMESG000074553.1 SMESG000074551.1 dd_Smed_v6_1484_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001371SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30001371SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001371SMESG000074553.1 SMED_02071_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30001371SMESG000074553.1 SMESG000074551.1 SMED_02071_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of P/Homo B domain-containing protein vs. Ensembl Human
Match: PCSK1 (proprotein convertase subtilisin/kexin type 1 [Source:HGNC Symbol;Acc:HGNC:8743])

HSP 1 Score: 287.345 bits (734), Expect = 8.480e-85
Identity = 200/551 (36.30%), Postives = 308/551 (55.90%), Query Frame = 3
Query:  573 IYATKINPKVHKKS-FTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFK--FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTN 2204
            ++  K +P+  ++S F   KR   + + +  +++Y +  ++R     S    FNDP  ++ W Y    +     P LD+++  V++  I+G+GVV++V+DDG++  H +I  N+DP AS D ND  +   DP  PRY      +N HGT CA  IA ++NN  CG+GVA+N+ +GGIRML   +VTD +EA ++  N  ++DIYS SWGP D G          QKA E G ++GR+G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   T+   G  TD           + +A ++  C E   GTSA+ PL +G  ALALEAN  L WRD+QHL   +    P      W+ N AG++V+ R+GFGLL+  A V   + + W +V + + CV  K    +   ++   +  +   T  C   +N I++LEHV+    IE+  RGDL ++LTS   T +VLL +R RDT+ N    + F+S   WGENP G W   I D+     S +    G ++   L  HGT++
Sbjct:   22 LFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNLFNDPMWNQQW-YLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDH---DPF-PRY--DPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLD-GIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDYTDQR---------ITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECV-VKDNDFEPRALKANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDM-----SGRIQNEGRIVNWKLILHGTSS 549          
BLAST of P/Homo B domain-containing protein vs. Ensembl Human
Match: PCSK1 (proprotein convertase subtilisin/kexin type 1 [Source:HGNC Symbol;Acc:HGNC:8743])

HSP 1 Score: 287.73 bits (735), Expect = 1.757e-84
Identity = 200/551 (36.30%), Postives = 308/551 (55.90%), Query Frame = 3
Query:  573 IYATKINPKVHKKS-FTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFK--FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTN 2204
            ++  K +P+  ++S F   KR   + + +  +++Y +  ++R     S    FNDP  ++ W Y    +     P LD+++  V++  I+G+GVV++V+DDG++  H +I  N+DP AS D ND  +   DP  PRY      +N HGT CA  IA ++NN  CG+GVA+N+ +GGIRML   +VTD +EA ++  N  ++DIYS SWGP D G          QKA E G ++GR+G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   T+   G  TD           + +A ++  C E   GTSA+ PL +G  ALALEAN  L WRD+QHL   +    P      W+ N AG++V+ R+GFGLL+  A V   + + W +V + + CV  K    +   ++   +  +   T  C   +N I++LEHV+    IE+  RGDL ++LTS   T +VLL +R RDT+ N    + F+S   WGENP G W   I D+     S +    G ++   L  HGT++
Sbjct:   69 LFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNLFNDPMWNQQW-YLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDH---DPF-PRY--DPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLD-GIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDYTDQR---------ITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECV-VKDNDFEPRALKANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDM-----SGRIQNEGRIVNWKLILHGTSS 596          
BLAST of P/Homo B domain-containing protein vs. Ensembl Human
Match: PCSK5 (proprotein convertase subtilisin/kexin type 5 [Source:HGNC Symbol;Acc:HGNC:8747])

HSP 1 Score: 286.189 bits (731), Expect = 1.857e-84
Identity = 190/501 (37.92%), Postives = 284/501 (56.69%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGL-DMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN----DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNE-IQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            FNDP+   +W  +     D  +P   DMN+   +K   +G+ +VV+++DDGI+  H ++++N+D  AS D+N    DP         PRY    + +N HGT CA  +A  +NN  C +G+AFNA +GG+RML  + VTD++EA +++ N Q++ IYS SWGP D G          ++A E G R GR+G GS++++A+GNGG + DHC  DG+ NS YTI++++T   G+KP Y EEC++   T     YS+   +D+      ++   +  +C +   GTSA+ P+ +G IALALEAN FL WRD+QH+   + R  +     W+ N AG  VSH YGFGL+D  A V  A+ W TV +  VCV  ++   +I  IR     R  ++ +GC++  N  +  LEHV +   I HP RGDL I LTSP+ T+S LL  R+ D +      + F++   WGE   G W  ++ D      + K+   G L E  L  +GT+
Sbjct:  126 FNDPKWPSMWYMHCS---DNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPM--------PRY--DASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGD-VTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATT----YSSGESYDKK-----IITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPRQHVCV--ESTDRQIKTIRPNSAVRSIYKASGCSDNPNRHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANRLFDHSMEGFKNWEFMTIHCWGERAAGDWVLEVYDTPSQLRNFKTP--GKLKEWSLVLYGTS 599          
BLAST of P/Homo B domain-containing protein vs. Ensembl Human
Match: PCSK6 (proprotein convertase subtilisin/kexin type 6 [Source:HGNC Symbol;Acc:HGNC:8569])

HSP 1 Score: 281.567 bits (719), Expect = 1.977e-83
Identity = 192/498 (38.55%), Postives = 280/498 (56.22%), Query Frame = 3
Query:  648 KTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN----DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCA-NTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANIT-FSFLSQMNWGENPRGKWHFDIVDL 2123
            K ++  +  RR+  Q      +  FNDP    +W Y + G  +      +MN+   +K   +G+ VVV+++DDGI+  H ++  N+D  AS D+N    DP         PRY    + +N HGT CA  +A  +NN  C +G+A+NA +GGIRML  + VTD++EA +L     YIDIYS SWGP D G          ++A E G ++GR+G GSI+++A+GNGG   D+C  DG+ NS YTI+V++   +G KP Y EECA+   T     YS+   ++R      +V   +  +C +   GTS + P+++G IALALEAN+ L WRD+QHL   + R  +   + W++N AG  VSH YGFGL+D  A V  A+ W  V    +CV    K  + + +   +  R T  T+ CA ++D  +  LEHV + T I HP RGDL I L SP+ TKS LL +R+ D +N   T + F++   WGE   G+W  +I DL
Sbjct:  136 KWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMW-YLHCGDKNSRCRS-EMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDP--------SPRY--DASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGD-VTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATT----YSSGAFYERK-----IVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVDAEALVVEAKKWTAVPSQHMCVAASDKRPRSIPLV--QVLRTTALTSACAEHSDQRVVYLEHVVVRTSISHPRRGDLQIYLVSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQWTLEIQDL 609          
BLAST of P/Homo B domain-containing protein vs. Ensembl Human
Match: PCSK6 (proprotein convertase subtilisin/kexin type 6 [Source:HGNC Symbol;Acc:HGNC:8569])

HSP 1 Score: 281.952 bits (720), Expect = 2.432e-83
Identity = 192/498 (38.55%), Postives = 280/498 (56.22%), Query Frame = 3
Query:  648 KTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN----DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCA-NTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANIT-FSFLSQMNWGENPRGKWHFDIVDL 2123
            K ++  +  RR+  Q      +  FNDP    +W Y + G  +      +MN+   +K   +G+ VVV+++DDGI+  H ++  N+D  AS D+N    DP         PRY    + +N HGT CA  +A  +NN  C +G+A+NA +GGIRML  + VTD++EA +L     YIDIYS SWGP D G          ++A E G ++GR+G GSI+++A+GNGG   D+C  DG+ NS YTI+V++   +G KP Y EECA+   T     YS+   ++R      +V   +  +C +   GTS + P+++G IALALEAN+ L WRD+QHL   + R  +   + W++N AG  VSH YGFGL+D  A V  A+ W  V    +CV    K  + + +   +  R T  T+ CA ++D  +  LEHV + T I HP RGDL I L SP+ TKS LL +R+ D +N   T + F++   WGE   G+W  +I DL
Sbjct:  136 KWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMW-YLHCGDKNSRCRS-EMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDP--------SPRY--DASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGD-VTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATT----YSSGAFYERK-----IVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVDAEALVVEAKKWTAVPSQHMCVAASDKRPRSIPLV--QVLRTTALTSACAEHSDQRVVYLEHVVVRTSISHPRRGDLQIYLVSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQWTLEIQDL 609          
BLAST of P/Homo B domain-containing protein vs. Ensembl Celegans
Match: kpc-1 (Furin-like protease kpc-1 [Source:UniProtKB/Swiss-Prot;Acc:O17798])

HSP 1 Score: 265.388 bits (677), Expect = 3.599e-77
Identity = 184/514 (35.80%), Postives = 283/514 (55.06%), Query Frame = 3
Query:  606 KKSFTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQ---YYNYGQF-DEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGC--ANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANIT-FSFLSQMNWGENPRGKWHFDIVDLG 2126
            K+ +   +R+  +    E+D +  ++   R+      K  DP  D LW    Y N G+   +    +D N+   +    +G+GVVV+++DDG++  H +I  N+D  AS D+ND  N   DP  PRY    + +N HGT CA  +A   NN +C +G+A+NAN+GGIRML  + VTD +EA ++ HN  YIDIYS SWGP D G          + A E G   GRKG+GSI+++A+GNGG + D C  DG+ NS YT+++++   +G  P Y+E C++   T    G         ++ +  ++   ++  C     GTSA+ PL +G +ALALEAN  L WRD+QH+   + +  N     W  N  G  VSH +G+GL+D  A V+ A++W  V +   C   +   ++   I  G + ++   + GC     +N++  +EHV+    ++ P RGDL I LTSP+ TKS LL +R RDT+ +  T ++F++  NWGE   G W  +I + G
Sbjct:  138 KRGYRRIRRHTDDNDIFEEDDDGTQISKSRNR-----KHPDPN-DPLWTDMWYLNRGEHHSDSTTRMDHNVKEAWDLGYTGKGVVVTILDDGLERTHPDISPNYDERASYDVNDRDN---DPM-PRY--EFSDENRHGTRCAGEVAAIFNNSLCIVGIAYNANIGGIRMLDGD-VTDAVEAASVGHNADYIDIYSASWGPDDDGRTVDGPAKLTRSAFEKGITMGRKGKGSIFVWASGNGGKDADSCNCDGYTNSIYTLSISSATENGNIPWYSEACSSTLATTYSSG---------ATGEKMILTTDLHHACTNMHTGTSASAPLAAGIVALALEANPNLTWRDLQHIVIRTAKPINLRAGDWTTNGVGRNVSHSFGYGLMDAGAMVKLAKIWKKVDEQHRCR--QFYPSRYKNIPNGNRLQLQLYSDGCYGGADENKVSYVEHVQAIVTLKAPKRGDLQIYLTSPSGTKSTLLTKRARDTSRSGFTDWAFMTTHNWGEQAAGLWILEIDNDG 627          
BLAST of P/Homo B domain-containing protein vs. Ensembl Celegans
Match: kpc-1 (Furin-like protease kpc-1 [Source:UniProtKB/Swiss-Prot;Acc:O17798])

HSP 1 Score: 265.388 bits (677), Expect = 3.599e-77
Identity = 184/514 (35.80%), Postives = 283/514 (55.06%), Query Frame = 3
Query:  606 KKSFTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQ---YYNYGQF-DEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGC--ANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANIT-FSFLSQMNWGENPRGKWHFDIVDLG 2126
            K+ +   +R+  +    E+D +  ++   R+      K  DP  D LW    Y N G+   +    +D N+   +    +G+GVVV+++DDG++  H +I  N+D  AS D+ND  N   DP  PRY    + +N HGT CA  +A   NN +C +G+A+NAN+GGIRML  + VTD +EA ++ HN  YIDIYS SWGP D G          + A E G   GRKG+GSI+++A+GNGG + D C  DG+ NS YT+++++   +G  P Y+E C++   T    G         ++ +  ++   ++  C     GTSA+ PL +G +ALALEAN  L WRD+QH+   + +  N     W  N  G  VSH +G+GL+D  A V+ A++W  V +   C   +   ++   I  G + ++   + GC     +N++  +EHV+    ++ P RGDL I LTSP+ TKS LL +R RDT+ +  T ++F++  NWGE   G W  +I + G
Sbjct:  138 KRGYRRIRRHTDDNDIFEEDDDGTQISKSRNR-----KHPDPN-DPLWTDMWYLNRGEHHSDSTTRMDHNVKEAWDLGYTGKGVVVTILDDGLERTHPDISPNYDERASYDVNDRDN---DPM-PRY--EFSDENRHGTRCAGEVAAIFNNSLCIVGIAYNANIGGIRMLDGD-VTDAVEAASVGHNADYIDIYSASWGPDDDGRTVDGPAKLTRSAFEKGITMGRKGKGSIFVWASGNGGKDADSCNCDGYTNSIYTLSISSATENGNIPWYSEACSSTLATTYSSG---------ATGEKMILTTDLHHACTNMHTGTSASAPLAAGIVALALEANPNLTWRDLQHIVIRTAKPINLRAGDWTTNGVGRNVSHSFGYGLMDAGAMVKLAKIWKKVDEQHRCR--QFYPSRYKNIPNGNRLQLQLYSDGCYGGADENKVSYVEHVQAIVTLKAPKRGDLQIYLTSPSGTKSTLLTKRARDTSRSGFTDWAFMTTHNWGEQAAGLWILEIDNDG 627          
BLAST of P/Homo B domain-containing protein vs. Ensembl Celegans
Match: bli-4 (Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;Acc:P51559])

HSP 1 Score: 253.447 bits (646), Expect = 5.055e-73
Identity = 181/483 (37.47%), Postives = 260/483 (53.83%), Query Frame = 3
Query:  675 RRLVNQRHES---LGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYE--AVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGK-KTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKW 2102
            RR   Q+ +S   + S  F DP     W Y + G       G DMN+   +    +GR V VS++DDGI   H ++  N+DP AS D+ND  +   DP       +    N HGT CA  +A  + N  CG+GVAF A +GG+RML    V+D +EA +L+ N  +IDIYS SWGP+D G          ++A   G + GR G+G+I+++A+GNGG   D C  DG+  S YT+++++      +P Y EEC +   T     YS+  DF +    P +V   + G C ++  GTSA+ PL +G IALALEAN  L WRD+QHL   +     P E    W  N  G +VS+++G+GL+D  A V  A+ W TV +  +C      +N   +   G+ +   T    GC  +   +  LEHV++H  + +  RGDL ++L SP+ T+SVLL  R +D N N    + FLS   WGE+PRG W
Sbjct:  142 RRAQRQQPQSPREIPSLPFPDPLYKDQW-YLHGGAVG----GYDMNVRQAWLQGYAGRNVSVSILDDGIQRDHPDLAANYDPLASTDINDHDD---DP-----TPQNNGDNKHGTRCAGEVAALAGNNQCGVGVAFKAKIGGVRMLD-GAVSDSVEAASLSLNQDHIDIYSASWGPEDDGKTFDGPGPLAREAFYRGIKNGRGGKGNIFVWASGNGGSRQDSCSADGYTTSVYTLSISSATYDNHRPWYLEECPSSIATT----YSS-ADFRQ----PAIVTVDVPGGCTDKHTGTSASAPLAAGIIALALEANPELTWRDMQHLVLRTANW-KPLENNPGWSRNGVGRMVSNKFGYGLIDGGALVNMAKTWKTVPEQHICTYEYRLANPNPRPIVGRFQLNFTLDVNGC-ESGTPVLYLEHVQVHATVRYLKRGDLKLTLFSPSGTRSVLLPPRPQDFNANGFHKWPFLSVQQWGEDPRGTW 599          
BLAST of P/Homo B domain-containing protein vs. Ensembl Celegans
Match: bli-4 (Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;Acc:P51559])

HSP 1 Score: 253.447 bits (646), Expect = 5.055e-73
Identity = 181/483 (37.47%), Postives = 260/483 (53.83%), Query Frame = 3
Query:  675 RRLVNQRHES---LGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYE--AVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGK-KTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKW 2102
            RR   Q+ +S   + S  F DP     W Y + G       G DMN+   +    +GR V VS++DDGI   H ++  N+DP AS D+ND  +   DP       +    N HGT CA  +A  + N  CG+GVAF A +GG+RML    V+D +EA +L+ N  +IDIYS SWGP+D G          ++A   G + GR G+G+I+++A+GNGG   D C  DG+  S YT+++++      +P Y EEC +   T     YS+  DF +    P +V   + G C ++  GTSA+ PL +G IALALEAN  L WRD+QHL   +     P E    W  N  G +VS+++G+GL+D  A V  A+ W TV +  +C      +N   +   G+ +   T    GC  +   +  LEHV++H  + +  RGDL ++L SP+ T+SVLL  R +D N N    + FLS   WGE+PRG W
Sbjct:  142 RRAQRQQPQSPREIPSLPFPDPLYKDQW-YLHGGAVG----GYDMNVRQAWLQGYAGRNVSVSILDDGIQRDHPDLAANYDPLASTDINDHDD---DP-----TPQNNGDNKHGTRCAGEVAALAGNNQCGVGVAFKAKIGGVRMLD-GAVSDSVEAASLSLNQDHIDIYSASWGPEDDGKTFDGPGPLAREAFYRGIKNGRGGKGNIFVWASGNGGSRQDSCSADGYTTSVYTLSISSATYDNHRPWYLEECPSSIATT----YSS-ADFRQ----PAIVTVDVPGGCTDKHTGTSASAPLAAGIIALALEANPELTWRDMQHLVLRTANW-KPLENNPGWSRNGVGRMVSNKFGYGLIDGGALVNMAKTWKTVPEQHICTYEYRLANPNPRPIVGRFQLNFTLDVNGC-ESGTPVLYLEHVQVHATVRYLKRGDLKLTLFSPSGTRSVLLPPRPQDFNANGFHKWPFLSVQQWGEDPRGTW 599          
BLAST of P/Homo B domain-containing protein vs. Ensembl Celegans
Match: bli-4 (Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;Acc:P51559])

HSP 1 Score: 252.292 bits (643), Expect = 1.001e-72
Identity = 180/482 (37.34%), Postives = 259/482 (53.73%), Query Frame = 3
Query:  675 RRLVNQRHES---LGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHL-FTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGK-KTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKW 2102
            RR   Q+ +S   + S  F DP     W Y + G       G DMN+   +    +GR V VS++DDGI   H ++  N+DP AS D+ND  +   DP       +    N HGT CA  +A  + N  CG+GVAF A +GG+RML    V+D +EA +L+ N  +IDIYS SWGP+D G          ++A   G + GR G+G+I+++A+GNGG   D C  DG+  S YT+++++      +P Y EEC +   T     YS+  DF +    P +V   + G C ++  GTSA+ PL +G IALALEAN  L WRD+QHL    +   P      W  N  G +VS+++G+GL+D  A V  A+ W TV +  +C      +N   +   G+ +   T    GC  +   +  LEHV++H  + +  RGDL ++L SP+ T+SVLL  R +D N N    + FLS   WGE+PRG W
Sbjct:  142 RRAQRQQPQSPREIPSLPFPDPLYKDQW-YLHGGAVG----GYDMNVRQAWLQGYAGRNVSVSILDDGIQRDHPDLAANYDPLASTDINDHDD---DP-----TPQNNGDNKHGTRCAGEVAALAGNNQCGVGVAFKAKIGGVRMLD-GAVSDSVEAASLSLNQDHIDIYSASWGPEDDGKTFDGPGPLAREAFYRGIKNGRGGKGNIFVWASGNGGSRQDSCSADGYTTSVYTLSISSATYDNHRPWYLEECPSSIATT----YSS-ADFRQ----PAIVTVDVPGGCTDKHTGTSASAPLAAGIIALALEANPELTWRDMQHLVLRTANWKPLENNPGWSRNGVGRMVSNKFGYGLIDGGALVNMAKTWKTVPEQHICTYEYRLANPNPRPIVGRFQLNFTLDVNGC-ESGTPVLYLEHVQVHATVRYLKRGDLKLTLFSPSGTRSVLLPPRPQDFNANGFHKWPFLSVQQWGEDPRGTW 599          
BLAST of P/Homo B domain-containing protein vs. Ensembl Fly
Match: Fur2 (gene:FBgn0004598 transcript:FBtr0074262)

HSP 1 Score: 258.84 bits (660), Expect = 1.378e-71
Identity = 189/500 (37.80%), Postives = 270/500 (54.00%), Query Frame = 3
Query:  714 FKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAA-ISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEA--VWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            F F DP   + W Y N G  D    GLDMN+   ++   +G+GVVVS++DDGI T H ++ +N+DP AS D+N      SDP       +    N HGT CA  +A  + N  CG+GVA+NA++GG+RML    V D++EA AL+ N  +IDIYS SWGP+D G          ++A   G   GR+G+GSI+++A+GNGG   D C  DG+ NS +T+++++    G KP Y EEC++ ++ T + G    D       +D  L    I   C     GTSA+ PL +G  ALALEAN  L WRD+Q+L   + R P P E    W LN      SH++G+GL+D  A V  A+ W +V    +C   +   ++ +    G          GCA T NE++ LEHV+    +    RG+L I LTSP  T S LL +R RD   +N   + FLS   WGE   G+W   +++    G  ++  + G L +  L F+GT+
Sbjct:  373 FIFPDPLFKEQW-YLNGGAKD----GLDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGND---SDP-----TPQDNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLD-GKVNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGHDKSVATVDMDGSLRPDHI---CTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR-PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSNFDDWPFLSVHFWGEKAEGRWTLQVIN----GGRRRVNQPGILSKWQLIFYGTS 850          
BLAST of P/Homo B domain-containing protein vs. Ensembl Fly
Match: Fur2 (gene:FBgn0004598 transcript:FBtr0074267)

HSP 1 Score: 258.84 bits (660), Expect = 1.378e-71
Identity = 189/500 (37.80%), Postives = 270/500 (54.00%), Query Frame = 3
Query:  714 FKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAA-ISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEA--VWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            F F DP   + W Y N G  D    GLDMN+   ++   +G+GVVVS++DDGI T H ++ +N+DP AS D+N      SDP       +    N HGT CA  +A  + N  CG+GVA+NA++GG+RML    V D++EA AL+ N  +IDIYS SWGP+D G          ++A   G   GR+G+GSI+++A+GNGG   D C  DG+ NS +T+++++    G KP Y EEC++ ++ T + G    D       +D  L    I   C     GTSA+ PL +G  ALALEAN  L WRD+Q+L   + R P P E    W LN      SH++G+GL+D  A V  A+ W +V    +C   +   ++ +    G          GCA T NE++ LEHV+    +    RG+L I LTSP  T S LL +R RD   +N   + FLS   WGE   G+W   +++    G  ++  + G L +  L F+GT+
Sbjct:  373 FIFPDPLFKEQW-YLNGGAKD----GLDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGND---SDP-----TPQDNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLD-GKVNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGHDKSVATVDMDGSLRPDHI---CTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR-PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSNFDDWPFLSVHFWGEKAEGRWTLQVIN----GGRRRVNQPGILSKWQLIFYGTS 850          
BLAST of P/Homo B domain-containing protein vs. Ensembl Fly
Match: Fur2 (gene:FBgn0004598 transcript:FBtr0074266)

HSP 1 Score: 258.84 bits (660), Expect = 1.378e-71
Identity = 189/500 (37.80%), Postives = 270/500 (54.00%), Query Frame = 3
Query:  714 FKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAA-ISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEA--VWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            F F DP   + W Y N G  D    GLDMN+   ++   +G+GVVVS++DDGI T H ++ +N+DP AS D+N      SDP       +    N HGT CA  +A  + N  CG+GVA+NA++GG+RML    V D++EA AL+ N  +IDIYS SWGP+D G          ++A   G   GR+G+GSI+++A+GNGG   D C  DG+ NS +T+++++    G KP Y EEC++ ++ T + G    D       +D  L    I   C     GTSA+ PL +G  ALALEAN  L WRD+Q+L   + R P P E    W LN      SH++G+GL+D  A V  A+ W +V    +C   +   ++ +    G          GCA T NE++ LEHV+    +    RG+L I LTSP  T S LL +R RD   +N   + FLS   WGE   G+W   +++    G  ++  + G L +  L F+GT+
Sbjct:  373 FIFPDPLFKEQW-YLNGGAKD----GLDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGND---SDP-----TPQDNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLD-GKVNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGHDKSVATVDMDGSLRPDHI---CTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR-PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSNFDDWPFLSVHFWGEKAEGRWTLQVIN----GGRRRVNQPGILSKWQLIFYGTS 850          
BLAST of P/Homo B domain-containing protein vs. Ensembl Fly
Match: Fur2 (gene:FBgn0004598 transcript:FBtr0074264)

HSP 1 Score: 258.84 bits (660), Expect = 1.378e-71
Identity = 189/500 (37.80%), Postives = 270/500 (54.00%), Query Frame = 3
Query:  714 FKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAA-ISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEA--VWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            F F DP   + W Y N G  D    GLDMN+   ++   +G+GVVVS++DDGI T H ++ +N+DP AS D+N      SDP       +    N HGT CA  +A  + N  CG+GVA+NA++GG+RML    V D++EA AL+ N  +IDIYS SWGP+D G          ++A   G   GR+G+GSI+++A+GNGG   D C  DG+ NS +T+++++    G KP Y EEC++ ++ T + G    D       +D  L    I   C     GTSA+ PL +G  ALALEAN  L WRD+Q+L   + R P P E    W LN      SH++G+GL+D  A V  A+ W +V    +C   +   ++ +    G          GCA T NE++ LEHV+    +    RG+L I LTSP  T S LL +R RD   +N   + FLS   WGE   G+W   +++    G  ++  + G L +  L F+GT+
Sbjct:  373 FIFPDPLFKEQW-YLNGGAKD----GLDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGND---SDP-----TPQDNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLD-GKVNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGHDKSVATVDMDGSLRPDHI---CTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR-PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSNFDDWPFLSVHFWGEKAEGRWTLQVIN----GGRRRVNQPGILSKWQLIFYGTS 850          
BLAST of P/Homo B domain-containing protein vs. Ensembl Fly
Match: Fur2 (gene:FBgn0004598 transcript:FBtr0301301)

HSP 1 Score: 258.455 bits (659), Expect = 1.576e-71
Identity = 189/500 (37.80%), Postives = 270/500 (54.00%), Query Frame = 3
Query:  714 FKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAA-ISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEA--VWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            F F DP   + W Y N G  D    GLDMN+   ++   +G+GVVVS++DDGI T H ++ +N+DP AS D+N      SDP       +    N HGT CA  +A  + N  CG+GVA+NA++GG+RML    V D++EA AL+ N  +IDIYS SWGP+D G          ++A   G   GR+G+GSI+++A+GNGG   D C  DG+ NS +T+++++    G KP Y EEC++ ++ T + G    D       +D  L    I   C     GTSA+ PL +G  ALALEAN  L WRD+Q+L   + R P P E    W LN      SH++G+GL+D  A V  A+ W +V    +C   +   ++ +    G          GCA T NE++ LEHV+    +    RG+L I LTSP  T S LL +R RD   +N   + FLS   WGE   G+W   +++    G  ++  + G L +  L F+GT+
Sbjct:  349 FIFPDPLFKEQW-YLNGGAKD----GLDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGND---SDP-----TPQDNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLD-GKVNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGHDKSVATVDMDGSLRPDHI---CTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR-PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTINEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSNFDDWPFLSVHFWGEKAEGRWTLQVIN----GGRRRVNQPGILSKWQLIFYGTS 826          
BLAST of P/Homo B domain-containing protein vs. Ensembl Zebrafish
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:ZFIN;Acc:ZDB-GENE-071009-1])

HSP 1 Score: 293.893 bits (751), Expect = 6.805e-87
Identity = 194/520 (37.31%), Postives = 297/520 (57.12%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRG-PRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDT-NNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIH 2264
            F+DP  ++ W Y    +     P LD+++  V+K  I+G+GVV++V+DDG++  H +I  N+DPAAS D ND     +DP   PRY +    +N HGT CA  IA +++N  CG+GVA+N+ +GGIRML   +VTD +EA ++ +N  ++DIYS SWGP D G          QKA E G ++GR G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   TA   G  TD           + +A ++ +C E   GTSA+ PL +G  ALALE N  L WRD+QHL   +    P      W+ N AG++V+ R+GFGLL+  A V   + ++W  V + + C+  + ++ +   ++   +  +   T  CA   N + +LEHV++   IE+  RGDL I+LTSP+ T +VLL +R RDT +N    ++F+S   WGENP G W   I D     +S +    G ++   L  HGT+  +   H  K  + T +  + 
Sbjct:  124 FDDPMWNQQW-YLQDTRTSSSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNHTDIYPNYDPAASYDFND-----NDPDPFPRYDS--TNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGGIRMLD-GIVTDAIEASSIGYNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSLYTISISSASQQGLSPWYAEKCSSTLATAYSSGDYTDQR---------ITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVWTSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCI-VRDETFQPRPLKAAGEISIEIPTKACAGQANSVMSLEHVQVEVSIEYTRRGDLHITLTSPSGTTTVLLAERERDTSSNGFRNWAFMSVHTWGENPTGTWILKITD-----TSGRMENEGQIISWKLILHGTS--EKPEHMKKARVYTPYNAVQ 617          
BLAST of P/Homo B domain-containing protein vs. Ensembl Zebrafish
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:ZFIN;Acc:ZDB-GENE-071009-1])

HSP 1 Score: 293.508 bits (750), Expect = 8.782e-87
Identity = 194/520 (37.31%), Postives = 297/520 (57.12%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRG-PRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDT-NNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIH 2264
            F+DP  ++ W Y    +     P LD+++  V+K  I+G+GVV++V+DDG++  H +I  N+DPAAS D ND     +DP   PRY +    +N HGT CA  IA +++N  CG+GVA+N+ +GGIRML   +VTD +EA ++ +N  ++DIYS SWGP D G          QKA E G ++GR G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   TA   G  TD           + +A ++ +C E   GTSA+ PL +G  ALALE N  L WRD+QHL   +    P      W+ N AG++V+ R+GFGLL+  A V   + ++W  V + + C+  + ++ +   ++   +  +   T  CA   N + +LEHV++   IE+  RGDL I+LTSP+ T +VLL +R RDT +N    ++F+S   WGENP G W   I D     +S +    G ++   L  HGT+  +   H  K  + T +  + 
Sbjct:  124 FDDPMWNQQW-YLQDTRTSSSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNHTDIYPNYDPAASYDFND-----NDPDPFPRYDS--TNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGGIRMLD-GIVTDAIEASSIGYNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSLYTISISSASQQGLSPWYAEKCSSTLATAYSSGDYTDQR---------ITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVWTSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCI-VRDETFQPRPLKAAGEISIEIPTKACAGQANSVMSLEHVQVEVSIEYTRRGDLHITLTSPSGTTTVLLAERERDTSSNGFRNWAFMSVHTWGENPTGTWILKITD-----TSGRMENEGQIISWKLILHGTS--EKPEHMKKARVYTPYNAVQ 617          
BLAST of P/Homo B domain-containing protein vs. Ensembl Zebrafish
Match: CR383678.1 (proprotein convertase subtilisin/kexin type 5a [Source:NCBI gene;Acc:571235])

HSP 1 Score: 293.508 bits (750), Expect = 2.593e-84
Identity = 208/533 (39.02%), Postives = 298/533 (55.91%), Query Frame = 3
Query:  639 MNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN--DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGC-ANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRD-TNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHK 2225
            + Q+ ++   +    ++Q H+      FNDP+ D +W    Y   D  N   DMN+   ++   +G+GVVVS++DDGI+ +H ++ +N+D  AS D+N  DP     DP  PRY   V  +N HGT CA ++A  +NN +C +G+A+NA +GG+RML  +M TD++EA +L    QYIDIYS+SWGP D G          + A+E G R+GRKGRGSI+++A+GNGG + DHC  DG+ NS YTI+V +T   GRKP Y EEC++   T    G          S  P +V   +  +C +   GTSA+ P+ +G IAL LEAN  L WRDIQH+   +    +   + WQ N AG  VSH YGFGLL+  A V+NA+ W  V    +C     ++ +I  I   +  R   +++GC A     +  LEHV +   I HP RGDL I+LTSP+ T S LL  R  D ++   I + F++   WGE   G W  DI D       + +  +G L+E  L  +GT+     RH+
Sbjct:   93 IQQQMVQKRVKRTETMDQTHDG----SFNDPKWDSMW----YIHCDH-NCLTDMNIQAAWRRGYTGKGVVVSILDDGIERQHPDLKQNYDARASYDVNGNDP-----DPT-PRY--DVTNENKHGTRCAGVVAASANNSLCIVGIAYNAKIGGVRMLDGDM-TDMVEAQSLNLRQQYIDIYSSSWGPDDDGRTVDGPGPLARLALENGIRKGRKGRGSIFVWASGNGGQSQDHCSCDGYTNSIYTISVGSTTQSGRKPWYLEECSSTLATTYSSG---------DSHSPGVVTTDLRQRCTDEHSGTSASAPMAAGIIALTLEANPALTWRDIQHIIVKTSSRGHLSASDWQSNGAGYDVSHLYGFGLLNAEAMVKNAETWKQVPSQHICEENIGQNARI--ISPERVLRSVLKSSGCSAQRLQRVVYLEHVIVRVTITHPHRGDLSITLTSPSGTTSQLLANRPNDHSSEGFIKWEFMTTHCWGERSAGDWILDIRDTPS--PQRNTRLQGKLVEWSLVLYGTSTHPYIRHE 594          
BLAST of P/Homo B domain-containing protein vs. Ensembl Zebrafish
Match: pcsk5a (proprotein convertase subtilisin/kexin type 5a [Source:ZFIN;Acc:ZDB-GENE-060531-130])

HSP 1 Score: 291.967 bits (746), Expect = 7.708e-84
Identity = 208/533 (39.02%), Postives = 298/533 (55.91%), Query Frame = 3
Query:  639 MNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN--DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGC-ANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRD-TNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHK 2225
            + Q+ ++   +    ++Q H+      FNDP+ D +W    Y   D  N   DMN+   ++   +G+GVVVS++DDGI+ +H ++ +N+D  AS D+N  DP     DP  PRY   V  +N HGT CA ++A  +NN +C +G+A+NA +GG+RML  +M TD++EA +L    QYIDIYS+SWGP D G          + A+E G R+GRKGRGSI+++A+GNGG + DHC  DG+ NS YTI+V +T   GRKP Y EEC++   T    G          S  P +V   +  +C +   GTSA+ P+ +G IAL LEAN  L WRDIQH+   +    +   + WQ N AG  VSH YGFGLL+  A V+NA+ W  V    +C     ++ +I  I   +  R   +++GC A     +  LEHV +   I HP RGDL I+LTSP+ T S LL  R  D ++   I + F++   WGE   G W  DI D       + +  +G L+E  L  +GT+     RH+
Sbjct:   93 IQQQMVQKRVKRTETMDQTHDG----SFNDPKWDSMW----YIHCDH-NCLTDMNIQAAWRRGYTGKGVVVSILDDGIERQHPDLKQNYDARASYDVNGNDP-----DPT-PRY--DVTNENKHGTRCAGVVAASANNSLCIVGIAYNAKIGGVRMLDGDM-TDMVEAQSLNLRQQYIDIYSSSWGPDDDGRTVDGPGPLARLALENGIRKGRKGRGSIFVWASGNGGQSQDHCSCDGYTNSIYTISVGSTTQSGRKPWYLEECSSTLATTYSSG---------DSHSPGVVTTDLRQRCTDEHSGTSASAPMAAGIIALTLEANPALTWRDIQHIIVKTSSRGHLSASDWQSNGAGYDVSHLYGFGLLNAEAMVKNAETWKQVPSQHICEENIGQNARI--ISPERVLRSVLKSSGCSAQRLQRVVYLEHVIVRVTITHPHRGDLSITLTSPSGTTSQLLANRPNDHSSEGFIKWEFMTTHCWGERLAGDWILDIRDTPS--PQRNNRLQGKLVEWSLVLYGTSTHPYIRHE 594          
BLAST of P/Homo B domain-containing protein vs. Ensembl Zebrafish
Match: pcsk5a (proprotein convertase subtilisin/kexin type 5a [Source:ZFIN;Acc:ZDB-GENE-060531-130])

HSP 1 Score: 290.426 bits (742), Expect = 5.393e-82
Identity = 208/533 (39.02%), Postives = 298/533 (55.91%), Query Frame = 3
Query:  639 MNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN--DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGC-ANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRD-TNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHK 2225
            + Q+ ++   +    ++Q H+      FNDP+ D +W    Y   D  N   DMN+   ++   +G+GVVVS++DDGI+ +H ++ +N+D  AS D+N  DP     DP  PRY   V  +N HGT CA ++A  +NN +C +G+A+NA +GG+RML  +M TD++EA +L    QYIDIYS+SWGP D G          + A+E G R+GRKGRGSI+++A+GNGG + DHC  DG+ NS YTI+V +T   GRKP Y EEC++   T    G          S  P +V   +  +C +   GTSA+ P+ +G IAL LEAN  L WRDIQH+   +    +   + WQ N AG  VSH YGFGLL+  A V+NA+ W  V    +C     ++ +I  I   +  R   +++GC A     +  LEHV +   I HP RGDL I+LTSP+ T S LL  R  D ++   I + F++   WGE   G W  DI D       + +  +G L+E  L  +GT+     RH+
Sbjct:   72 IQQQMVQKRVKRTETMDQTHDG----SFNDPKWDSMW----YIHCDH-NCLTDMNIQAAWRRGYTGKGVVVSILDDGIERQHPDLKQNYDARASYDVNGNDP-----DPT-PRY--DVTNENKHGTRCAGVVAASANNSLCIVGIAYNAKIGGVRMLDGDM-TDMVEAQSLNLRQQYIDIYSSSWGPDDDGRTVDGPGPLARLALENGIRKGRKGRGSIFVWASGNGGQSQDHCSCDGYTNSIYTISVGSTTQSGRKPWYLEECSSTLATTYSSG---------DSHSPGVVTTDLRQRCTDEHSGTSASAPMAAGIIALTLEANPALTWRDIQHIIVKTSSRGHLSASDWQSNGAGYDVSHLYGFGLLNAEAMVKNAETWKQVPSQHICEENIGQNARI--ISPERVLRSVLKSSGCSAQRLQRVVYLEHVIVRVTITHPHRGDLSITLTSPSGTTSQLLANRPNDHSSEGFIKWEFMTTHCWGERLAGDWILDIRDTPS--PQRNNRLQGKLVEWSLVLYGTSTHPYIRHE 573          
BLAST of P/Homo B domain-containing protein vs. Ensembl Xenopus
Match: zar1 (zygote arrest 1 [Source:Xenbase;Acc:XB-GENE-942424])

HSP 1 Score: 295.819 bits (756), Expect = 1.255e-87
Identity = 205/552 (37.14%), Postives = 310/552 (56.16%), Query Frame = 3
Query:  573 IYATKINPKVHKKSFTN-KKRYGMNQKTMEDDKEYRRLVNQRHESLGSFK--FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILK--IRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            ++  K +P+  ++S  +  KR   + +    +++Y +  N+R       K  FNDP  ++ W Y    + +   P LD++L  V+K  I+G+GVV++V+DDG++  H +I  N+DP AS D ND  N   DP  PRY   +  +N HGT CA  IA  +NN  CG+GVA+NA +GGIRML   +VTD  EA ++  N Q++ IYS SWGP D G          QKA E G ++GR G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   TA   G  TD           +++A ++ +C E   GTSA+ PL +G  ALALE N  L WRD+QHL   +    P    A W+ N AG++V+ R+GFGLL+  A V   + + W  V + + C+    + N+     +R+  +  +   T  C   DN I++LEH+++   IE+  RGDL I+LTSP  T +VLL +R RDT+     ++ F+S   WGE+P G W   I D+     S +    G ++   L  HGT+
Sbjct:   70 LFRHKAHPRRSRRSAPHLTKRLADDGRVSWAEQQYSKERNKRSTFRQDTKNLFNDPLWNRQW-YLQDTRSNPSLPKLDLHLLPVWKKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDN---DPF-PRY--DITNENRHGTRCAGEIAMVANNNKCGVGVAYNAKVGGIRMLD-GVVTDAKEASSIGFNPQHVHIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKQGRNGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGDYTDQR---------IISADLHNECTETHTGTSASAPLAAGIFALALEFNPDLTWRDMQHLVVWTSEYDPLANNAGWKKNGAGLMVNSRFGFGLLNAKALVDLADPKTWKGVAEKKECI---VEDNEFSPRFLRSDGEVTIQIPTKACEGQDNHIKSLEHLQLEATIEYTRRGDLHITLTSPLGTNTVLLTERERDTSPYGFKSWDFMSVHTWGEDPAGTWTLKISDV-----SGRKKNEGRIVSWKLILHGTS 596          
BLAST of P/Homo B domain-containing protein vs. Ensembl Xenopus
Match: zar1 (zygote arrest 1 [Source:Xenbase;Acc:XB-GENE-942424])

HSP 1 Score: 296.204 bits (757), Expect = 1.289e-87
Identity = 205/552 (37.14%), Postives = 310/552 (56.16%), Query Frame = 3
Query:  573 IYATKINPKVHKKSFTN-KKRYGMNQKTMEDDKEYRRLVNQRHESLGSFK--FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILK--IRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            ++  K +P+  ++S  +  KR   + +    +++Y +  N+R       K  FNDP  ++ W Y    + +   P LD++L  V+K  I+G+GVV++V+DDG++  H +I  N+DP AS D ND  N   DP  PRY   +  +N HGT CA  IA  +NN  CG+GVA+NA +GGIRML   +VTD  EA ++  N Q++ IYS SWGP D G          QKA E G ++GR G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   TA   G  TD           +++A ++ +C E   GTSA+ PL +G  ALALE N  L WRD+QHL   +    P    A W+ N AG++V+ R+GFGLL+  A V   + + W  V + + C+    + N+     +R+  +  +   T  C   DN I++LEH+++   IE+  RGDL I+LTSP  T +VLL +R RDT+     ++ F+S   WGE+P G W   I D+     S +    G ++   L  HGT+
Sbjct:   70 LFRHKAHPRRSRRSAPHLTKRLADDGRVSWAEQQYSKERNKRSTFRQDTKNLFNDPLWNRQW-YLQDTRSNPSLPKLDLHLLPVWKKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDN---DPF-PRY--DITNENRHGTRCAGEIAMVANNNKCGVGVAYNAKVGGIRMLD-GVVTDAKEASSIGFNPQHVHIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKQGRNGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGDYTDQR---------IISADLHNECTETHTGTSASAPLAAGIFALALEFNPDLTWRDMQHLVVWTSEYDPLANNAGWKKNGAGLMVNSRFGFGLLNAKALVDLADPKTWKGVAEKKECI---VEDNEFSPRFLRSDGEVTIQIPTKACEGQDNHIKSLEHLQLEATIEYTRRGDLHITLTSPLGTNTVLLTERERDTSPYGFKSWDFMSVHTWGEDPAGTWTLKISDV-----SGRKKNEGRIVSWKLILHGTS 596          
BLAST of P/Homo B domain-containing protein vs. Ensembl Xenopus
Match: zar1 (zygote arrest 1 [Source:Xenbase;Acc:XB-GENE-942424])

HSP 1 Score: 295.819 bits (756), Expect = 1.348e-87
Identity = 205/552 (37.14%), Postives = 310/552 (56.16%), Query Frame = 3
Query:  573 IYATKINPKVHKKSFTN-KKRYGMNQKTMEDDKEYRRLVNQRHESLGSFK--FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILK--IRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            ++  K +P+  ++S  +  KR   + +    +++Y +  N+R       K  FNDP  ++ W Y    + +   P LD++L  V+K  I+G+GVV++V+DDG++  H +I  N+DP AS D ND  N   DP  PRY   +  +N HGT CA  IA  +NN  CG+GVA+NA +GGIRML   +VTD  EA ++  N Q++ IYS SWGP D G          QKA E G ++GR G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   TA   G  TD           +++A ++ +C E   GTSA+ PL +G  ALALE N  L WRD+QHL   +    P    A W+ N AG++V+ R+GFGLL+  A V   + + W  V + + C+    + N+     +R+  +  +   T  C   DN I++LEH+++   IE+  RGDL I+LTSP  T +VLL +R RDT+     ++ F+S   WGE+P G W   I D+     S +    G ++   L  HGT+
Sbjct:   70 LFRHKAHPRRSRRSAPHLTKRLADDGRVSWAEQQYSKERNKRSTFRQDTKNLFNDPLWNRQW-YLQDTRSNPSLPKLDLHLLPVWKKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDN---DPF-PRY--DITNENRHGTRCAGEIAMVANNNKCGVGVAYNAKVGGIRMLD-GVVTDAKEASSIGFNPQHVHIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKQGRNGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGDYTDQR---------IISADLHNECTETHTGTSASAPLAAGIFALALEFNPDLTWRDMQHLVVWTSEYDPLANNAGWKKNGAGLMVNSRFGFGLLNAKALVDLADPKTWKGVAEKKECI---VEDNEFSPRFLRSDGEVTIQIPTKACEGQDNHIKSLEHLQLEATIEYTRRGDLHITLTSPLGTNTVLLTERERDTSPYGFKSWDFMSVHTWGEDPAGTWTLKISDV-----SGRKKNEGRIVSWKLILHGTS 596          
BLAST of P/Homo B domain-containing protein vs. Ensembl Xenopus
Match: gdap1l1 (ganglioside induced differentiation associated protein 1-like 1 [Source:Xenbase;Acc:XB-GENE-950543])

HSP 1 Score: 290.812 bits (743), Expect = 1.625e-85
Identity = 204/545 (37.43%), Postives = 302/545 (55.41%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCA-NTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAE-RGHLLEVVLEFHGTT----NLDSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYIYFNQQR 2333
            FNDP    +W  +   +        +MN+ + ++   +G+ VVVS++DDG++  H ++++N+DP AS D+N       DP  PRY    + +N HGT CA  +A  +NN  C +G+A+NA +GGIRML  + VTD++EA +L     YIDIYS+SWGP D G          +KA E G ++GRKG GSI+++A+GNGG   D+C  DG+ NS YTI++++T  +G KP Y EECA+   T     YS+   ++R      +V   +   C +   GTS + P+++G IALALEAN  L WRD+QHL   + R  +     W+ N AG  VSH YGFGL+D  A V  A+ W TV    VC+G   +  +   IR  +  R T QT  C  N  + +  LEHV +   I HP RGDL I L SP+ TKS LL +R  D++N     + F++   WGE   G+W  +I D     S  ++ E +G L E  L F+GT+    N    +H     ++    ++   +P KS ++ ++  +I   ++R
Sbjct:  124 FNDPIWPNMWYLHCSDKSSRCRS--EMNVMSAWQRGYTGKNVVVSILDDGVEKNHPDLIQNYDPHASHDVNGDDQ---DP-SPRY--DASNENKHGTRCAGEVAASANNSHCIVGIAYNARIGGIRMLDGD-VTDVVEAKSLGVRPDYIDIYSSSWGPDDDGKTVDGPGPLARKAFEDGIKKGRKGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISISSTTENGYKPWYLEECASTLATT----YSSGAFYERK-----IVTTDLRQGCTDDHTGTSVSAPMVAGVIALALEANPVLNWRDVQHLLVKTSRSVHLRAPDWKTNGAGRKVSHLYGFGLVDADAMVVEAKKWRTVPPQHVCIGASDRRPRF--IRAVQLIRTTTQTNACVDNAGHYVAYLEHVVVRVTISHPRRGDLQIYLISPSGTKSQLLAKRTFDSSNEGFKNWEFMTVHCWGEKAEGEWTLEIHD---SSSQLRNPEIQGKLKEWTLIFYGTSEHPYNHIGTQHSRIRTLDISATDL---EPSKSTVIQSHLEFIDEEEER 642          
BLAST of P/Homo B domain-containing protein vs. Ensembl Xenopus
Match: gdap1l1 (ganglioside induced differentiation associated protein 1-like 1 [Source:Xenbase;Acc:XB-GENE-950543])

HSP 1 Score: 290.041 bits (741), Expect = 4.434e-85
Identity = 203/539 (37.66%), Postives = 299/539 (55.47%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCA-NTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAE-RGHLLEVVLEFHGTT----NLDSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYI 2315
            FNDP    +W  +   +        +MN+ + ++   +G+ VVVS++DDG++  H ++++N+DP AS D+N       DP  PRY    + +N HGT CA  +A  +NN  C +G+A+NA +GGIRML  + VTD++EA +L     YIDIYS+SWGP D G          +KA E G ++GRKG GSI+++A+GNGG   D+C  DG+ NS YTI++++T  +G KP Y EECA+   T     YS+   ++R      +V   +   C +   GTS + P+++G IALALEAN  L WRD+QHL   + R  +     W+ N AG  VSH YGFGL+D  A V  A+ W TV    VC+G   +  +   IR  +  R T QT  C  N  + +  LEHV +   I HP RGDL I L SP+ TKS LL +R  D++N     + F++   WGE   G+W  +I D     S  ++ E +G L E  L F+GT+    N    +H     ++    ++   +P KS ++ ++  +I
Sbjct:  115 FNDPIWPNMWYLHCSDKSSRCRS--EMNVMSAWQRGYTGKNVVVSILDDGVEKNHPDLIQNYDPHASHDVNGDDQ---DP-SPRY--DASNENKHGTRCAGEVAASANNSHCIVGIAYNARIGGIRMLDGD-VTDVVEAKSLGVRPDYIDIYSSSWGPDDDGKTVDGPGPLARKAFEDGIKKGRKGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISISSTTENGYKPWYLEECASTLATT----YSSGAFYERK-----IVTTDLRQGCTDDHTGTSVSAPMVAGVIALALEANPVLNWRDVQHLLVKTSRSVHLRAPDWKTNGAGRKVSHLYGFGLVDADAMVVEAKKWRTVPPQHVCIGASDRRPRF--IRAVQLIRTTTQTNACVDNAGHYVAYLEHVVVRVTISHPRRGDLQIYLISPSGTKSQLLAKRTFDSSNEGFKNWEFMTVHCWGEKAEGEWTLEIHD---SSSQLRNPEIQGKLKEWTLIFYGTSEHPYNHIGTQHSRIRTLDISATDL---EPSKSTVIQSHLEFI 627          
BLAST of P/Homo B domain-containing protein vs. Ensembl Mouse
Match: Pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:MGI Symbol;Acc:MGI:97511])

HSP 1 Score: 288.115 bits (736), Expect = 9.163e-85
Identity = 200/551 (36.30%), Postives = 308/551 (55.90%), Query Frame = 3
Query:  573 IYATKINPKVHKKSFTN-KKRYGMNQKTMEDDKEYRRLVNQRHESLGSFK--FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTN 2204
            ++  K +P+  ++S  +  KR   + +    +++Y +  ++R     S    FNDP  ++ W Y    +     P LD+++  V++  I+G+GVV++V+DDG++  H +I  N+DP AS D ND  +   DP  PRY   +  +N HGT CA  IA ++NN  CG+GVA+N+ +GGIRML   +VTD +EA ++  N  ++DIYS SWGP D G          QKA E G ++GR+G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   T+   G  TD           + +A ++  C E   GTSA+ PL +G  ALALEAN  L WRD+QHL   +    P      W+ N AG++V+ R+GFGLL+  A V   + + W  V + + CV  K  + +   ++   +  V   T  C   +N I++LEHV+    IE+  RGDL ++LTS   T +VLL +R RDT+ N    + F+S   WGENP G W   I D+     S +    G ++   L  HGT++
Sbjct:   69 LFKHKSHPRRSRRSALHITKRLSDDDRVTWAEQQYEKERSKRSVQKDSALDLFNDPMWNQQW-YLQDTRMTAALPKLDLHVIPVWEKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDH---DPF-PRY--DLTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLD-GIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDYTDQR---------ITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLASNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRNVPEKKECV-VKDNNFEPRALKANGEVIVEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAVGTSTVLLAERERDTSPNGFKNWDFMSVHTWGENPVGTWTLKITDM-----SGRMQNEGRIVNWKLILHGTSS 596          
BLAST of P/Homo B domain-containing protein vs. Ensembl Mouse
Match: Pcsk5 (proprotein convertase subtilisin/kexin type 5 [Source:MGI Symbol;Acc:MGI:97515])

HSP 1 Score: 286.574 bits (732), Expect = 6.583e-83
Identity = 190/501 (37.92%), Postives = 284/501 (56.69%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGL-DMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN----DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCA-NTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            FNDP+   +W  +     D  +P   DMN+   +K   +G+ +VV+++DDGI+  H ++++N+D  AS D+N    DP         PRY    + +N HGT CA  +A  +NN  C +G+AFNA +GG+RML  + VTD++EA ++++N Q++ IYS SWGP D G          ++A E G R GR+G GS++++A+GNGG + DHC  DG+ NS YTI++++T   G+KP Y EEC++   T     YS+   +D+      ++   +  +C +   GTSA+ P+ +G IALALEAN FL WRD+QH+   + R  +     W+ N AG  VSH YGFGL+D  A V  A+ W TV Q  VCV  ++   +I  IR     R  ++ +GC+ N ++ +  LEHV +   I HP RGDL I LTSP+ T+S LL  R+ D +      + F++   WGE   G W  ++ D       +     G L E  L  +GT+
Sbjct:  128 FNDPKWPSMWYMHCS---DNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPM--------PRY--DASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGD-VTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATT----YSSGESYDKK-----IITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPQQHVCV--ESTDRQIKTIRPNSAVRSIYKASGCSDNPNHHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANRLFDHSMEGFKNWEFMTIHCWGERAAGDWVLEVYDTPS--QLRNFKTPGKLKEWSLVLYGTS 601          
BLAST of P/Homo B domain-containing protein vs. Ensembl Mouse
Match: Pcsk6 (proprotein convertase subtilisin/kexin type 6 [Source:MGI Symbol;Acc:MGI:102897])

HSP 1 Score: 282.337 bits (721), Expect = 4.158e-81
Identity = 199/517 (38.49%), Postives = 287/517 (55.51%), Query Frame = 3
Query:  666 KEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN----DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCAN-TDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANIT-FSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGT 2198
            +E +R V ++  S  S  FNDP    +W  +   +        +MN+   +K   +G+ VVV+++DDGI+  H ++  N+D  AS D+N    DP         PRY    + +N HGT CA  +A  +NN  C +G+A+NA +GGIRML  + VTD++EA +L     YIDIYS SWGP D G          ++A E G ++GR+G GSI+++A+GNGG   DHC  DG+ NS YTI+V++T  +G KP Y EECA+   T     YS+   ++R      +V   +  +C +   GTS + P+++G IALALEANN L WRD+QHL   + R  +   + W++N AG  VSH YGFGL+D  A V  A+ W  V    VCV    K  + + I   +  R T  T  CA+ +D  +  LEHV +   I HP RGDL I L SP+ TKS LL +R+ D +N   T + F++   WGE   G+W  ++ D+      +   ++G L E  L  +GT
Sbjct:  133 QEVKRRVKRQARS-DSLYFNDPIWSNMWYMHCTDKNSRCRS--EMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDP--------SPRY--DASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGD-VTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDHCSCDGYTNSIYTISVSSTTENGHKPWYLEECASTLATT----YSSGAFYERK-----IVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANNQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHLYGFGLVDAEALVLEARKWTAVPSQHVCVATADKRPRSIPIV--QVLRTTALTNACADHSDQRVVYLEHVVVRISISHPRRGDLQIHLISPSGTKSQLLAKRLLDFSNEGFTNWEFMTVHCWGEKAEGEWTLEVQDIPS--QVRNPEKQGKLKEWSLILYGT 622          
BLAST of P/Homo B domain-containing protein vs. Ensembl Mouse
Match: Pcsk6 (proprotein convertase subtilisin/kexin type 6 [Source:MGI Symbol;Acc:MGI:102897])

HSP 1 Score: 281.952 bits (720), Expect = 4.849e-81
Identity = 199/518 (38.42%), Postives = 287/518 (55.41%), Query Frame = 3
Query:  666 KEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN----DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCAN-TDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANIT-FSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            +E +R V ++  S  S  FNDP    +W  +   +        +MN+   +K   +G+ VVV+++DDGI+  H ++  N+D  AS D+N    DP         PRY    + +N HGT CA  +A  +NN  C +G+A+NA +GGIRML  + VTD++EA +L     YIDIYS SWGP D G          ++A E G ++GR+G GSI+++A+GNGG   DHC  DG+ NS YTI+V++T  +G KP Y EECA+   T     YS+   ++R      +V   +  +C +   GTS + P+++G IALALEANN L WRD+QHL   + R  +   + W++N AG  VSH YGFGL+D  A V  A+ W  V    VCV    K  + + I   +  R T  T  CA+ +D  +  LEHV +   I HP RGDL I L SP+ TKS LL +R+ D +N   T + F++   WGE   G+W  ++ D+      +   ++G L E  L  +GT 
Sbjct:  133 QEVKRRVKRQARS-DSLYFNDPIWSNMWYMHCTDKNSRCRS--EMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDP--------SPRY--DASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGD-VTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDHCSCDGYTNSIYTISVSSTTENGHKPWYLEECASTLATT----YSSGAFYERK-----IVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANNQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHLYGFGLVDAEALVLEARKWTAVPSQHVCVATADKRPRSIPIV--QVLRTTALTNACADHSDQRVVYLEHVVVRISISHPRRGDLQIHLISPSGTKSQLLAKRLLDFSNEGFTNWEFMTVHCWGEKAEGEWTLEVQDIPS--QVRNPEKQGKLKEWSLILYGTA 623          
BLAST of P/Homo B domain-containing protein vs. Ensembl Mouse
Match: Pcsk5 (proprotein convertase subtilisin/kexin type 5 [Source:MGI Symbol;Acc:MGI:97515])

HSP 1 Score: 285.804 bits (730), Expect = 2.222e-80
Identity = 184/474 (38.82%), Postives = 275/474 (58.02%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGL-DMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN----DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCA-NTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVD 2120
            FNDP+   +W  +     D  +P   DMN+   +K   +G+ +VV+++DDGI+  H ++++N+D  AS D+N    DP         PRY    + +N HGT CA  +A  +NN  C +G+AFNA +GG+RML  + VTD++EA ++++N Q++ IYS SWGP D G          ++A E G R GR+G GS++++A+GNGG + DHC  DG+ NS YTI++++T   G+KP Y EEC++   T     YS+   +D+      ++   +  +C +   GTSA+ P+ +G IALALEAN FL WRD+QH+   + R  +     W+ N AG  VSH YGFGL+D  A V  A+ W TV Q  VCV  ++   +I  IR     R  ++ +GC+ N ++ +  LEHV +   I HP RGDL I LTSP+ T+S LL  R+ D +      + F++   WGE   G W  ++ D
Sbjct:  128 FNDPKWPSMWYMHCS---DNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPM--------PRY--DASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGD-VTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATT----YSSGESYDKK-----IITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPQQHVCV--ESTDRQIKTIRPNSAVRSIYKASGCSDNPNHHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANRLFDHSMEGFKNWEFMTIHCWGERAAGDWVLEVYD 576          
BLAST of P/Homo B domain-containing protein vs. UniProt/SwissProt
Match: sp|P63239|NEC1_MOUSE (Neuroendocrine convertase 1 OS=Mus musculus OX=10090 GN=Pcsk1 PE=1 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 6.409e-84
Identity = 200/551 (36.30%), Postives = 308/551 (55.90%), Query Frame = 3
Query:  573 IYATKINPKVHKKSFTN-KKRYGMNQKTMEDDKEYRRLVNQRHESLGSFK--FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTN 2204
            ++  K +P+  ++S  +  KR   + +    +++Y +  ++R     S    FNDP  ++ W Y    +     P LD+++  V++  I+G+GVV++V+DDG++  H +I  N+DP AS D ND  +   DP  PRY   +  +N HGT CA  IA ++NN  CG+GVA+N+ +GGIRML   +VTD +EA ++  N  ++DIYS SWGP D G          QKA E G ++GR+G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   T+   G  TD           + +A ++  C E   GTSA+ PL +G  ALALEAN  L WRD+QHL   +    P      W+ N AG++V+ R+GFGLL+  A V   + + W  V + + CV  K  + +   ++   +  V   T  C   +N I++LEHV+    IE+  RGDL ++LTS   T +VLL +R RDT+ N    + F+S   WGENP G W   I D+     S +    G ++   L  HGT++
Sbjct:   69 LFKHKSHPRRSRRSALHITKRLSDDDRVTWAEQQYEKERSKRSVQKDSALDLFNDPMWNQQW-YLQDTRMTAALPKLDLHVIPVWEKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDH---DPF-PRY--DLTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLD-GIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDYTDQR---------ITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLASNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRNVPEKKECV-VKDNNFEPRALKANGEVIVEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAVGTSTVLLAERERDTSPNGFKNWDFMSVHTWGENPVGTWTLKITDM-----SGRMQNEGRIVNWKLILHGTSS 596          
BLAST of P/Homo B domain-containing protein vs. UniProt/SwissProt
Match: sp|P63240|NEC1_MUSCO (Neuroendocrine convertase 1 OS=Mus cookii OX=10098 GN=Pcsk1 PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 6.814e-84
Identity = 200/551 (36.30%), Postives = 308/551 (55.90%), Query Frame = 3
Query:  573 IYATKINPKVHKKSFTN-KKRYGMNQKTMEDDKEYRRLVNQRHESLGSFK--FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTN 2204
            ++  K +P+  ++S  +  KR   + +    +++Y +  ++R     S    FNDP  ++ W Y    +     P LD+++  V++  I+G+GVV++V+DDG++  H +I  N+DP AS D ND  +   DP  PRY   +  +N HGT CA  IA ++NN  CG+GVA+N+ +GGIRML   +VTD +EA ++  N  ++DIYS SWGP D G          QKA E G ++GR+G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   T+   G  TD           + +A ++  C E   GTSA+ PL +G  ALALEAN  L WRD+QHL   +    P      W+ N AG++V+ R+GFGLL+  A V   + + W  V + + CV  K  + +   ++   +  V   T  C   +N I++LEHV+    IE+  RGDL ++LTS   T +VLL +R RDT+ N    + F+S   WGENP G W   I D+     S +    G ++   L  HGT++
Sbjct:   69 LFKHKSHPRRSRRSALHITKRLSDDDRVTWAEQQYEKERSKRSVQKDSALDLFNDPMWNQQW-YLQDTRMTAALPKLDLHVIPVWEKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDH---DPF-PRY--DLTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLD-GIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDYTDQR---------ITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLASNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRNVPEKKECV-VKDNNFEPRALKANGEVIVEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAVGTSTVLLAERERDTSPNGFKNWDFMSVHTWGENPVGTWTLKITDM-----SGRMQNEGRIVNWKLILHGTSS 596          
BLAST of P/Homo B domain-containing protein vs. UniProt/SwissProt
Match: sp|P29120|NEC1_HUMAN (Neuroendocrine convertase 1 OS=Homo sapiens OX=9606 GN=PCSK1 PE=1 SV=2)

HSP 1 Score: 287.73 bits (735), Expect = 8.439e-84
Identity = 200/551 (36.30%), Postives = 308/551 (55.90%), Query Frame = 3
Query:  573 IYATKINPKVHKKS-FTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFK--FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTN 2204
            ++  K +P+  ++S F   KR   + + +  +++Y +  ++R     S    FNDP  ++ W Y    +     P LD+++  V++  I+G+GVV++V+DDG++  H +I  N+DP AS D ND  +   DP  PRY      +N HGT CA  IA ++NN  CG+GVA+N+ +GGIRML   +VTD +EA ++  N  ++DIYS SWGP D G          QKA E G ++GR+G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   T+   G  TD           + +A ++  C E   GTSA+ PL +G  ALALEAN  L WRD+QHL   +    P      W+ N AG++V+ R+GFGLL+  A V   + + W +V + + CV  K    +   ++   +  +   T  C   +N I++LEHV+    IE+  RGDL ++LTS   T +VLL +R RDT+ N    + F+S   WGENP G W   I D+     S +    G ++   L  HGT++
Sbjct:   69 LFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNLFNDPMWNQQW-YLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDH---DPF-PRY--DPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLD-GIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDYTDQR---------ITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECV-VKDNDFEPRALKANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDM-----SGRIQNEGRIVNWKLILHGTSS 596          
BLAST of P/Homo B domain-containing protein vs. UniProt/SwissProt
Match: sp|P28840|NEC1_RAT (Neuroendocrine convertase 1 OS=Rattus norvegicus OX=10116 GN=Pcsk1 PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 1.120e-82
Identity = 195/518 (37.64%), Postives = 291/518 (56.18%), Query Frame = 3
Query:  663 DKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTN 2204
            +KE R+    R  +L    FNDP  ++ W Y    +     P LD+++  V++  I+G+GVV++V+DDG++  H +I  N+DP AS D ND  +   DP  PRY      +N HGT CA  IA ++NN  CG+GVA+N+ +GGIRML   +VTD +EA ++  N  ++DIYS SWGP D G          QKA E G ++GR+G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   T+   G  TD           + +A ++  C E   GTSA+ PL +G  ALALEAN  L WRD+QHL   +    P      W+ N AG++V+ R+GFGLL+  A V   + + W  V + + C+  K  + +   ++   +  V   T  C   +N I +LEHV+    IE+  RGDL ++LTS   T +VLL +R RDT+ N    + F+S   WGENP G W   + D+     S +    G ++   L  HGT++
Sbjct:  104 EKERRKRSVPRDSALN--LFNDPMWNQQW-YLQDTRMTASLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDH---DPF-PRY--DPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLD-GIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDYTDQR---------ITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRNVPEKKECI-IKDNNFEPRALKANGEVIVEIPTRACEGQENAINSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPNGFKNWDFMSVHTWGENPVGTWTLKVTDM-----SGRMQNEGRIVNWKLILHGTSS 596          
BLAST of P/Homo B domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9GLR1|NEC1_BOVIN (Neuroendocrine convertase 1 OS=Bos taurus OX=9913 GN=PCSK1 PE=2 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 3.259e-82
Identity = 192/501 (38.32%), Postives = 283/501 (56.49%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKI--LKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTN 2204
            FNDP  ++ W Y    +     P LD+++  V++  I+G+GVV++V+DDG++  H +I  N+DP AS D ND  +   DP  PRY   +  +N HGT CA  IA ++NN  CG+GVA+N+ +GGIRML   +VTD +EA  +  N  ++DIYS SWGP D G          QKA E G ++GR+G+GSI+++A+GNGG   D+C  DG+ +S YTI++ + +  G  P Y E+C++   T+   G  TD           + +A ++  C E   GTSA+ PL +G  ALALEAN  L WRD+QHL   +    P      W+ N AG++V+ R+GFGLL+  A V   +   W++V + + CV    K N      ++   +  +   T  C   +N I++LEHV+    IE+  RGDL ++LTS   T +VLL +R RDT+ N    + F+S   WGENP G W   I D+     S +    G ++   L  HGT++
Sbjct:  121 FNDPMWNQQW-YLQDTRMTATLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDH---DPF-PRY--DLINENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLD-GIVTDAIEASLIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISINSASQQGLSPWYAEKCSSTLATSYSSGDYTDQR---------ITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPSTWSSVPEKKECV---VKDNDFEPRALKANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPNGFKNWDFMSVHTWGENPIGTWTLRIADM-----SGRIQNEGRIVTWKLILHGTSS 596          
BLAST of P/Homo B domain-containing protein vs. TrEMBL
Match: A0A267G4F6 (P/Homo B domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002511g2 PE=4 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 6.562e-109
Identity = 259/687 (37.70%), Postives = 370/687 (53.86%), Query Frame = 3
Query:  126 LIWFLSTLVAYA------DENLGHNEYAVEM--DMDALEANLDLSANNIEVIRKVSVLGNVYHLKHVHNC--NHA--RCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKPSSEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDP--RGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIP-----NPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIE-HPCRGDLIISLTSPTNTKSVLLKQRVRDTNN--ANITFSFLSQMNWGENPRGKWHFDIVD 2120
            L W L+ +++ A       E L  + +A+E+  + D   A      +N +++     LGNVYHL+H   C  NH   +C  + + ++I  + +HP + R   QV  +VE++              LD       +++  + L + +D  +D   + S   D                 K+R     + +ED K Y++ +++RH  L     NDP  +  W  +N GQ   +NPGLD+NL   +    +G G+VVSV+DDG+D  + ++ KN+DP AS D N+       P   GP  + +      HGT CA  I   +NN  CG+GVAFNA LGGIR+L   +VTDLLEAYA+ HNNQYI +YS SWGP+D G+      +Y  KA+++G  +GR G+GS+++ A+GNGG N D+CG DGFVN+P+TIAV A NI GR P Y E C+AI ++A VGG  T    +    D  +    +NG CF+   GTSAATPL+S C+ALAL+AN  L WRD+QHL + S R+P     +P    WQ+N AG  VSH  GFGLLDC   V  AQ W  V     C   K    K  ++ + K   + F + GC  T   ++ LEHV +   ++    RG + I L SP  T+S LL  R +D +N       +FL+ +NW ENP G+W   I D
Sbjct:   10 LPWLLACILSCAICVYNCQEQL-TDHFALELLDNSDISVAKEIAKKHNFDLLHHAQQLGNVYHLQHRSACKSNHTANQCATDGA-ALIRSMLSHPRVLRSIHQVAEDVEKR-------------HLD-------IKEFLRNLADGVDDKSDDSSEESRAID-----------------KRR-----EEIEDAKIYKKALSRRHLDL---IVNDPHFNLQWYLHNTGQLQGINPGLDLNLLPAWNRGFTGSGIVVSVVDDGLDPSNPDL-KNYDPLASADFNNLTRKEGIPIRSGPLTMEQT-----HGTACAGEIGALANNSFCGIGVAFNAKLGGIRILD-GVVTDLLEAYAILHNNQYISVYSCSWGPRDNGLVMDMPKFYTSKALQLGVSKGRGGKGSLFVMASGNGGKNADNCGADGFVNNPHTIAVGALNIFGRTPYYGESCSAIHVSAPVGGPHTP---NSKLPDYLVTTTMVNGGCFKEMSGTSAATPLVSSCVALALQANPELSWRDVQHLLSRSARLPSSGKGDPKIQSWQVNGAGHYVSHHAGFGLLDCAKLVFTAQTWPGVTDQIDCRDAKPYRGK-FRVPSRKPLTLPFDSRGCNGT---LKRLEHVLVTLTMQGMAMRGAVEIWLKSPAGTESRLLGMRPKDKDNRVGIKNQTFLTLLNWDENPAGRWLLQIWD 635          
BLAST of P/Homo B domain-containing protein vs. TrEMBL
Match: A0A267GWN3 (P/Homo B domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006257g1 PE=4 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 1.486e-108
Identity = 248/641 (38.69%), Postives = 352/641 (54.91%), Query Frame = 3
Query:  240 NNIEVIRKVSVLGNVYHLKHVHNC--NHA--RCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKPSSEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDP--RGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEA-----VWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIE-HPCRGDLIISLTSPTNTKSVLLKQRVRDTNN--ANITFSFLSQMNWGENPRGKWHFDIVD 2120
            +N +++     LGNVYHL+H   C  NH   +C  + + ++I+ + +HP + R   QV  +VE++              LD       +++  + L + +D  +D   + S   D                 K+R     + +ED K Y++ +++RH  L     NDP  +  W  +N GQ   +NPGLD+NL   +    +G G+VVSV+DDG+D  + ++ KN+DP AS D N+       P   GP  + +      HGT CA  I   +NN  CG+GVAFNA LGGIR+L   +VTDLLEAYA+ HNNQYI +YS SWGP+D G+      +Y  KA+++G  +GR G+GS+++ A+GNGG N D+CG DGFVN+P+TIAV A NI GR P Y E C+AI ++A VGG  T    +    D  +    +NG CF+   GTSAATPL+S C+ALAL+AN  L WRD+QHL + S R+P+  +       WQ+N AG  VSH  GFGLLDC   V  AQ W  V     C   K    K  ++ + K   + F + GC  T   ++ LEHV +   ++    RG + I L SP  T+S LL  R +D +N       +FL+ +NW ENP G+W   I D
Sbjct:   55 HNFDLLHHAQQLGNVYHLQHRSACKSNHTANQCATDGA-ALIQSMLSHPRVLRSIHQVAEDVEKR-------------HLD-------IKEFLRNLADGVDDKSDDSSEESRAID-----------------KRR-----EEIEDAKIYKKALSRRHLDL---IVNDPHFNLQWYLHNTGQLQGINPGLDLNLLPAWNRGFTGSGIVVSVVDDGLDPSNPDL-KNYDPLASADFNNLTRKEGIPIRSGPLTMEQT-----HGTACAGEIGALANNSFCGIGVAFNAKLGGIRILD-GVVTDLLEAYAILHNNQYISVYSCSWGPRDNGLVMDMPKFYTSKALQLGVSKGRGGKGSLFVMASGNGGKNADNCGADGFVNNPHTIAVGALNIFGRTPYYGESCSAIHVSAPVGGPHTP---NSKLPDYLVTTTMVNGGCFKEMSGTSAATPLVSSCVALALQANPELSWRDVQHLLSRSARLPSSGKGDLKIQSWQVNGAGHYVSHHAGFGLLDCAKLVFTAQTWPGVTDQIDCRDAKPYRGK-FRVPSRKPLTLPFDSRGCNGT---LKRLEHVLVTLTMQGMAMRGAVEIWLKSPAGTESRLLGMRPKDKDNRVGIKNQTFLTLLNWDENPAGRWLLQIWD 635          
BLAST of P/Homo B domain-containing protein vs. TrEMBL
Match: A0A267G4G7 (P/Homo B domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002511g1 PE=4 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 1.533e-108
Identity = 249/641 (38.85%), Postives = 351/641 (54.76%), Query Frame = 3
Query:  240 NNIEVIRKVSVLGNVYHLKHVHNC--NHA--RCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKPSSEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDP--RGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIP-----NPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIE-HPCRGDLIISLTSPTNTKSVLLKQRVRDTNN--ANITFSFLSQMNWGENPRGKWHFDIVD 2120
            +N +++     LGNVYHL+H   C  NH   +C  + + ++I+ + +HP + R   QV  +VE++              LD       + +  + L + +D  +D   + S   D                 K+R     + +ED K Y++ +++RH  L     NDP  +  W  +N GQ   +NPGLD+NL   +    +G G+VVSV+DDG+D  + ++ KN+DP AS D N+       P   GP  + +      HGT CA  I   +NN  CG+GVAFNA LGGIR+L   +VTDLLEAYA+ HNNQYI +YS SWGP+D G+      +Y  KA+++G  +GR G+GS+++ A+GNGG N D+CG DGFVN+P+TIAV A NI GR P Y E C+AI ++A VGG  T    +    D  +    +NG CF+   GTSAATPL+S C+ALAL+AN  L WRD+QHL + S R+P     +P    WQ+N AG  VSH  GFGLLDC   V  AQ W  V     C   K    K  ++ + K   + F + GC  T   ++ LEHV +   ++    RG + I L SP  T+S LL  R +D +N       +FL+ +NW ENP G+W   I D
Sbjct:   55 HNFDLLHHAQQLGNVYHLQHRSACKSNHTANQCATDGA-ALIQSMLSHPRVLRSIHQVAEDVEKR-------------HLD-------INEFLRNLADGVDDKSDDSSEESRAID-----------------KRR-----EEIEDAKIYKKALSRRHLDL---IVNDPHFNLQWYLHNTGQLQGINPGLDLNLLPAWNRGFTGSGIVVSVVDDGLDPSNPDL-KNYDPLASADFNNLTRKEGIPIRSGPLTMEQT-----HGTACAGEIGALANNSFCGIGVAFNAKLGGIRILD-GVVTDLLEAYAILHNNQYISVYSCSWGPRDNGLVMDMPKFYTSKALQLGVSKGRGGKGSLFVMASGNGGKNADNCGADGFVNNPHTIAVGALNIFGRTPYYGESCSAIHVSAPVGGPHTP---NSKLPDYLVTTTMVNGGCFKEMSGTSAATPLVSSCVALALQANPELSWRDVQHLLSRSARLPSSGKGDPKIQSWQVNGAGHHVSHHAGFGLLDCAKLVFTAQTWPGVTDQIDCRDAKPYRGK-FRVPSRKPLTLPFDSRGCNGT---LKRLEHVLVTLTMQGMAMRGAVEIWLKSPAGTESRLLGMRPKDKDNRVGIKNQTFLTLLNWDENPAGRWLLQIWD 635          
BLAST of P/Homo B domain-containing protein vs. TrEMBL
Match: A0A1S3HG99 (neuroendocrine convertase 2-like OS=Lingula unguis OX=7574 GN=LOC106155046 PE=3 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 6.512e-97
Identity = 244/681 (35.83%), Postives = 360/681 (52.86%), Query Frame = 3
Query:  276 GNVYHLKHVHNCNHARCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKS-ENSELEYFY----DDHELD---SDTQKKVLEDVEKELVNDLDADTDMEKKPSSEFDIY--ATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLND------PRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEEC-AAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGT----TNLDSAR-HKNKDLIETYF 2252
            G+VYH   VH+    R KR A+D   ++L +H  ++ VE+QV L  +++     ELE           +D   SD +K+ + D+EKE    L A  D E +  +   +Y    ++  + +K     ++ Y     T E+D  ++  +    ++     F DP     WQ +N  Q      G+++N+   +K   +G+G VV ++DDG+  +H ++ KN+DP AS D N       PR+ VS              N HGT CA  IA E+NN  CG+G+AF+A +GG+R+L    VTD LEA A      Y+DIYS SWGP+D G        Y Q A++ GT +GR GRG+IY++A GNGG   D CG DG+V+S YT++V + N +G    + E C + +++  + G +      +R      +V   I+G C E F GTS+A PL +GC+ALAL+AN  + WRD+QHL   + RIPN  E  W++N AG   + ++GFG+LDC   V  AQ W  VG    CV    K NK  KI +     +T  T+ C NT+N I  LEHV ++ ++    RGD+ ++L SP  T+S LL  R  D +   I F+F++  NWGENPRG W   + D+   G        G +    L  HGT        SAR HK++D +++ F
Sbjct:   72 GDVYHF--VHDEIEKRTKR-AADKHRDLLLSHLQVNHVEQQVHLIRDKRDFTPKELEEVLVATIKREAIDNTHSDIEKRRI-DLEKE---KLTARKDRETEEDTRDIVYDKQNELEIETYKDRSVFERHY-----TEENDMAFKDGI-PSPDTEDDMNFIDPLYRDQWQLHN-SQIAGGKKGMNLNVVAAWKKGFTGKGTVVCILDDGVQHEHPDLKKNYDPEASSDFNGNDDDPTPRDDVS--------------NSHGTRCAGEIASEANNSFCGVGIAFDAKIGGVRLLD-GKVTDKLEAKAAIFKMTYVDIYSASWGPRDNGKVMEKPGRYTQAALKEGTSKGRHGRGNIYVWATGNGGHMGDDCGADGYVSSIYTLSVGSINQYGLSTYFMEFCPSTLAVVYSGGKHDPKDRHEREHPILKVVTTDIDGGCTENFQGTSSAAPLCAGCVALALQANQNMTWRDVQHLVVETARIPNFKEPGWEVNGAGKHTNEKFGFGVLDCGKMVEVAQTWKNVGPQHTCVSPMQKENK--KIDSKSTISMTMSTSACQNTENRIDHLEHVEVYVRLNTSRRGDIQLTLISPAGTRSELLSLRPYDDSKKGIDFTFMTVRNWGENPRGTWTLVVKDIPLNGRENT----GEITYWQLILHGTDAKAERGRSARPHKDEDEMQSAF 717          
BLAST of P/Homo B domain-containing protein vs. TrEMBL
Match: A0A1S3NW77 (PC3-like endoprotease variant B OS=Salmo salar OX=8030 GN=LOC106581764 PE=3 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 1.374e-92
Identity = 209/553 (37.79%), Postives = 304/553 (54.97%), Query Frame = 3
Query:  669 EYRRLVNQRHESLG-------SFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVD----LGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIHLEQPKKSFI 2291
            + R L ++R +SL        S  FNDP     W+ +N+GQ+   +   D+N+  V+  NI+G GVVVS+IDDG+D  + ++ +NF+  AS DL     +  DP   R       +NGHGT CA  +A E+NN  CG+G+AFNA +GGIR+L    VTD +EA +LT NN +ID+Y   WGP+D G + A      QKA+ +GT++GR G+GSI+++A+GNGG  NDHCG DG+VNS Y+IA+ A    G+   + E C A+      G    +T        P +  + +   C   F GTS+A P+ +G +AL LEAN  L WRD+QHL  ++ ++P+P E  W +N AG  +  RYGFG+LD    V+ A  +  V   R C   +   + I  + +G +  V  Q+  C  TD E+  LEHV++   +   CRGDL I+L SP  T S+LL  R  D + A +  ++ +S  +WGE+P G W   + D    +G C         G LL V L  +GT N   + H    +  T       E+P +SF+
Sbjct:  158 QQRELPSRRQDSLKTEDQLGHSLTFNDPLWPMQWELFNHGQYSSSH--FDLNVMPVWSRNITGNGVVVSIIDDGVDHTNMDLKRNFEAFASFDLRGSHGLSHDPMPLR-----DEENGHGTRCAGEVAMEANNSYCGVGIAFNARIGGIRLLD-GTVTDSMEATSLTFNNDFIDVYVCCWGPRDDGQEMAGPGTLTQKALRLGTQKGRGGKGSIFVWASGNGGLVNDHCGADGYVNSVYSIAIGAVTHMGKPAFFGEPCPAVMAVTLTGASLGNTL-------PLVTVSNLGDGCVTHFAGTSSAAPIAAGILALVLEANPDLTWRDVQHLIAMTAKVPDPKEPGWSVNGAGYHIHDRYGFGVLDAGLMVQQALQFQAVAPHRKCT-QEVTLDPIRILPSGGEVSVNIQSADCLGTDTEVNTLEHVQVKVSLSSVCRGDLSIALVSPAGTVSLLLATRSNDASAAGMRNWTLMSVQSWGEHPHGVWTLKVTDNKGTVGRCVRVSSEEAVGALLSVTLLLYGTYNPHRSLHVCCCIKTT-------EEPLQSFL 687          
BLAST of P/Homo B domain-containing protein vs. Ensembl Cavefish
Match: pcsk5b (proprotein convertase subtilisin/kexin type 5 [Source:NCBI gene;Acc:103025246])

HSP 1 Score: 297.745 bits (761), Expect = 4.754e-87
Identity = 203/503 (40.36%), Postives = 287/503 (57.06%), Query Frame = 3
Query:  711 SFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN----DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCA-NTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            S  FND +   +W  Y +   +  N   DMN+   +K   +G+ VVV+++DDGI+  H ++V+N+D  AS D+N    DP         PRY   V+ +N HGT CA  +A  +NN  C +G+A+NA +GG+RML  + VTD++EA +L+ + Q+IDIYS SWGP D G          ++A E G R GRKGRGSI+++A+GNGG + DHC  DG+ NS YTI++++T   GRKP Y EECA+   T     YS+  ++DR      ++   +  +C +   GTSA+ P+ +G IALALEAN  L WRD+QH+   + R  +     W+ N AG  VSH YGFGL+D  A V+ A+ W  V    +CV    K  +I  IR     R  ++ TGC  N +N +  LEHV +   I HP RGDL I+LTSP+ TKS LL  R+ D +      + F++   WGE   G W  +I D      S+K+   G L E  L  +GT+
Sbjct:  129 SIFFNDAKWSSMW--YIHCNDNIHNCQSDMNIVGAWKRGYTGKDVVVTILDDGIERNHPDLVQNYDNQASYDVNGNDLDPM--------PRY--DVSNENKHGTRCAGEVAASANNSHCTVGIAYNAKIGGVRMLDGD-VTDMVEAKSLSLHPQHIDIYSASWGPDDDGKTVDGPAALARQAFENGIRLGRKGRGSIFVWASGNGGRSRDHCSCDGYTNSIYTISISSTAESGRKPWYLEECASTLTTT----YSSGENYDRK-----IITTDLRQRCTDSHTGTSASAPMAAGIIALALEANTLLTWRDVQHIIVKTSRAGHLSAPDWKTNAAGYNVSHLYGFGLMDAEAMVKEAERWKPVPPQHICVENADK--QIRTIRPEHVVRSVYKATGCTDNANNHVIYLEHVVVRITITHPRRGDLSINLTSPSGTKSQLLANRLFDHSMEGFKNWEFMTTHCWGEKAAGDWILEINDTPSQLRSQKTP--GKLKEWSLVLYGTS 605          
BLAST of P/Homo B domain-containing protein vs. Ensembl Cavefish
Match: pcsk5b (proprotein convertase subtilisin/kexin type 5 [Source:NCBI gene;Acc:103025246])

HSP 1 Score: 294.664 bits (753), Expect = 1.031e-83
Identity = 203/503 (40.36%), Postives = 287/503 (57.06%), Query Frame = 3
Query:  711 SFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLN----DPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCA-NTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            S  FND +   +W  Y +   +  N   DMN+   +K   +G+ VVV+++DDGI+  H ++V+N+D  AS D+N    DP         PRY   V+ +N HGT CA  +A  +NN  C +G+A+NA +GG+RML  + VTD++EA +L+ + Q+IDIYS SWGP D G          ++A E G R GRKGRGSI+++A+GNGG + DHC  DG+ NS YTI++++T   GRKP Y EECA+   T     YS+  ++DR      ++   +  +C +   GTSA+ P+ +G IALALEAN  L WRD+QH+   + R  +     W+ N AG  VSH YGFGL+D  A V+ A+ W  V    +CV    K  +I  IR     R  ++ TGC  N +N +  LEHV +   I HP RGDL I+LTSP+ TKS LL  R+ D +      + F++   WGE   G W  +I D      S+K+   G L E  L  +GT+
Sbjct:  129 SIFFNDAKWSSMW--YIHCNDNIHNCQSDMNIVGAWKRGYTGKDVVVTILDDGIERNHPDLVQNYDNQASYDVNGNDLDPM--------PRY--DVSNENKHGTRCAGEVAASANNSHCTVGIAYNAKIGGVRMLDGD-VTDMVEAKSLSLHPQHIDIYSASWGPDDDGKTVDGPAALARQAFENGIRLGRKGRGSIFVWASGNGGRSRDHCSCDGYTNSIYTISISSTAESGRKPWYLEECASTLTTT----YSSGENYDRK-----IITTDLRQRCTDSHTGTSASAPMAAGIIALALEANTLLTWRDVQHIIVKTSRAGHLSAPDWKTNAAGYNVSHLYGFGLMDAEAMVKEAERWKPVPPQHICVENADK--QIRTIRPEHVVRSVYKATGCTDNANNHVIYLEHVVVRITITHPRRGDLSINLTSPSGTKSQLLANRLFDHSMEGFKNWEFMTTHCWGEKAAGDWILEINDTPSQLRSQKTP--GKLKEWSLVLYGTS 605          
BLAST of P/Homo B domain-containing protein vs. Ensembl Cavefish
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:103033370])

HSP 1 Score: 277.715 bits (709), Expect = 4.597e-82
Identity = 194/544 (35.66%), Postives = 290/544 (53.31%), Query Frame = 3
Query:  618 TNKKRYGMNQKTMEDDKEYRRLVNQR---HESLG-------SFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDL--NDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAV--WQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFS---FLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGT 2198
            T +KR   +++ +E D+  + ++ Q     +  G           NDP   K W   N GQ D   PGLD+N+   +K   +G+GV ++++DDGID  H ++  N++  AS D   NDP         PRY       N HGT CA  ++  SNN +CG+GVA+N+ + GIRML    +TD++EA +++H  Q IDIYS SWGP D G           +AM  G  +GR G+GSIY++A+   GG+ D C  DG+ +S +TI++ +    GR   Y E C++   +    G   + +   ++ D       + G C  R  GTSAA P  +G  ALALEAN  L WRD+QHL  ++ +    ++ V  W+ N  G+  +H +G+G+LD    V+ AQ W TV +   CV G  +  ++ KI++G+K  ++  T  C   +N ++ LEHV+    +    RGDL I++TSP  TKS+LL +R RD  +A + F    F++   WGE+PRG W      L E G    + + G L E  L  HGT
Sbjct:   79 TRRKRSLRHRQRLEKDRRVKNVIAQEGFDRQKRGYRDINDIDVSMNDPLFSKQWYLINTGQADGT-PGLDLNVAEAWKMGYTGKGVTIAIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPY------PRYTDDWF--NSHGTRCAGEVSAVSNNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWAS-GDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTD-------LYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLTVLTSKRNKLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKLAQDWKTVPERFHCVAGSVQ--EMHKIQSGEKLSLSISTDACQGKENFVRYLEHVQAVVTVNASRRGDLNINMTSPMGTKSILLSRRPRDA-DAKVGFDKWPFMTTHTWGEDPRGTW------LLEVGFQGDAPQSGMLKEWTLMLHGT 596          
BLAST of P/Homo B domain-containing protein vs. Ensembl Cavefish
Match: pcsk5a (proprotein convertase subtilisin/kexin type 5a [Source:ZFIN;Acc:ZDB-GENE-060531-130])

HSP 1 Score: 281.952 bits (720), Expect = 2.367e-81
Identity = 204/516 (39.53%), Postives = 291/516 (56.40%), Query Frame = 3
Query:  684 VNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGC-ANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRD-TNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHK 2225
             +Q H +L    FNDP+   +W    Y   D  N   DMN+  V++   +G GVVVS++DDG++  H ++ +N+D  AS D+N      SDP  PRY      +N HGT CA ++A  +NN +C +G+A+NA +GG+RML  +M TD++EA +L+   QYIDIYS+SWGP D G          + A+E G R+GRKGRGSI+++A+GNGG   DHC  DG+ NS +TI++ +T   GRKP Y EEC++   T    G S             +V   +  +C +   GTSA+ P+ +G IAL LEAN  L WRD+QH+   + R  +     WQ N AG  VSH YGFGL+D  A V+ A+ W  V    VC     ++ ++  I   K  R+ ++++GC A     +  +EHV I   I HP RGDL I+LTSP  TKS LL  R  D + +  + + F++   WGE   G W  +I D     S K++   G L+E  L F+GT++    RH+
Sbjct:  113 ASQTHSTL----FNDPKWSSMW----YIHCDH-NCLTDMNIKAVWRRGYTGNGVVVSILDDGVERLHPDLKQNYDARASHDVNGND---SDPT-PRY--DATNENKHGTRCAGVVAAAANNSLCMVGIAYNARIGGVRMLDGDM-TDMVEAQSLSLRQQYIDIYSSSWGPDDDGKTVDGPGPLARLALENGIRKGRKGRGSIFVWASGNGGQRKDHCSCDGYTNSIFTISLGSTTQSGRKPWYLEECSSTLATTYSSGESQGLG---------IVTTDLRQRCTDEHSGTSASAPIAAGIIALTLEANPLLTWRDVQHIIVKTSRRGHLSAPDWQSNGAGYDVSHLYGFGLMDAEAMVKEAETWREVPTQHVCEERTVQNARV--ISPEKVLRLLYKSSGCSAQRTQHVAYVEHVIIRVTITHPRRGDLSIALTSPAGTKSQLLALRPNDHSTDGFVKWEFMTTHCWGEKAAGDWILEIRDS---PSLKRNTRPGKLMEWALVFYGTSSHPYQRHE 598          
BLAST of P/Homo B domain-containing protein vs. Ensembl Cavefish
Match: pcsk5a (proprotein convertase subtilisin/kexin type 5a [Source:ZFIN;Acc:ZDB-GENE-060531-130])

HSP 1 Score: 281.567 bits (719), Expect = 4.514e-80
Identity = 204/516 (39.53%), Postives = 291/516 (56.40%), Query Frame = 3
Query:  684 VNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGC-ANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRD-TNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHK 2225
             +Q H +L    FNDP+   +W    Y   D  N   DMN+  V++   +G GVVVS++DDG++  H ++ +N+D  AS D+N      SDP  PRY      +N HGT CA ++A  +NN +C +G+A+NA +GG+RML  +M TD++EA +L+   QYIDIYS+SWGP D G          + A+E G R+GRKGRGSI+++A+GNGG   DHC  DG+ NS +TI++ +T   GRKP Y EEC++   T    G S             +V   +  +C +   GTSA+ P+ +G IAL LEAN  L WRD+QH+   + R  +     WQ N AG  VSH YGFGL+D  A V+ A+ W  V    VC     ++ ++  I   K  R+ ++++GC A     +  +EHV I   I HP RGDL I+LTSP  TKS LL  R  D + +  + + F++   WGE   G W  +I D     S K++   G L+E  L F+GT++    RH+
Sbjct:  113 ASQTHSTL----FNDPKWSSMW----YIHCDH-NCLTDMNIKAVWRRGYTGNGVVVSILDDGVERLHPDLKQNYDARASHDVNGND---SDPT-PRY--DATNENKHGTRCAGVVAAAANNSLCMVGIAYNARIGGVRMLDGDM-TDMVEAQSLSLRQQYIDIYSSSWGPDDDGKTVDGPGPLARLALENGIRKGRKGRGSIFVWASGNGGQRKDHCSCDGYTNSIFTISLGSTTQSGRKPWYLEECSSTLATTYSSGESQGLG---------IVTTDLRQRCTDEHSGTSASAPIAAGIIALTLEANPLLTWRDVQHIIVKTSRRGHLSAPDWQSNGAGYDVSHLYGFGLMDAEAMVKEAETWREVPTQHVCEERTVQNARV--ISPEKVLRLLYKSSGCSAQRTQHVAYVEHVIIRVTITHPRRGDLSIALTSPAGTKSQLLALRPNDHSTDGFVKWEFMTTHCWGEKAAGDWILEIRDS---PSLKRNTRPGKLMEWALVFYGTSSHPYQRHE 598          
BLAST of P/Homo B domain-containing protein vs. Ensembl Sea Lamprey
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:ZFIN;Acc:ZDB-GENE-090608-1])

HSP 1 Score: 90.5077 bits (223), Expect = 9.266e-20
Identity = 89/333 (26.73%), Postives = 149/333 (44.74%), Query Frame = 3
Query: 1263 EGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-----------PNPYEAVWQLNTA-----GILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITF---SFLSQMNWGENPRGKWHFDI--VDLGECGSSKKSAERGHLLEVVLEFHGT 2198
            +GR G+GS+Y++A+G+GG  +D      + +S +TI++ +    GR   Y E C++   +    G   D +   ++ D       + G C  R  GTSAA P  +G  ALA+EA      + ++ L   S  +           P     + +  T         V+   GF L  C  +    Q    +   R           +  +    +  +T  T  C    + ++ LEHV++   +    RGDL ++LTSP  T+S+LL +R RD+ ++ + F    F++   WGE+PRG+W  ++   D  E  ++  +A  G L E  L  HGT
Sbjct:    1 QGRGGKGSVYVWASGDGGSYDDCNCDG-YASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKKDPEAGVATTD-------LYGNCTLRHSGTSAAAPEAAGVFALAIEA------KGVEWLHNTSASVSLLPHSRSQSHPETAPCIARRTTTSDANRAFFVTKSRGF-LGICHDFHLQKQPTTHLTAFR--------GEDVCAVPGQGRLVLTVDTDACEGRADHVRYLEHVQVVVTVNATRRGDLTLNLTSPMGTRSLLLGRRPRDS-DSRVGFHRWPFMTTHTWGEDPRGRWTLEVGFADGAEGPAAAAAARSGVLSEWTLMLHGT 309          
BLAST of P/Homo B domain-containing protein vs. Ensembl Sea Lamprey
Match: pcsk7 (proprotein convertase subtilisin/kexin type 7 [Source:ZFIN;Acc:ZDB-GENE-030131-7293])

HSP 1 Score: 85.5001 bits (210), Expect = 1.477e-18
Identity = 86/227 (37.89%), Postives = 124/227 (54.63%), Query Frame = 3
Query:  711 SFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNG-----HGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAV 1376
            S  FNDP+  K W      Q +   PG+D+N+  V++  ++G+GVVV+V+DDG++    ++  N+    S DL D      DPR         P  G     HGT CA  IA  +NN +CG+G A+++ + GIR+L    +TD +EA A   + Q   IYS SWGP D G          Q A++ G   GR+G G+I++ A+GNGG   D+C  DG+ NS YTI +
Sbjct:   74 SLPFNDPKFPKQWHL----QRNTHTPGMDLNVTGVWERGVTGKGVVVAVVDDGVEHTLPDLQSNYCAEGSYDLTDGDQ---DPR---------PGTGDQESRHGTRCAGEIAAVANNSLCGVGAAYDSRVAGIRLLD-GPLTDHMEATAFNTHYQLNHIYSCSWGPDDDGKTVDGPHVLGQSALQRGVVGGRRGFGTIFVVASGNGGRYQDNCNYDGYANSIYTITI 283          
BLAST of P/Homo B domain-containing protein vs. Ensembl Sea Lamprey
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:ZFIN;Acc:ZDB-GENE-090608-1])

HSP 1 Score: 67.3958 bits (163), Expect = 3.597e-12
Identity = 41/117 (35.04%), Postives = 66/117 (56.41%), Query Frame = 3
Query: 1863 VTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITF---SFLSQMNWGENPRGKWHFDI--VDLGECGSSKKSAERGHLLEVVLEFHGT 2198
            +T  T  C    + ++ LEHV++   +    RGDL ++LTSP  T+S+LL +R RD+ ++ + F    F++   WGE+PRG+W  ++   D  E  ++  +A  G L E  L  HGT
Sbjct:  217 LTVDTDACEGRADHVRYLEHVQVVVTVNATRRGDLTLNLTSPMGTRSLLLGRRPRDS-DSRVGFHRWPFMTTHTWGEDPRGRWTLEVGFADGAEGPAAAAAARSGVLSEWTLMLHGT 332          

HSP 2 Score: 50.447 bits (119), Expect = 9.176e-7
Identity = 38/116 (32.76%), Postives = 62/116 (53.45%), Query Frame = 3
Query: 1263 EGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANN 1610
            +GR G+GS+Y++A+G+GG  +D      + +S +TI++ +    GR   Y E C++   +    G   D +   ++ D       + G C  R  GTSAA P  +G  ALA+EAN+
Sbjct:    1 QGRGGKGSVYVWASGDGGSYDDCNCDG-YASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKKDPEAGVATTD-------LYGNCTLRHSGTSAAAPEAAGVFALAIEANH 108          
BLAST of P/Homo B domain-containing protein vs. Ensembl Yeast
Match: KEX2 (Kexin, a subtilisin-like protease (proprotein convertase); a calcium-dependent serine protease involved in the activation of proproteins of the secretory pathway [Source:SGD;Acc:S000005182])

HSP 1 Score: 199.134 bits (505), Expect = 8.774e-54
Identity = 166/502 (33.07%), Postives = 246/502 (49.00%), Query Frame = 3
Query:  699 ESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISG-RIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVR--------NAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANIT-FSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLE 2174
            E+      NDP  ++ W   N        PG D+N+ +++  NI+G GVV +++DDG+D +++++  NF    S D ND  N+   P+ PR        + HGT CA  IA +  N  CG+GV +NA + GIR+LS ++ T+  EA +L +     DIYS SWGP D G      +  V+KA+  G  EGR  +G+IY+FA+GNGG   D+C  DG+ NS Y+I + A +     P Y+E C+A+    AV   S   ++  SS         ING+C     GTSAA PL +G   L LEAN  L WRD+Q+L  +S   +    +  W+ +  G   SHRYGFG +D    +         NAQ W  +  L V     +    +  + T  +  +          D   + +EHV +   I+   RG   + L SP    S L   R RD ++     ++F+S  +WGEN  G W   +          K+ E GH ++
Sbjct:  126 EAEDKLSINDPLFERQWHLVN-----PSFPGSDINVLDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNL---PK-PRL-----SDDYHGTRCAGEIAAKKGNNFCGVGVGYNAKISGIRILSGDITTED-EAASLIYGLDVNDIYSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNSIYSITIGAIDHKDLHPPYSEGCSAV---MAVTYSSGSGEYIHSS--------DINGRCSNSHGGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSILSAVGLEKNADGDWRDSAMGKKYSHRYGFGKIDAHKLIEMSKTWENVNAQTWFYLPTLYVSQSTNSTEETLESVITISEKSL---------QDANFKRIEHVTVTVDIDTEIRGTTTVDLISPAGIISNLGVVRPRDVSSEGFKDWTFMSVAHWGENGVGDWKIKV----------KTTENGHRID 582          
BLAST of P/Homo B domain-containing protein vs. Ensembl Nematostella
Match: EDO38851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBU0])

HSP 1 Score: 299.671 bits (766), Expect = 9.412e-91
Identity = 199/513 (38.79%), Postives = 290/513 (56.53%), Query Frame = 3
Query:  600 VHKKSFTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFKF----NDPQVDKLWQYYNYGQFDEVNP-GLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLK-QRVRDTNNANITFSFLSQMNWGENPRGKWHFDIVD 2120
            VHK     ++   +++KT    +E   L  QR   L   +     +DP+    W  +N GQ     P G+D+++   +  NI+GRGVVVS++DDG+D  H ++  NFD  AS D ND   +  DPR PR      P N HGT CA  +A  +NN+VCG+GVA+NAN+GG+RML     TD+LE  +L+  + YIDIYSN WGPKD G          Q+A+  G  +GR GRG+IY++A GNGG  +D C  DG+  S YTI++     HG    YTE C++       GG   + + ++      +V   ++ KC E F GTS+A PL +G IAL LEAN  L WRD+QHL   + ++ +P +  W  N AG   +H++GFG LD  A V+ A+ W +V   R+C G  + + +  +I TG    +T  T  C+ TD  +  LEHV +    +H  RGD+ I L SP+ T++ +L  +R  D+ N    ++F++  NWGENP+G+W  ++ D
Sbjct:   45 VHKPGNRARRELHVHEKTRLLMQEDEVLWAQRQHVLARTRKYIVPHDPKFHDQWYLFNDGQ--STGPAGVDIDVVPAWNRNITGRGVVVSILDDGVDHTHPDLRDNFDQKASYDFND---MDPDPR-PR---DSDPDNCHGTRCAGEVAA-ANNDVCGVGVAYNANIGGVRMLD-GQATDVLEGSSLSFQSAYIDIYSNCWGPKDDGKTFGKPGKLAQEALMQGALKGRGGRGNIYVWATGNGGLTDDDCNCDGYTTSIYTISIGCIGDHGLSAYYTELCSSTLGVTFNGGSHREREENK------MVTTDLHHKCTEEFKGTSSAAPLAAGMIALVLEANPNLSWRDVQHLVVETAQVTSPVDEGWMKNGAGYHFNHKFGFGRLDADAMVKRAKTWKSVAPQRICHGPSSSTQQ--EIPTGGTLSITIDTIACSGTDKMLTKLEHVTLTVSFQHRRRGDVSIDLFSPSGTRNEMLSTRRYDDSKNGLHDWTFMTVHNWGENPKGEWVMNVTD 538          
BLAST of P/Homo B domain-containing protein vs. Ensembl Nematostella
Match: EDO47748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT1])

HSP 1 Score: 291.197 bits (744), Expect = 7.461e-88
Identity = 206/534 (38.58%), Postives = 295/534 (55.24%), Query Frame = 3
Query:  645 QKTMEDDKEYRRLVNQRHESLGSF-KFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFT-ISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANIT-FSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNK 2231
            ++  E  +E R   + R  + G   +F DP  D  W    Y      +  LD+++  V+K  ISG+GVVV+++DDGI+  H +++KN+DP AS D+ND  N   DP  PRY      +N HGT CA  +A E+NN  CG+GVAFNA +GG+RML    VTD +EA +L+ N QYIDIYS SWGP D G            A   G ++GR G GSI+++A+GNGG + D C  DG+ +S YT+++++ + HG  P Y+E C++   T    G   +           +V   ++  C ER  GTSA+ PL +G  ALALE N  L WRD+QH+    S  +P  ++  W  N   ++V+ ++GFGLL     V   N   + TV + R C G   +  K+ K    K   +    TGC+ T +EI+ LEHV++   +++  RGDL+I LTSP  TKS LL  R  D++N   + + F++  +WGE+PRG W  +I DLG+       A  G L E  L  HGT   D   H+ K
Sbjct:  110 EQQHEKVREKRGFYHDRMVARGIVPRFKDPLWDAQW----YLDDKRKDTDLDIHVIPVWKKGISGKGVVVTILDDGIEHNHTDLIKNYDPNASWDVNDGDN---DPF-PRY--DPTNENKHGTRCAGEVAAEANNTKCGVGVAFNARIGGVRMLD-GRVTDKVEAESLSLNPQYIDIYSASWGPSDDGATVEGPGTLATAAFLNGIQKGRGGLGSIFVWASGNGGRHGDSCNCDGYTDSIYTLSISSASDHGESPWYSESCSSTLATTFSSGAHGEKR---------IVTTDLHNTCTERHTGTSASAPLAAGIFALALEVNPKLTWRDMQHIVVHTSNHLPLKHDQDWSKNGIDLMVNRKFGFGLLVAEKIVDMANPATYVTVPEKRFCRGQINQDAKVFKWD--KPLTIQLPATGCSGTGDEIRYLEHVQLMVSLDYVRRGDLVIYLTSPMGTKSCLLSPRKEDSSNEGFSKWPFMTTHSWGEDPRGTWTLEIKDLGD-----NKANHGTLREWQLILHGTK--DKPAHQQK 614          
BLAST of P/Homo B domain-containing protein vs. Ensembl Nematostella
Match: EDO38852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBU1])

HSP 1 Score: 286.96 bits (733), Expect = 3.468e-86
Identity = 190/503 (37.77%), Postives = 276/503 (54.87%), Query Frame = 3
Query:  726 DPQVDKLWQYYNYGQFDEVNP-GLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVD--LGECGSSKKSAERGHLLEVVLEFHGTTNLDSARH 2222
            DP   ++W   N GQ     P G+D+N+  V+K  I+GRGVVV+V+DDG+D  H ++  N++P AS D ND      DP  PR I    P N HGT CA  IA  +N+ +CG GVA+NA +GG+RML     TD LEA +L   NQ  D+YSN WGPKD G           KA++ G  +GR G+G+I+++A GNGG  +D C  DG+  S YT+++     HG    YTE C++       GG   + + ++      ++   + GKC E+F GTS+A PL +G +AL LE N  L WRD+QH+   + ++ +P +  W+ N AG+  +H++GFG LD  A V  +++W  V   R C G  + +     I  G    +   T GC  T  EI  LEHV +     H  RGD+ + LTSP+ TK+ +L  R  D +   +  +SF++   WGENPRG W  +++D  L E G            + V+   GT +LD+++ 
Sbjct:   92 DPMFTEMWYLMNTGQTG--GPVGVDINVIPVWKRGITGRGVVVTVLDDGMDHNHPDLKPNYEPCASHDFNDND---QDP-APRDID---PDNCHGTRCAGEIAAVANDSICGAGVAYNAKIGGVRMLD-GKATDALEACSLGFANQVTDVYSNCWGPKDDGKTFGKPGPLAAKALKSGAEKGRGGKGNIFVWATGNGGLTDDDCNCDGYTTSIYTVSIGCIGDHGLSAYYTELCSSTLAVTFNGGAHREKEENK------MITTDLKGKCTEQFKGTSSAAPLAAGMVALMLEQNPSLTWRDVQHIIVHTAKMTSPVDDGWRTNGAGLHFNHKFGFGRLDADAMVEKSRVWKNVPVQRTCTGASSVTGDEKDIPVGGSLDIQIPTGGCMGTIAEINHLEHVVLTVSFIHRRRGDVSLLLTSPSGTKNEMLSTRRYDDSKEGLDKWSFMTVHCWGENPRGFWKLNVIDNPLNEIG------------DRVVNGFGTLHLDTSKQ 566          
BLAST of P/Homo B domain-containing protein vs. Ensembl Nematostella
Match: EDO40864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S624])

HSP 1 Score: 272.322 bits (695), Expect = 1.717e-81
Identity = 182/471 (38.64%), Postives = 258/471 (54.78%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSV--DPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVC-VGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVD 2120
            +NDP +   W   ++G+ + V    DM + + + A+      +V  + D       + +K++DP ASL+LN   N   D  G   I R  P   HGT CA  I  +SNN  CG+GVA + NLG IRML    VT + E +A +HN QY+DIYS SWGPKD G   A  +   +KA+E G + GR G+GS+Y++A+GNGG ++D C  DG+ +S YTIAV + +  G    Y E+C   S  A V  YS D+D  R+ +  +  LV    +  C E F GTSAA PL +G +AL L+AN  L WRD+QHL T S       +  W+ N AG LVS+++GFGLL+      NA  W  V   + C + G      +  I+  K+  +  +T GC  ++N I+ LEHV+    + H  RG L I + SP  T S LL  R  D + + I  + F++   WGE+P+G+W   I D
Sbjct:   93 YNDPMLQDQWYLKSFGR-NGVPMNNDMKVMDAW-ADGYTGKGIVVTVMDDGLDHTNDDLKHYDPKASLNLNGATN--GDTTGKDPIPRDEPDQYHGTKCAGEIGAKSNNGFCGVGVAPDVNLGAIRMLD-GKVTGMTEGHAFSHNPQYVDIYSASWGPKDNGKTLAGPSSLGRKALEHGVKRGRNGKGSLYVWASGNGGASSDDCNCDGYTSSIYTIAVGSVSAAGGSTFYDEKCP--STLAVV--YSGDSDLSRTKLGGNHKLVTTGPHNSCVEHFGGTSAAAPLAAGVVALTLQANPELTWRDMQHLITRSTDQLQKDDPSWKRNAAGFLVSNKFGFGLLNAHKLTTNALKWKRVPDQKRCEIEGPIPP--VPLIKRNKEVVLRVRTNGCEGSENAIKRLEHVQAIITLAHRKRGVLSIDIRSPRKTASRLLSTRPLDESASGIKNWPFMTVQMWGEDPKGEWEVVIRD 552          
BLAST of P/Homo B domain-containing protein vs. Ensembl Nematostella
Match: EDO33327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI6])

HSP 1 Score: 271.937 bits (694), Expect = 5.209e-81
Identity = 197/486 (40.53%), Postives = 276/486 (56.79%), Query Frame = 3
Query:  684 VNQRHESLGSFK----FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDP-CLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVC-VGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKWHFDIVD 2120
             +Q+  SLG  +    ++DP   K W   N GQF+ +  G D+ +  V++   +G+GVVVS++DDG+D  H ++ +N+DP AS D ND  +   DP    +   V P N HGT C   +  +++N++CG GVA N +LGGIRML   + TD LEA AL++  QYIDIYSN WGPKD G          QKA+E G ++GR G+GSIY++A GNGG  +D C  DG+ +S YTI++ A + +G    Y E+C++       G      D  RS  +   LV   ++ +C + F GTS+A PL +G  AL LEAN  L WRD+QHL   S    +P +  W++N AGI  +H++GFG L  T  V NA  W  V    +C V G     +I+K R GK   +   T GCA T N ++ LEHV+    ++H  RG L I + SP  T S LL  R  DT+ N    +SF++   WGE+P G+W   I D
Sbjct:   91 ASQQQRSLGHERRKRFYHDPMFAKQWYLQNTGQFN-IPEGNDIGVLPVWERGFTGKGVVVSILDDGLDHTHPDLKRNYDPKASWDFNDKDD---DP----FPNDVDPYNAHGTKCGGEVGAQADNDICGAGVAPNVSLGGIRMLD-GVATDALEANALSYKPQYIDIYSNCWGPKDDGKTFGRPGKLGQKALEDGAKKGRGGKGSIYVWATGNGGLVDDDCNCDGYTSSIYTISIGAISSYGLSTYYDEQCSSTMAVTFTG------DSHRSGEEEYTLVTTNLHHECTDTFRGTSSAAPLAAGIFALVLEANPNLTWRDLQHLVVHSAEKTSPLDQGWKVNGAGIHFNHKFGFGRLHATRLVANALKWKHVPAQHICQVEGFQARKEIIK-RNGKLI-LKVHTDGCAGTKNAVKRLEHVQATVSLKHNRRGALSIEIRSPMGTTSQLLSTRKYDTSTNGLKDWSFMTVHFWGEDPAGEWEVIITD 559          
BLAST of P/Homo B domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000002776.2 (proprotein convertase subtilisin/kexin type 4-like [Source:NCBI gene;Acc:101161187])

HSP 1 Score: 290.812 bits (743), Expect = 1.167e-88
Identity = 174/444 (39.19%), Postives = 247/444 (55.63%), Query Frame = 3
Query:  885 KEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAI-SITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVD----LGECGSSKKSAERGHLLEVVLEFHGT 2198
            K++ KNF+  AS DL     +  DP   +       +N HGT CA  ++ E+NN  CG+G+AFNA +GGIR+L    VTD +EA ALT+N  +IDIY  SWGP+D G +     Y  ++A+ +GTR+GR G+GSI+++AAGNGG  +DHCG DG++NS YTI++ A    G+   + E CA + ++T    GY    D+      P +        C   F GTS+A P+ +G +ALALE N  L WRD+QHL   + +IP+P E  W +N AG  V HRYGFG+LD    V+ A ++  VG+ R C   +   +       G    +   + GC  T NEI +LEHV++   +   CRGDL +SL SP  T S+LL  R  D + A +  ++ ++   WGE PRG W   + D    +  C    +    G LL   L  +GT
Sbjct:   27 KDLRKNFEVFASFDLLASHGLSHDPMPIK-----DEENSHGTRCAGEVSMEANNSYCGVGIAFNAKIGGIRLLD-GPVTDAMEASALTYNIHFIDIYVCSWGPRDNGAEMDGPHYLTEQALRLGTRKGRVGKGSIFVWAAGNGGMYDDHCGADGYINSIYTISIGAITQSGKPAFFGEPCAGVMAVTPTGSGYG---DYQ-----PLVTLTTTGDGCVTHFPGTSSAAPIAAGILALALEVNPALTWRDVQHLIANTAKIPDPEEPGWSINAAGYHVHHRYGFGVLDAGLLVQQAALFQKVGRQRTCT-QEVAFDSPRIFSPGDSVTLRIHSDGCQWTSNEISSLEHVQVRLGVSARCRGDLSVSLESPGGTVSMLLDSRPNDASTAGLKNWTLMTVHCWGEQPRGHWTLKVTDHKGEVWRCTRQHEEEPAGALLTATLILYGT 455          
BLAST of P/Homo B domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044769.1 (proprotein convertase subtilisin/kexin type 4-like [Source:NCBI gene;Acc:101161187])

HSP 1 Score: 292.738 bits (748), Expect = 2.502e-88
Identity = 174/444 (39.19%), Postives = 247/444 (55.63%), Query Frame = 3
Query:  885 KEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAI-SITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDIVD----LGECGSSKKSAERGHLLEVVLEFHGT 2198
            K++ KNF+  AS DL     +  DP     +     +N HGT CA  ++ E+NN  CG+G+AFNA +GGIR+L    VTD +EA ALT+N  +IDIY  SWGP+D G +     Y  ++A+ +GTR+GR G+GSI+++AAGNGG  +DHCG DG++NS YTI++ A    G+   + E CA + ++T    GY    D+      P +        C   F GTS+A P+ +G +ALALE N  L WRD+QHL   + +IP+P E  W +N AG  V HRYGFG+LD    V+ A ++  VG+ R C   +   +       G    +   + GC  T NEI +LEHV++   +   CRGDL +SL SP  T S+LL  R  D + A +  ++ ++   WGE PRG W   + D    +  C    +    G LL   L  +GT
Sbjct:   27 KDLRKNFEVFASFDLLASHGLSHDP-----MPIKDEENSHGTRCAGEVSMEANNSYCGVGIAFNAKIGGIRLLD-GPVTDAMEASALTYNIHFIDIYVCSWGPRDNGAEMDGPHYLTEQALRLGTRKGRVGKGSIFVWAAGNGGMYDDHCGADGYINSIYTISIGAITQSGKPAFFGEPCAGVMAVTPTGSGYG---DYQ-----PLVTLTTTGDGCVTHFPGTSSAAPIAAGILALALEVNPALTWRDVQHLIANTAKIPDPEEPGWSINAAGYHVHHRYGFGVLDAGLLVQQAALFQKVGRQRTCT-QEVAFDSPRIFSPGDSVTLRIHSDGCQWTSNEISSLEHVQVRLGVSARCRGDLSVSLESPGGTVSMLLDSRPNDASTAGLKNWTLMTVHCWGEQPRGHWTLKVTDHKGEVWRCTRQHEEEPAGALLTATLILYGT 455          
BLAST of P/Homo B domain-containing protein vs. Ensembl Medaka
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:NCBI gene;Acc:101174018])

HSP 1 Score: 286.96 bits (733), Expect = 2.474e-84
Identity = 187/499 (37.47%), Postives = 288/499 (57.72%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRG-PRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRI-PNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV--RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTN-NANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTT 2201
            F+DP  ++ W Y    +     P LD+++  V++  I+G+GVV++V+DDG++  H +I  N+D AAS D ND     +DP   PRY +    +N HGT CA  IA +++N  CG+GVA+N+ +GGIRML   +VTD +EA ++  N  ++DIYS SWGP D G          QKA E G ++GR G+GSI+++A+GNGG   D+C  DG+ +S YTI++++ +  G  P Y E+C++   TA   G  TD           + +A ++ +C +   GTSA+ PL +G  ALALE N  L WRD+QH+   +    P      W+ N AG++V+ R+GFGLL+  A V   +   W  V + ++C+  +  S +  +++   +  +   T  CA  +N +++LEH+++   IE+  RGDL I+LTSP  T +VLL +R RDT+ N    + F+S   WGE+P G W   I D     +S +   +G +L   L  HGT+
Sbjct:  127 FDDPMWNQQW-YLQDTRTSSSLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYSNYDAAASYDFND-----NDPDPFPRYDS--TNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGGIRMLD-GIVTDAIEASSIGFNPNHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGDYTDQR---------ITSADLHNECTQTHTGTSASAPLAAGIFALALEQNPNLTWRDLQHIIVWTSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPATWKHVPEKKICI-VRDDSFQPRELKAAGEITIEIPTKACAGQENAVRSLEHLQVEASIEYTRRGDLHITLTSPAGTTTVLLAERERDTSANGFRNWDFMSVHTWGEDPAGTWTLKITD-----TSGRMENKGRILSWKLILHGTS 601          
BLAST of P/Homo B domain-containing protein vs. Ensembl Medaka
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:100049241])

HSP 1 Score: 266.929 bits (681), Expect = 9.424e-79
Identity = 182/500 (36.40%), Postives = 269/500 (53.80%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDL--NDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAV--WQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFS---FLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGT 2198
             +DP   K W   N GQ D   PGLD+N+   ++   +G+GV ++++DDGID  H ++  N++  AS D   NDP         PRY       N HGT CA  ++  +NN +CG+GVA+N+ + GIRML    +TD++EA +++H  Q IDIYS SWGP D G           +AM  G  +GR G+GSIY++A+   GG+ D C  DG+ +S +TI++ +    GR   Y E C++   +    G   + +   ++ D       + G C  R  GTSAA P  +G  ALALEAN  L WRD+QHL  ++ +    ++ V  W+ N  G+  +H +G+G+LD    V+ A+ W TV +   CV G  +     KI++G K  +   T  C   DN ++ LEHV+    +    RGDL I++TSP  TKS+LL +R RD +++ + F    F++   WGE+PRG W        E G      +RG L E  +  HGT
Sbjct:   63 MSDPLFTKQWYLINTGQADGT-PGLDLNVAEAWQLGYTGKGVTIAIMDDGIDYLHPDLASNYNADASYDFSSNDPFPF------PRYTDDWF--NSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQTIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWAS-GDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTD-------LYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLSVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMAKEWKTVPERFHCVAGSIQEPH--KIQSGNKLVLAINTEACEGKDNFVRYLEHVQAVVTVNATRRGDLNINMTSPMGTKSLLLSRRPRD-DDSKVGFDKWPFMTTHTWGEDPRGTWVL------EVGFQGDQPQRGVLKEWTVMLHGT 536          
BLAST of P/Homo B domain-containing protein vs. Ensembl Medaka
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:100049241])

HSP 1 Score: 267.314 bits (682), Expect = 2.965e-78
Identity = 182/500 (36.40%), Postives = 269/500 (53.80%), Query Frame = 3
Query:  720 FNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDL--NDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAV--WQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFS---FLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGT 2198
             +DP   K W   N GQ D   PGLD+N+   ++   +G+GV ++++DDGID  H ++  N++  AS D   NDP         PRY       N HGT CA  ++  +NN +CG+GVA+N+ + GIRML    +TD++EA +++H  Q IDIYS SWGP D G           +AM  G  +GR G+GSIY++A+   GG+ D C  DG+ +S +TI++ +    GR   Y E C++   +    G   + +   ++ D       + G C  R  GTSAA P  +G  ALALEAN  L WRD+QHL  ++ +    ++ V  W+ N  G+  +H +G+G+LD    V+ A+ W TV +   CV G  +     KI++G K  +   T  C   DN ++ LEHV+    +    RGDL I++TSP  TKS+LL +R RD +++ + F    F++   WGE+PRG W        E G      +RG L E  +  HGT
Sbjct:  123 MSDPLFTKQWYLINTGQADGT-PGLDLNVAEAWQLGYTGKGVTIAIMDDGIDYLHPDLASNYNADASYDFSSNDPFPF------PRYTDDWF--NSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQTIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWAS-GDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTD-------LYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLSVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMAKEWKTVPERFHCVAGSIQEPH--KIQSGNKLVLAINTEACEGKDNFVRYLEHVQAVVTVNATRRGDLNINMTSPMGTKSLLLSRRPRD-DDSKVGFDKWPFMTTHTWGEDPRGTWVL------EVGFQGDQPQRGVLKEWTVMLHGT 596          
BLAST of P/Homo B domain-containing protein vs. Planmine SMEST
Match: SMESG000074551.1 (SMESG000074551.1)

HSP 1 Score: 1584.7 bits (4102), Expect = 0.000e+0
Identity = 794/810 (98.02%), Postives = 798/810 (98.52%), Query Frame = 3
Query:  108 MEFYYLLIWFLSTLVAYADENLGHNEYAVEMDMDALEANLDLSANNIEVIRKVSVLGNVYHLKHVHNCNHARCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKPSSEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLV-----AAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYIYFNQQRKYFIQLHPINQKVIQYRDRIRKLKSPEQWETISKEINELNYIIPDDEKNYLNNLLHNRKHNTL 2522
            MEFYYLLIWFLSTLVAYADENLGHNEYAVEMDMDALEANLDLSANNIEVIRKVS LGNVYHLKHVHNCNHARCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKP+SEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYR LVNQRHE LGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANISGRGVVVSVIDDGIDTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCG GVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAGNGGGNNDHCGGDGFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCL+       +INGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYIYFN+QR YFIQLHPINQKVIQYRDRIRKLKSPEQWETISKEINELNYIIPDDEKNYLNNLLHNRKHNTL
Sbjct:    1 MEFYYLLIWFLSTLVAYADENLGHNEYAVEMDMDALEANLDLSANNIEVIRKVSALGNVYHLKHVHNCNHARCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKPASEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYRGLVNQRHEGLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANISGRGVVVSVIDDGIDTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGFGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAGNGGGNNDHCGGDGFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLIVLILGGGKINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYIYFNRQRNYFIQLHPINQKVIQYRDRIRKLKSPEQWETISKEINELNYIIPDDEKNYLNNLLHNRKHNTL 810          
BLAST of P/Homo B domain-containing protein vs. Planmine SMEST
Match: SMESG000074551.1 (SMESG000074551.1)

HSP 1 Score: 1521.52 bits (3938), Expect = 0.000e+0
Identity = 764/780 (97.95%), Postives = 768/780 (98.46%), Query Frame = 3
Query:  198 MDMDALEANLDLSANNIEVIRKVSVLGNVYHLKHVHNCNHARCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKPSSEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLV-----AAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYIYFNQQRKYFIQLHPINQKVIQYRDRIRKLKSPEQWETISKEINELNYIIPDDEKNYLNNLLHNRKHNTL 2522
            MDMDALEANLDLSANNIEVIRKVS LGNVYHLKHVHNCNHARCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKP+SEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYR LVNQRHE LGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANISGRGVVVSVIDDGIDTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCG GVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAGNGGGNNDHCGGDGFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCL+       +INGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYIYFN+QR YFIQLHPINQKVIQYRDRIRKLKSPEQWETISKEINELNYIIPDDEKNYLNNLLHNRKHNTL
Sbjct:    1 MDMDALEANLDLSANNIEVIRKVSALGNVYHLKHVHNCNHARCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKPASEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYRGLVNQRHEGLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANISGRGVVVSVIDDGIDTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGFGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAGNGGGNNDHCGGDGFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLIVLILGGGKINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYIYFNRQRNYFIQLHPINQKVIQYRDRIRKLKSPEQWETISKEINELNYIIPDDEKNYLNNLLHNRKHNTL 780          
BLAST of P/Homo B domain-containing protein vs. Planmine SMEST
Match: SMESG000074551.1 (SMESG000074551.1)

HSP 1 Score: 1517.29 bits (3927), Expect = 0.000e+0
Identity = 762/778 (97.94%), Postives = 766/778 (98.46%), Query Frame = 3
Query:  204 MDALEANLDLSANNIEVIRKVSVLGNVYHLKHVHNCNHARCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKPSSEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLV-----AAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYIYFNQQRKYFIQLHPINQKVIQYRDRIRKLKSPEQWETISKEINELNYIIPDDEKNYLNNLLHNRKHNTL 2522
            MDALEANLDLSANNIEVIRKVS LGNVYHLKHVHNCNHARCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKP+SEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYR LVNQRHE LGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANISGRGVVVSVIDDGIDTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCG GVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAGNGGGNNDHCGGDGFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCL+       +INGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYIYFN+QR YFIQLHPINQKVIQYRDRIRKLKSPEQWETISKEINELNYIIPDDEKNYLNNLLHNRKHNTL
Sbjct:    1 MDALEANLDLSANNIEVIRKVSALGNVYHLKHVHNCNHARCKREASDSIIEILKNHPMIHRVEEQVDLEVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKPASEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYRGLVNQRHEGLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANISGRGVVVSVIDDGIDTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGFGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAGNGGGNNDHCGGDGFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLIVLILGGGKINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNLDSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYIYFNRQRNYFIQLHPINQKVIQYRDRIRKLKSPEQWETISKEINELNYIIPDDEKNYLNNLLHNRKHNTL 778          
BLAST of P/Homo B domain-containing protein vs. Planmine SMEST
Match: SMESG000049794.1 (SMESG000049794.1)

HSP 1 Score: 244.588 bits (623), Expect = 4.076e-70
Identity = 187/530 (35.28%), Postives = 282/530 (53.21%), Query Frame = 3
Query:  573 IYATKINPKVHKKSFTNKKRYGMNQKTMEDD-------KEYRRLVNQRHESLGSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDL----NDPRNVVSDPRGPRYITRVAPK---NGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCA-NTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANI-TFSFLSQMNWGENPRGKWHFDI 2114
            IY+ K + +V K+S      Y   Q  + DD       +++ ++  +RH        NDP+  K+W        +++N    MN+ + +K    G+ VVVS++DDGI+  H ++ +N+DP AS D+    N+P         PRYI+    K   N HGT CA  +A  +NN +CG+GVA+ AN+GGIRML    V+D +E+++L    Q+IDIYS SWGP+D G          + A E G  +GR G GSI+++A+GNGG N+D+C  DG+ NS +T+ V A +  G  P Y E+C++   T AV  YS+ +  +R+     ++   +N +C E+  GTSA+ P  +G  ALAL AN FL WRD+QHL  I+ R  N     W  N AG   SH +GFGL+D  A V  A  W TV +  +C          + ++      ++  T  C+ N+   ++ LEHV+    +    RG++ + L SP+ + S LL +R  D  +A    + F+S   WGE   G W   I
Sbjct:   60 IYSFK-HRRVSKRSIYPSNYY---QSNLSDDPRVIWLEQQFAKVRVKRH------IVNDPKWYKMWY------LNKMNKENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPE--------PRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLD-GEVSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSS---TLAVT-YSSGSMDERA-----IITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITARKANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKRRNDVASAGFHHWPFMSVHFWGEEAPGTWKLTI 555          
BLAST of P/Homo B domain-containing protein vs. Planmine SMEST
Match: SMESG000008070.1 (SMESG000008070.1)

HSP 1 Score: 243.817 bits (621), Expect = 9.274e-70
Identity = 171/500 (34.20%), Postives = 265/500 (53.00%), Query Frame = 3
Query:  726 DPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANXXXXXXXXXXXXXXXXTKHKEIVKNFDPAASLDL--NDPRNVVSDPRGPRYITRVAPKNGHGTLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNNQYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAXXXXXXXXXXXXXXFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGGYSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEANNFLGWRDIQHLFTISGRIPNPYEAV----WQLNTAGILVSHRYGFGLLDCTAYVRNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGC-ANTDNEIQALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNAN--ITFSFLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGT 2198
            DP   K W   N GQ D V   LD+N+ + +   I+G+GV  +++DDGID  H ++ KN++  +S D   NDP         PRY       N HGT CA  I+ E +N +CG+GVA+++ + G+RML    +TDL+EA A++++   IDIYS SWGP D G           +A+  G  +GRKG+GSIY++A+   GG  D C  DG+  S +TI++ +    G   +Y E C++   +    G +        S+D  +    + G+C     GTSAA P  +G  ALALEAN+ +GWRD+QHL  ++ +  + ++      W +N AG+  +H +G+G+LD    VR A+ W  V +   C+ G+   +K  +    K   +   T  C ++  + +  LEHV+    ++   RGD+ + LTSP  T S++L  R +D ++      + F++   WGENPRGKW   ++       +K    +G   E VL  HGT
Sbjct:  140 DPLFSKEWYIRNTGQADGVKD-LDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPF------PRYTDDWF--NSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-GDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAW------FSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQI--DKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVM-----FDTKDPLSQGIFSEWVLVLHGT 616          
The following BLAST results are available for this feature:
BLAST of P/Homo B domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCSK18.480e-8536.30proprotein convertase subtilisin/kexin type 1 [Sou... [more]
PCSK11.757e-8436.30proprotein convertase subtilisin/kexin type 1 [Sou... [more]
PCSK51.857e-8437.92proprotein convertase subtilisin/kexin type 5 [Sou... [more]
PCSK61.977e-8338.55proprotein convertase subtilisin/kexin type 6 [Sou... [more]
PCSK62.432e-8338.55proprotein convertase subtilisin/kexin type 6 [Sou... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kpc-13.599e-7735.80Furin-like protease kpc-1 [Source:UniProtKB/Swiss... [more]
kpc-13.599e-7735.80Furin-like protease kpc-1 [Source:UniProtKB/Swiss... [more]
bli-45.055e-7337.47Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;A... [more]
bli-45.055e-7337.47Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;A... [more]
bli-41.001e-7237.34Endoprotease bli-4 [Source:UniProtKB/Swiss-Prot;A... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fur21.378e-7137.80gene:FBgn0004598 transcript:FBtr0074262[more]
Fur21.378e-7137.80gene:FBgn0004598 transcript:FBtr0074267[more]
Fur21.378e-7137.80gene:FBgn0004598 transcript:FBtr0074266[more]
Fur21.378e-7137.80gene:FBgn0004598 transcript:FBtr0074264[more]
Fur21.576e-7137.80gene:FBgn0004598 transcript:FBtr0301301[more]
back to top
BLAST of P/Homo B domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcsk16.805e-8737.31proprotein convertase subtilisin/kexin type 1 [Sou... [more]
pcsk18.782e-8737.31proprotein convertase subtilisin/kexin type 1 [Sou... [more]
CR383678.12.593e-8439.02proprotein convertase subtilisin/kexin type 5a [So... [more]
pcsk5a7.708e-8439.02proprotein convertase subtilisin/kexin type 5a [So... [more]
pcsk5a5.393e-8239.02proprotein convertase subtilisin/kexin type 5a [So... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zar11.255e-8737.14zygote arrest 1 [Source:Xenbase;Acc:XB-GENE-942424... [more]
zar11.289e-8737.14zygote arrest 1 [Source:Xenbase;Acc:XB-GENE-942424... [more]
zar11.348e-8737.14zygote arrest 1 [Source:Xenbase;Acc:XB-GENE-942424... [more]
gdap1l11.625e-8537.43ganglioside induced differentiation associated pro... [more]
gdap1l14.434e-8537.66ganglioside induced differentiation associated pro... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcsk19.163e-8536.30proprotein convertase subtilisin/kexin type 1 [Sou... [more]
Pcsk56.583e-8337.92proprotein convertase subtilisin/kexin type 5 [Sou... [more]
Pcsk64.158e-8138.49proprotein convertase subtilisin/kexin type 6 [Sou... [more]
Pcsk64.849e-8138.42proprotein convertase subtilisin/kexin type 6 [Sou... [more]
Pcsk52.222e-8038.82proprotein convertase subtilisin/kexin type 5 [Sou... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63239|NEC1_MOUSE6.409e-8436.30Neuroendocrine convertase 1 OS=Mus musculus OX=100... [more]
sp|P63240|NEC1_MUSCO6.814e-8436.30Neuroendocrine convertase 1 OS=Mus cookii OX=10098... [more]
sp|P29120|NEC1_HUMAN8.439e-8436.30Neuroendocrine convertase 1 OS=Homo sapiens OX=960... [more]
sp|P28840|NEC1_RAT1.120e-8237.64Neuroendocrine convertase 1 OS=Rattus norvegicus O... [more]
sp|Q9GLR1|NEC1_BOVIN3.259e-8238.32Neuroendocrine convertase 1 OS=Bos taurus OX=9913 ... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G4F66.562e-10937.70P/Homo B domain-containing protein OS=Macrostomum ... [more]
A0A267GWN31.486e-10838.69P/Homo B domain-containing protein OS=Macrostomum ... [more]
A0A267G4G71.533e-10838.85P/Homo B domain-containing protein OS=Macrostomum ... [more]
A0A1S3HG996.512e-9735.83neuroendocrine convertase 2-like OS=Lingula unguis... [more]
A0A1S3NW771.374e-9237.79PC3-like endoprotease variant B OS=Salmo salar OX=... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcsk5b4.754e-8740.36proprotein convertase subtilisin/kexin type 5 [Sou... [more]
pcsk5b1.031e-8340.36proprotein convertase subtilisin/kexin type 5 [Sou... [more]
pcsk24.597e-8235.66proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk5a2.367e-8139.53proprotein convertase subtilisin/kexin type 5a [So... [more]
pcsk5a4.514e-8039.53proprotein convertase subtilisin/kexin type 5a [So... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pcsk29.266e-2026.73proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk71.477e-1837.89proprotein convertase subtilisin/kexin type 7 [Sou... [more]
pcsk23.597e-1235.04proprotein convertase subtilisin/kexin type 2 [Sou... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
KEX28.774e-5433.07Kexin, a subtilisin-like protease (proprotein conv... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO388519.412e-9138.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477487.461e-8838.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388523.468e-8637.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408641.717e-8138.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333275.209e-8140.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002776.21.167e-8839.19proprotein convertase subtilisin/kexin type 4-like... [more]
ENSORLT00000044769.12.502e-8839.19proprotein convertase subtilisin/kexin type 4-like... [more]
pcsk12.474e-8437.47proprotein convertase subtilisin/kexin type 1 [Sou... [more]
pcsk29.424e-7936.40proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk22.965e-7836.40proprotein convertase subtilisin/kexin type 2 [Sou... [more]
back to top
BLAST of P/Homo B domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074551.10.000e+098.02SMESG000074551.1[more]
SMESG000074551.10.000e+097.95SMESG000074551.1[more]
SMESG000074551.10.000e+097.94SMESG000074551.1[more]
SMESG000049794.14.076e-7035.28SMESG000049794.1[more]
SMESG000008070.19.274e-7034.20SMESG000008070.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001371 ID=SMED30001371|Name=P/Homo B domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2594bp
CGTAGGTTGAATGCTCAAATTTTGATTTTATATTTTCACTTTAACCTAAA
AATTAAAATTGAGACAAGAAAATCTCAACAGTGATTTGTTTGGGCCTATT
TTATTCAATGGAATTTTATTATTTGCTAATATGGTTTTTATCCACGCTTG
TTGCGTATGCAGATGAAAATCTTGGCCACAACGAGTATGCCGTTGAAATG
GACATGGACGCGTTGGAGGCTAATTTGGATTTGAGTGCCAATAACATAGA
AGTTATTAGAAAAGTAAGCGTATTGGGCAATGTTTACCACTTGAAGCATG
TCCATAATTGCAATCATGCTCGATGCAAAAGAGAAGCTTCTGATTCGATA
ATTGAAATATTAAAAAACCATCCAATGATCCACCGAGTGGAGGAACAAGT
CGACTTAGAAGTTGAACAGAAATCTGAAAATTCAGAGTTGGAATATTTCT
ATGATGATCATGAATTGGATTCTGATACTCAGAAGAAAGTTCTTGAAGAT
GTTGAAAAGGAACTTGTAAATGATCTTGATGCTGATACTGACATGGAGAA
AAAGCCATCTTCTGAATTTGATATATACGCGACAAAAATAAATCCTAAGG
TTCATAAGAAATCATTTACTAACAAAAAGCGTTACGGTATGAATCAAAAA
ACAATGGAGGACGATAAAGAATATCGAAGATTGGTTAATCAGCGACATGA
GAGTTTAGGAAGCTTTAAATTTAATGATCCCCAAGTTGATAAACTCTGGC
AATACTATAATTATGGTCAGTTTGATGAAGTGAATCCGGGTTTAGATATG
AATCTGTTTAACGTTTATAAAGCGAATATTTCTGGACGAGGAGTTGTCGT
TTCCGTCATTGATGATGGCATTGACACAAAACATAAAGAAATCGTTAAAA
ATTTTGATCCTGCAGCGTCTTTGGACCTGAATGATCCGCGTAATGTTGTG
TCTGATCCGCGGGGTCCCCGGTATATTACGAGAGTAGCGCCAAAAAATGG
CCATGGAACCCTATGTGCTAGTATAATTGCTGGAGAATCTAACAATGAAG
TATGCGGTCTCGGTGTGGCCTTCAATGCAAACTTAGGAGGAATCCGAATG
CTGTCCTTGAATATGGTCACCGACTTACTGGAAGCATACGCATTGACTCA
CAACAATCAGTATATTGATATTTACAGCAATTCTTGGGGCCCCAAAGACA
CTGGAATGAAAACGGCACCTGTGACATATTACGTTCAAAAGGCGATGGAG
ATTGGAACTCGAGAGGGCAGAAAAGGAAGGGGTTCAATTTATTTATTTGC
AGCTGGAAATGGAGGCGGAAATAATGACCATTGTGGAGGCGATGGTTTTG
TCAATTCTCCTTACACTATTGCCGTGACAGCAACAAATATCCATGGGCGT
AAGCCTGCCTACACCGAAGAATGCGCTGCTATTAGTATAACTGCAGCCGT
TGGCGGTTATTCAACTGATACTGATTTTGATAGAAGTTCTGTTGATCCAT
GCTTGGTGGCGGCACAAATTAACGGCAAATGTTTCGAACGGTTTGTTGGG
ACGTCTGCAGCTACGCCATTAATTTCGGGATGTATAGCCCTTGCTCTTGA
AGCAAATAATTTCTTAGGATGGAGGGACATTCAACATTTGTTTACCATTA
GTGGTCGTATTCCAAACCCATATGAAGCAGTATGGCAGTTAAATACTGCT
GGGATATTGGTCAGTCATCGCTATGGATTTGGTCTTTTAGATTGCACCGC
TTATGTTCGAAATGCTCAAATGTGGAATACTGTAGGCCAATTACGGGTCT
GTGTTGGAGGGAAAACAAAATCAAACAAAATATTAAAAATTAGAACTGGC
AAAAAAACTCGCGTGACTTTTCAGACTACTGGGTGTGCAAACACTGATAA
TGAAATTCAAGCCTTAGAACACGTCCGTATTCATACAAAAATTGAGCATC
CATGTCGAGGAGACCTAATAATAAGTCTTACCAGCCCAACAAATACAAAA
AGCGTTTTGCTAAAACAGCGAGTTCGTGATACAAATAACGCTAATATAAC
GTTTTCGTTTCTTTCACAAATGAATTGGGGTGAAAATCCCCGAGGAAAGT
GGCATTTCGATATTGTCGATCTCGGTGAATGTGGAAGCTCCAAGAAATCA
GCTGAAAGAGGACACCTACTTGAAGTAGTGTTAGAATTTCACGGAACAAC
AAATCTTGATAGTGCTAGACATAAAAACAAGGATTTAATTGAAACATACT
TCAAAAACATCCATTTAGAACAACCAAAAAAATCATTTATACTAAATGCT
AATCAAACGTATATTTACTTTAATCAACAGAGAAAATATTTTATTCAACT
GCATCCTATTAACCAAAAAGTTATTCAATACCGTGACAGAATCAGAAAAC
TAAAATCACCAGAGCAATGGGAAACTATTAGCAAAGAAATAAATGAATTA
AATTACATTATACCTGATGACGAGAAAAATTATTTAAATAATTTATTACA
TAACAGAAAGCATAATACATTGTGATTACAAAATAACATTTATTGTAACA
TACATTATATTCTTACAGAATAAATAATTTTTGATAAATATTAA
back to top

protein sequence of SMED30001371-orf-1

>SMED30001371-orf-1 ID=SMED30001371-orf-1|Name=SMED30001371-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=806bp
MEFYYLLIWFLSTLVAYADENLGHNEYAVEMDMDALEANLDLSANNIEVI
RKVSVLGNVYHLKHVHNCNHARCKREASDSIIEILKNHPMIHRVEEQVDL
EVEQKSENSELEYFYDDHELDSDTQKKVLEDVEKELVNDLDADTDMEKKP
SSEFDIYATKINPKVHKKSFTNKKRYGMNQKTMEDDKEYRRLVNQRHESL
GSFKFNDPQVDKLWQYYNYGQFDEVNPGLDMNLFNVYKANISGRGVVVSV
IDDGIDTKHKEIVKNFDPAASLDLNDPRNVVSDPRGPRYITRVAPKNGHG
TLCASIIAGESNNEVCGLGVAFNANLGGIRMLSLNMVTDLLEAYALTHNN
QYIDIYSNSWGPKDTGMKTAPVTYYVQKAMEIGTREGRKGRGSIYLFAAG
NGGGNNDHCGGDGFVNSPYTIAVTATNIHGRKPAYTEECAAISITAAVGG
YSTDTDFDRSSVDPCLVAAQINGKCFERFVGTSAATPLISGCIALALEAN
NFLGWRDIQHLFTISGRIPNPYEAVWQLNTAGILVSHRYGFGLLDCTAYV
RNAQMWNTVGQLRVCVGGKTKSNKILKIRTGKKTRVTFQTTGCANTDNEI
QALEHVRIHTKIEHPCRGDLIISLTSPTNTKSVLLKQRVRDTNNANITFS
FLSQMNWGENPRGKWHFDIVDLGECGSSKKSAERGHLLEVVLEFHGTTNL
DSARHKNKDLIETYFKNIHLEQPKKSFILNANQTYIYFNQQRKYFIQLHP
INQKVIQYRDRIRKLKSPEQWETISKEINELNYIIPDDEKNYLNNLLHNR
KHNTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR015500Peptidase_S8_subtilisin-rel
IPR000209Peptidase_S8/S53_dom
IPR002884P_dom
IPR008979Galactose-bd-like_sf
IPR032815S8_pro-domain
IPR022398Peptidase_S8_His-AS
IPR023827Peptidase_S8_Asp-AS
IPR023828Peptidase_S8_Ser-AS
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007565female pregnancy
GO:0033625positive regulation of integrin activation
GO:0034698response to gonadotropin
GO:0034699response to luteinizing hormone
GO:0036120cellular response to platelet-derived growth factor stimulus
GO:1904754positive regulation of vascular associated smooth muscle cell migration
GO:1905609positive regulation of smooth muscle cell-matrix adhesion
GO:1990874vascular smooth muscle cell proliferation
GO:2001046positive regulation of integrin-mediated signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0003674molecular_function
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005794Golgi apparatus
GO:0005797Golgi medial cisterna
GO:0005802trans-Golgi network
GO:0005886plasma membrane
GO:0012505endomembrane system
GO:0016020membrane
GO:0016021integral component of membrane
GO:0043204perikaryon
GO:1990635proximal dendrite