ADP-ribosylation factor 1

Overview
NameADP-ribosylation factor 1
Smed IDSMED30001367
Length (bp)1283
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADP-ribosylation factor 1 (SMED30001367) t-SNE clustered cells

Violin plots show distribution of expression levels for ADP-ribosylation factor 1 (SMED30001367) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADP-ribosylation factor 1 (SMED30001367) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADP-ribosylation factor 1 (SMED30001367) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001367

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30001367SMESG000031561.1 SMESG000018862.1 Contig8GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30001367SMESG000031561.1 SMESG000018862.1 Contig8GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30001367SMESG000067743.1 Contig8GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30001367SMESG000067743.1 Contig8GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30001367SMESG000067743.1 dd_Smed_v4_203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001367SMESG000067743.1 dd_Smed_v4_203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001367SMESG000067743.1 dd_Smed_v4_203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001367SMESG000067743.1 dd_Smed_v4_203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30001367SMESG000067743.1 dd_Smed_v4_203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001367SMESG000067743.1 dd_Smed_v4_203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001367SMESG000067743.1 Contig51258newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001367SMESG000067743.1 Contig51258uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30001367SMESG000067743.1 dd_Smed_v6_203_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001367SMESG000067743.1 dd_Smed_v6_203_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30001367SMESG000067743.1 dd_Smed_v6_203_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30001367SMESG000067743.1 dd_Smed_v6_203_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30001367SMESG000067743.1 dd_Smed_v6_203_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADP-ribosylation factor 1 vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 342.813 bits (878), Expect = 7.487e-118
Identity = 165/180 (91.67%), Postives = 172/180 (95.56%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  L+N+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 342.813 bits (878), Expect = 7.487e-118
Identity = 165/180 (91.67%), Postives = 172/180 (95.56%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  L+N+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 342.813 bits (878), Expect = 7.487e-118
Identity = 165/180 (91.67%), Postives = 172/180 (95.56%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  L+N+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 342.428 bits (877), Expect = 1.073e-117
Identity = 165/181 (91.16%), Postives = 171/181 (94.48%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+  +LL  L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWL+  LKN+ 
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 342.428 bits (877), Expect = 1.073e-117
Identity = 165/181 (91.16%), Postives = 171/181 (94.48%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+  +LL  L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWL+  LKN+ 
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 343.969 bits (881), Expect = 9.090e-119
Identity = 166/181 (91.71%), Postives = 169/181 (93.37%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+   L   LFGK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV EAREELMRML EDELRDAVLLVFANKQDLP AMN AE+TDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLS  LKNRS
Sbjct:    1 MGNVFGSLFKGLFGKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLKNRS 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 343.969 bits (881), Expect = 9.090e-119
Identity = 166/181 (91.71%), Postives = 169/181 (93.37%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+   L   LFGK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV EAREELMRML EDELRDAVLLVFANKQDLP AMN AE+TDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLS  LKNRS
Sbjct:    1 MGNVFGSLFKGLFGKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLKNRS 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 343.969 bits (881), Expect = 9.090e-119
Identity = 166/181 (91.71%), Postives = 169/181 (93.37%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+   L   LFGK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV EAREELMRML EDELRDAVLLVFANKQDLP AMN AE+TDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLS  LKNRS
Sbjct:    1 MGNVFGSLFKGLFGKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLKNRS 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Celegans
Match: arf-3 (ADP-Ribosylation Factor related; ADP-ribosylation factor related (20.5 kD) (Arf-3) [Source:UniProtKB/TrEMBL;Acc:G5EFK4])

HSP 1 Score: 320.087 bits (819), Expect = 2.531e-109
Identity = 151/177 (85.31%), Postives = 163/177 (92.09%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTL 647
            MG  +S L +RLFGK+++RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSND+ER+ E+REEL +MLNEDELRDA LLVFANKQDLPNAM  AE+TDKLGLH+LR+R WYIQATCAT G GLYEGLDWLS  L
Sbjct:    1 MGLTISSLFNRLFGKRQVRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDKERIEESREELHKMLNEDELRDATLLVFANKQDLPNAMTAAELTDKLGLHNLRSRQWYIQATCATQGHGLYEGLDWLSNQL 177          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Celegans
Match: arf-6 (ADP-Ribosylation Factor related [Source:UniProtKB/TrEMBL;Acc:Q9U2S4])

HSP 1 Score: 262.692 bits (670), Expect = 5.236e-87
Identity = 119/174 (68.39%), Postives = 148/174 (85.06%), Query Frame = 3
Query:  129 VSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLK 650
            +   L ++FGKKE+RILM+GLDAAGKTTILYKLKLG+ VTTIPT+GFNVETV YKNI F VWDVGGQDKIRPLWRHY+  TQ LIFV+D+ DR+RV+EAR EL R++N+ E+++A++LVFANKQDL +AM P EI DKLGL  +R+R+WY+Q +CA++GDGL+EGL WLS   K
Sbjct:    1 MGKFLSKIFGKKELRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYYTGTQALIFVMDAADRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAMKPHEIQDKLGLTRIRDRNWYVQPSCASTGDGLHEGLTWLSQNCK 174          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0332054)

HSP 1 Score: 342.428 bits (877), Expect = 4.189e-118
Identity = 164/182 (90.11%), Postives = 172/182 (94.51%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSK 662
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRER+ EAREELMRML EDELRDAVLL+FANKQDLPNAMN AEITDKLGLHSLRNR+WYIQATCATSGDGLYEGLDWLS  LKN ++
Sbjct:    1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNANR 182          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078573)

HSP 1 Score: 342.428 bits (877), Expect = 4.189e-118
Identity = 164/182 (90.11%), Postives = 172/182 (94.51%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSK 662
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRER+ EAREELMRML EDELRDAVLL+FANKQDLPNAMN AEITDKLGLHSLRNR+WYIQATCATSGDGLYEGLDWLS  LKN ++
Sbjct:    1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNANR 182          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299906)

HSP 1 Score: 342.428 bits (877), Expect = 4.189e-118
Identity = 164/182 (90.11%), Postives = 172/182 (94.51%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSK 662
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRER+ EAREELMRML EDELRDAVLL+FANKQDLPNAMN AEITDKLGLHSLRNR+WYIQATCATSGDGLYEGLDWLS  LKN ++
Sbjct:    1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNANR 182          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299907)

HSP 1 Score: 342.428 bits (877), Expect = 4.189e-118
Identity = 164/182 (90.11%), Postives = 172/182 (94.51%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSK 662
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRER+ EAREELMRML EDELRDAVLL+FANKQDLPNAMN AEITDKLGLHSLRNR+WYIQATCATSGDGLYEGLDWLS  LKN ++
Sbjct:    1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNANR 182          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078571)

HSP 1 Score: 342.428 bits (877), Expect = 4.189e-118
Identity = 164/182 (90.11%), Postives = 172/182 (94.51%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSK 662
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRER+ EAREELMRML EDELRDAVLL+FANKQDLPNAMN AEITDKLGLHSLRNR+WYIQATCATSGDGLYEGLDWLS  LKN ++
Sbjct:    1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNANR 182          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Zebrafish
Match: arf3b (ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GENE-030616-356])

HSP 1 Score: 342.428 bits (877), Expect = 6.826e-118
Identity = 165/181 (91.16%), Postives = 171/181 (94.48%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+  +LL  L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWL+  LKN+ 
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Zebrafish
Match: arf3b (ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GENE-030616-356])

HSP 1 Score: 342.428 bits (877), Expect = 6.826e-118
Identity = 165/181 (91.16%), Postives = 171/181 (94.48%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+  +LL  L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWL+  LKN+ 
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Zebrafish
Match: arf3a (ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GENE-040801-176])

HSP 1 Score: 341.658 bits (875), Expect = 1.127e-117
Identity = 164/181 (90.61%), Postives = 171/181 (94.48%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+  +LL  L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLL+FANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWL+  LKN+ 
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Zebrafish
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 340.887 bits (873), Expect = 2.367e-117
Identity = 165/179 (92.18%), Postives = 169/179 (94.41%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKN 653
            MGN+ + L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREEL RML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  LKN
Sbjct:    1 MGNMFAGLFKNLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKN 179          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Zebrafish
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 340.887 bits (873), Expect = 2.367e-117
Identity = 165/179 (92.18%), Postives = 169/179 (94.41%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKN 653
            MGN+ + L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREEL RML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  LKN
Sbjct:    1 MGNMFAGLFKNLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKN 179          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Xenopus
Match: arf3 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:100145191])

HSP 1 Score: 342.428 bits (877), Expect = 9.727e-118
Identity = 165/181 (91.16%), Postives = 171/181 (94.48%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+  +LL  L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWL+  LKN+ 
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Xenopus
Match: arf5 (ADP ribosylation factor 5 [Source:NCBI gene;Acc:394614])

HSP 1 Score: 342.043 bits (876), Expect = 1.379e-117
Identity = 165/181 (91.16%), Postives = 171/181 (94.48%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  L+N  
Sbjct:    1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNHK 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Xenopus
Match: fibp (fibroblast growth factor (acidic) intracellular binding protein [Source:Xenbase;Acc:XB-GENE-481175])

HSP 1 Score: 341.273 bits (874), Expect = 2.110e-117
Identity = 165/180 (91.67%), Postives = 171/180 (95.00%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREEL RML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  LKN+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKNQ 180          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:NCBI gene;Acc:595036])

HSP 1 Score: 319.701 bits (818), Expect = 7.808e-109
Identity = 152/180 (84.44%), Postives = 161/180 (89.44%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MG  +S L  RLFGKK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI FTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRER+ EA EEL +ML EDELRDAVLLVFANKQDLPNAM  +E+TDKLGL +LRNR+WY+QATCAT G GLYEGLDWLS  L  R
Sbjct:    1 MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMLQEDELRDAVLLVFANKQDLPNAMAISEMTDKLGLQNLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR 180          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Xenopus
Match: slc8a1 (solute carrier family 8 (sodium/calcium exchanger), member 1 [Source:Xenbase;Acc:XB-GENE-984129])

HSP 1 Score: 267.7 bits (683), Expect = 1.136e-87
Identity = 119/189 (62.96%), Postives = 156/189 (82.54%), Query Frame = 3
Query:   87 NKFTFN*FWKMGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKN 653
            N + +  +    +++  +L ++FG KEMRILM+GLDAAGKTTILYKLKLG+ VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGLIFVVD  DR+R++EAR+EL R++N+ E+RDA++L+FANKQDL +AM P EI +KLGL  +R+R+WY+Q +CA +G+GLYEGL WL++  K+
Sbjct:   41 NHYKYQLYGLRASIMGKMLSKVFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLADAMKPHEIQEKLGLTRIRDRNWYVQPSCANTGEGLYEGLMWLTSNYKS 229          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Mouse
Match: Arf1 (ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:MGI:99431])

HSP 1 Score: 342.813 bits (878), Expect = 5.140e-118
Identity = 165/180 (91.67%), Postives = 172/180 (95.56%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  L+N+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Mouse
Match: Arf1 (ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:MGI:99431])

HSP 1 Score: 342.813 bits (878), Expect = 5.140e-118
Identity = 165/180 (91.67%), Postives = 172/180 (95.56%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  L+N+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Mouse
Match: Arf3 (ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:MGI:99432])

HSP 1 Score: 342.428 bits (877), Expect = 7.367e-118
Identity = 165/181 (91.16%), Postives = 171/181 (94.48%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+  +LL  L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWL+  LKN+ 
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Mouse
Match: Arf2 (ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:MGI:99595])

HSP 1 Score: 339.347 bits (869), Expect = 1.090e-116
Identity = 164/180 (91.11%), Postives = 167/180 (92.78%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+   L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREEL RML EDELRDAVLLVF NKQDLPNAMN AEITDKLGLHSLR R+WYIQATCATSGDGLYEGLDWLS  LKN+
Sbjct:    1 MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKNQ 180          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Mouse
Match: Arf2 (ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:MGI:99595])

HSP 1 Score: 339.347 bits (869), Expect = 1.090e-116
Identity = 164/180 (91.11%), Postives = 167/180 (92.78%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+   L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREEL RML EDELRDAVLLVF NKQDLPNAMN AEITDKLGLHSLR R+WYIQATCATSGDGLYEGLDWLS  LKN+
Sbjct:    1 MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKNQ 180          
BLAST of ADP-ribosylation factor 1 vs. UniProt/SwissProt
Match: sp|P91924|ARF_DUGJA (ADP-ribosylation factor OS=Dugesia japonica OX=6161 PE=2 SV=3)

HSP 1 Score: 376.711 bits (966), Expect = 1.373e-130
Identity = 182/183 (99.45%), Postives = 183/183 (100.00%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK 665
            MGNLV+HLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK
Sbjct:    1 MGNLVTHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK 183          
BLAST of ADP-ribosylation factor 1 vs. UniProt/SwissProt
Match: sp|Q61LA8|ARF12_CAEBR (ADP-ribosylation factor 1-like 2 OS=Caenorhabditis briggsae OX=6238 GN=arf-1.2 PE=3 SV=3)

HSP 1 Score: 345.125 bits (884), Expect = 3.407e-118
Identity = 167/181 (92.27%), Postives = 169/181 (93.37%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+   L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV EAREELMRML EDELRDAVLLVFANKQDLP AMN AE+TDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLS  LKNRS
Sbjct:    1 MGNVFGSLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLKNRS 181          
BLAST of ADP-ribosylation factor 1 vs. UniProt/SwissProt
Match: sp|Q10943|ARF12_CAEEL (ADP-ribosylation factor 1-like 2 OS=Caenorhabditis elegans OX=6239 GN=arf-1.2 PE=2 SV=2)

HSP 1 Score: 343.969 bits (881), Expect = 1.156e-117
Identity = 166/181 (91.71%), Postives = 169/181 (93.37%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+   L   LFGK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV EAREELMRML EDELRDAVLLVFANKQDLP AMN AE+TDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLS  LKNRS
Sbjct:    1 MGNVFGSLFKGLFGKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLKNRS 181          
BLAST of ADP-ribosylation factor 1 vs. UniProt/SwissProt
Match: sp|P51643|ARF1_XENLA (ADP-ribosylation factor 1 OS=Xenopus laevis OX=8355 GN=arf1 PE=2 SV=2)

HSP 1 Score: 342.813 bits (878), Expect = 2.859e-117
Identity = 165/180 (91.67%), Postives = 172/180 (95.56%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  L+N+
Sbjct:    1 MGNMFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of ADP-ribosylation factor 1 vs. UniProt/SwissProt
Match: sp|P84079|ARF1_RAT (ADP-ribosylation factor 1 OS=Rattus norvegicus OX=10116 GN=Arf1 PE=1 SV=2)

HSP 1 Score: 342.813 bits (878), Expect = 3.595e-117
Identity = 165/180 (91.67%), Postives = 172/180 (95.56%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  L+N+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of ADP-ribosylation factor 1 vs. TrEMBL
Match: A0A4D5RLU2 (Putative gtp-binding adp-ribosylation factor-like protein arl1 (Fragment) OS=Ixodes scapularis OX=6945 PE=3 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 5.381e-116
Identity = 165/181 (91.16%), Postives = 173/181 (95.58%), Query Frame = 3
Query:  114 KMGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            KMGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRER+NEAREELMRML EDELRDAVLL+FANKQDLPNAMN AEITDKLGLHSLRNR+WYIQATCATSGDGLYEGLDWLS  L+N+
Sbjct:   10 KMGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERINEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 190          
BLAST of ADP-ribosylation factor 1 vs. TrEMBL
Match: A0A0R3RVR4 (Uncharacterized protein OS=Elaeophora elaphi OX=1147741 PE=3 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 9.882e-116
Identity = 166/181 (91.71%), Postives = 172/181 (95.03%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV EAREELMRML EDELRDAVLLVFANKQDLPNAMN AE+TDKLGLH+LRNR+WYIQATCATSGDGLYEGLDWLS  LKNRS
Sbjct:    1 MGNIFTNLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEVTDKLGLHTLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNRS 181          
BLAST of ADP-ribosylation factor 1 vs. TrEMBL
Match: F1KZX1 (ADP-ribosylation factor 1 OS=Ascaris suum OX=6253 PE=2 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 9.882e-116
Identity = 166/181 (91.71%), Postives = 172/181 (95.03%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV EAREELMRML EDELRDAVLLVFANKQDLPNAMN AE+TDKLGLH+LRNR+WYIQATCATSGDGLYEGLDWLS  LKNRS
Sbjct:    1 MGNIFTNLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEVTDKLGLHTLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNRS 181          
BLAST of ADP-ribosylation factor 1 vs. TrEMBL
Match: A0A238C2P4 (ADP-ribosylation factor family protein OS=Onchocerca flexuosa OX=387005 GN=X798_01272 PE=3 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 9.882e-116
Identity = 166/181 (91.71%), Postives = 172/181 (95.03%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV EAREELMRML EDELRDAVLLVFANKQDLPNAMN AE+TDKLGLH+LRNR+WYIQATCATSGDGLYEGLDWLS  LKNRS
Sbjct:    1 MGNIFTNLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEVTDKLGLHTLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNRS 181          
BLAST of ADP-ribosylation factor 1 vs. TrEMBL
Match: A0A0M3IIK1 (Uncharacterized protein OS=Ascaris lumbricoides OX=6252 PE=3 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 9.882e-116
Identity = 166/181 (91.71%), Postives = 172/181 (95.03%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV EAREELMRML EDELRDAVLLVFANKQDLPNAMN AE+TDKLGLH+LRNR+WYIQATCATSGDGLYEGLDWLS  LKNRS
Sbjct:    1 MGNIFTNLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEVTDKLGLHTLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNRS 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Cavefish
Match: arf2a (ADP-ribosylation factor 1-like [Source:NCBI gene;Acc:103045652])

HSP 1 Score: 340.887 bits (873), Expect = 2.006e-117
Identity = 165/179 (92.18%), Postives = 169/179 (94.41%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKN 653
            MGN+ + L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREEL RML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  LKN
Sbjct:    1 MGNMFAGLFKNLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKN 179          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Cavefish
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103047326])

HSP 1 Score: 340.502 bits (872), Expect = 2.495e-117
Identity = 163/180 (90.56%), Postives = 171/180 (95.00%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREEL RML EDELRDAVLL+FANKQDLPNAMN AEITDKLGLH+LR+R+WYIQATCATSGDGLYEGLDWLS  LKN+
Sbjct:    1 MGNVFANLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHALRHRNWYIQATCATSGDGLYEGLDWLSNQLKNQ 180          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Cavefish
Match: arf3a (ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GENE-040801-176])

HSP 1 Score: 342.428 bits (877), Expect = 2.506e-117
Identity = 165/180 (91.67%), Postives = 171/180 (95.00%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+  +LL  L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWL+  LKN+
Sbjct:   48 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK 227          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Cavefish
Match: arf1 (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103038497])

HSP 1 Score: 338.576 bits (867), Expect = 1.892e-116
Identity = 164/180 (91.11%), Postives = 172/180 (95.56%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+ ++L  + FGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELR+AVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  LKN+
Sbjct:    1 MGNIFANLF-KAFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELREAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKNQ 179          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Cavefish
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103047326])

HSP 1 Score: 331.257 bits (848), Expect = 1.149e-113
Identity = 159/169 (94.08%), Postives = 164/169 (97.04%), Query Frame = 3
Query:  150 LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREEL RML EDELRDAVLL+FANKQDLPNAMN AEITDKLGLH+LR+R+WYIQATCATSGDGLYEGLDWLS  LKN+
Sbjct:    5 LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHALRHRNWYIQATCATSGDGLYEGLDWLSNQLKNQ 173          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Sea Lamprey
Match: arf1 (ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GENE-010724-5])

HSP 1 Score: 338.576 bits (867), Expect = 3.086e-117
Identity = 167/180 (92.78%), Postives = 170/180 (94.44%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MG+L S   D L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWLS  LKNR
Sbjct:    1 MGSLFSVFKD-LLGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKNR 179          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 338.576 bits (867), Expect = 4.063e-117
Identity = 164/179 (91.62%), Postives = 167/179 (93.30%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKN 653
            MG   + L D L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELR+AVLLVFANKQDLPNAMN AEITDKLGLHSLR R+WYIQATCATSGDGLYEGLDWLS  LKN
Sbjct:    1 MGGFFTRLFDTLVGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRNAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKN 179          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 328.176 bits (840), Expect = 3.645e-113
Identity = 162/181 (89.50%), Postives = 168/181 (92.82%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+ ++L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQAT    GDGLYEGLDWLS  LKN+ 
Sbjct:    1 MGNMFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATPPV-GDGLYEGLDWLSNQLKNQK 180          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Sea Lamprey
Match: arf4a (ADP-ribosylation factor 4a [Source:ZFIN;Acc:ZDB-GENE-040801-109])

HSP 1 Score: 294.278 bits (752), Expect = 8.646e-100
Identity = 140/179 (78.21%), Postives = 152/179 (84.92%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKN 653
            MG  +S +L  L G K MRILMVGLDAAGKTTILYKLKLGEIVTTIPT  FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRER+ EA EEL +M+ ED+L+DA LLV ANKQDLPNAM   E+T+KLGLH LRNR+W++QATCA  G GL EGLDWLS  L N
Sbjct:    1 MGLAISRVLAALLGTKAMRILMVGLDAAGKTTILYKLKLGEIVTTIPTTRFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMMQEDDLKDAALLVLANKQDLPNAMAIGELTEKLGLHGLRNRAWFVQATCAPQGTGLCEGLDWLSNKLAN 179          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Sea Lamprey
Match: arf4a (ADP-ribosylation factor 4a [Source:ZFIN;Acc:ZDB-GENE-040801-109])

HSP 1 Score: 291.967 bits (746), Expect = 6.169e-99
Identity = 139/177 (78.53%), Postives = 151/177 (85.31%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTL 647
            MG  +S +L  L G K MRILMVGLDAAGKTTILYKLKLGEIVTTIPT  FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRER+ EA EEL +M+ ED+L+DA LLV ANKQDLPNAM   E+T+KLGLH LRNR+W++QATCA  G GL EGLDWLS  L
Sbjct:    1 MGLAISRVLAALLGTKAMRILMVGLDAAGKTTILYKLKLGEIVTTIPTTRFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMMQEDDLKDAALLVLANKQDLPNAMAIGELTEKLGLHGLRNRAWFVQATCAPQGTGLCEGLDWLSNKL 177          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 303.523 bits (776), Expect = 1.479e-103
Identity = 140/181 (77.35%), Postives = 160/181 (88.40%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MG   S L   LFG KEMRILMVGLD AGKTT+LYKLKLGE++TTIPTIGFNVETV+YKNISFTVWDVGGQD+IR LWRHY++NT+G+IFVVDSNDR R+ EARE + RMLNEDELR+A  LVFANKQDLP AM+ AEIT+KLGLHS+RNR W+IQATCATSG+GLYEGL+WLS +LKN +
Sbjct:    1 MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLKNST 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Yeast
Match: ARF2 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; ARF2 has a paralog, ARF1, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002296])

HSP 1 Score: 303.138 bits (775), Expect = 1.819e-103
Identity = 140/181 (77.35%), Postives = 161/181 (88.95%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MG   S L   LFG KEMRILMVGLD AGKTT+LYKLKLGE++TTIPTIGFNVETV+YKNISFTVWDVGGQD+IR LWRHY++NT+G+IFV+DSNDR R+ EARE + RMLNEDELR+AV LVFANKQDLP AM+ AEIT+KLGLHS+RNR W+IQ+TCATSG+GLYEGL+WLS  LKN+S
Sbjct:    1 MGLYASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLKNQS 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 221.476 bits (563), Expect = 1.918e-71
Identity = 104/175 (59.43%), Postives = 134/175 (76.57%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLH-SLRNRSWYIQATCATSGDGLYEGLDWLS 638
            MGN +S +L +LFG KEM+ILM+GLD AGKTTILYKLKL +I T+ PT+GFNVETV YKN+ F +WDVGGQ ++RPLWRHYF  T  LIFV+DS+ R R+ EA+EEL  ++ E E+ + VLLV+ANKQDL +AM P E++D L L  +L+N+ W +  + A SG GL EGL W+S
Sbjct:    1 MGNSISKVLGKLFGSKEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSWIS 175          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Yeast
Match: ARL1 (Soluble GTPase with a role in regulation of membrane traffic; regulates potassium influx; role in membrane organization at trans-Golgi network; required for delivery of Atg9p to the phagophore assembly site during autophagy under high temperature stress; required with Ypt6p for starvation-induced autophagy; required for the CVT pathway under non-starvation conditions; G protein of the Ras superfamily, similar to ADP-ribosylation factor [Source:SGD;Acc:S000000368])

HSP 1 Score: 219.935 bits (559), Expect = 7.796e-71
Identity = 102/179 (56.98%), Postives = 138/179 (77.09%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGK-KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLK 650
            MGN+ S + D+L+G  KE+RIL++GLD AGKTTILY+L++GE+VTT PTIGFNVET+ YKN+   VWD+GGQ  IRP WR Y+ +T  +IFVVDS D++R++ A +EL  ML E+EL+DA LLVFANKQD P A++ +E++ +L L  L++RSW I A+ A  G+G+ EGLDWL   +K
Sbjct:    1 MGNIFSSMFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIK 179          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Yeast
Match: SAR1 (ARF family GTPase; component of the COPII vesicle coat; required for transport vesicle formation during ER to Golgi protein transport; lowers membrane rigidity aiding vesicle formation; localizes to ER-mitochondrial contact sites where it enhances membrane curvature, thereby reducing contact size via its N-terminal amphipathic helix; regulates mitochondrial fission and fusion dynamics [Source:SGD;Acc:S000006139])

HSP 1 Score: 108.997 bits (271), Expect = 1.820e-28
Identity = 56/130 (43.08%), Postives = 79/130 (60.77%), Query Frame = 3
Query:  162 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGL 551
            K  ++L +GLD AGKTT+L+ LK   + T  PT     E +   NI FT +D+GG  + R LW+ YF    G++F+VD+ D ER +EAR EL  + N  EL+D   ++  NK D PNA++ AE+   LGL
Sbjct:   22 KHGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGL 151          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Nematostella
Match: EDO42156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S214])

HSP 1 Score: 340.887 bits (873), Expect = 7.567e-118
Identity = 165/179 (92.18%), Postives = 168/179 (93.85%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKN 653
            MG + + L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV EAREEL RMLNEDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLRNR WYIQATCATSGDGLYEGLDWLS+ LKN
Sbjct:    1 MGGMFAKLFAGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELNRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRNRQWYIQATCATSGDGLYEGLDWLSSQLKN 179          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Nematostella
Match: EDO48359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD9])

HSP 1 Score: 310.457 bits (794), Expect = 7.347e-106
Identity = 146/177 (82.49%), Postives = 161/177 (90.96%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTL 647
            MG  +S L  RLFGKK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVE+VEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLI+VVDSNDRERVNE++EEL +ML EDEL+DAV+LV ANKQDLPNA++ +EIT+KLGL S+R+R WYIQA CAT G GLYEGLDWLS  L
Sbjct:    1 MGLTISSLFTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSIRDRQWYIQAACATQGTGLYEGLDWLSNEL 177          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Nematostella
Match: EDO48360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJE1])

HSP 1 Score: 310.071 bits (793), Expect = 2.185e-105
Identity = 146/177 (82.49%), Postives = 161/177 (90.96%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTL 647
            MG  +S L  RLFGKK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVE+VEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLI+VVDSNDRERVNE++EEL +ML EDEL+DAV+LV ANKQDLPNA++ +EIT+KLGL S+R+R WYIQA CAT G GLYEGLDWLS  L
Sbjct:    1 MGLTISSLFTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSIRDRQWYIQAACATQGTGLYEGLDWLSNEL 177          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Nematostella
Match: EDO36373 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIW3])

HSP 1 Score: 266.929 bits (681), Expect = 8.199e-89
Identity = 125/181 (69.06%), Postives = 149/181 (82.32%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN V  L  RL GK E+R+LMVGLDAAGKTTILY LKL E V TIPTIGFNVE VEYKNI FTVWD+GGQDKIR LWR YFQ TQGLIFVVDSNDR+R+ EA+EEL ++L E+EL+ A LLV ANKQDLP++M+  E+++KL LH+LR+R+WYIQATCA  G G+YEGL+WL+  ++ R 
Sbjct:    1 MGNSVLSLFRRLLGKDELRLLMVGLDAAGKTTILYHLKLDEPVNTIPTIGFNVEVVEYKNIKFTVWDIGGQDKIRLLWRLYFQETQGLIFVVDSNDRDRIQEAKEELFKLLKEEELKRAALLVLANKQDLPDSMSTTELSEKLSLHTLRSRNWYIQATCALKGQGVYEGLEWLAQQIQLRK 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Nematostella
Match: EDO40902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S615])

HSP 1 Score: 266.544 bits (680), Expect = 9.144e-89
Identity = 117/174 (67.24%), Postives = 149/174 (85.63%), Query Frame = 3
Query:  129 VSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLK 650
            +  LL ++FG KEMRILM+GLDAAGKTTILYKLKLG+ VTTIPT+GFNVETV ++ + F VWDVGGQDKIRPLWRHYF  +QGLIFVVD  DR+R++EAR+EL R++N+ E++D ++L+FANKQDLP+AM P EI +K+GL  +R+R+WY+Q +CAT+GDGLY+GL WLST  K
Sbjct:    1 MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTFQKVKFNVWDVGGQDKIRPLWRHYFAGSQGLIFVVDCADRDRIDEARKELQRIINDREMKDVIILIFANKQDLPDAMKPHEIQEKMGLTRIRDRNWYVQPSCATTGDGLYDGLKWLSTNFK 174          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Medaka
Match: ENSORLT00000042909.1 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:101170343])

HSP 1 Score: 342.428 bits (877), Expect = 5.749e-118
Identity = 165/181 (91.16%), Postives = 171/181 (94.48%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+  +LL  L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWL+  LKN+ 
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Medaka
Match: arf3b (ADP-ribosylation factor 3 [Source:NCBI gene;Acc:101174416])

HSP 1 Score: 342.428 bits (877), Expect = 5.749e-118
Identity = 165/181 (91.16%), Postives = 171/181 (94.48%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 659
            MGN+  +LL  L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWL+  LKN+ 
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Medaka
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:101155726])

HSP 1 Score: 342.428 bits (877), Expect = 1.556e-117
Identity = 165/180 (91.67%), Postives = 169/180 (93.89%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+ + L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREEL RML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLH+LR RSWYIQATCATSGDGLYEGLDWLS  LKN+
Sbjct:   29 MGNVFASLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELSRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHALRQRSWYIQATCATSGDGLYEGLDWLSNQLKNQ 208          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Medaka
Match: ENSORLT00000009599.2 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:101170343])

HSP 1 Score: 343.969 bits (881), Expect = 2.970e-117
Identity = 165/180 (91.67%), Postives = 171/180 (95.00%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNR 656
            MGN+  +LL  L GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR+R+WYIQATCATSGDGLYEGLDWL+  LKN+
Sbjct:   95 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK 274          
BLAST of ADP-ribosylation factor 1 vs. Ensembl Medaka
Match: ENSORLT00000030860.1 (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:101167961])

HSP 1 Score: 331.643 bits (849), Expect = 8.346e-114
Identity = 163/179 (91.06%), Postives = 167/179 (93.30%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKN 653
            MGN  S L   LFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE+KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV EA+EELMRML EDELRDAVLLVFANKQDLPNAMN AEITDKL LHSLR+R+WYIQATCATSGDGLYEGLDWLS  LKN
Sbjct:    1 MGNFAS-LFRGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEFKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAKEELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLCLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKN 178          
BLAST of ADP-ribosylation factor 1 vs. Planmine SMEST
Match: SMESG000067743.1 (SMESG000067743.1)

HSP 1 Score: 378.252 bits (970), Expect = 2.953e-132
Identity = 183/183 (100.00%), Postives = 183/183 (100.00%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK 665
            MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK
Sbjct:    1 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK 183          
BLAST of ADP-ribosylation factor 1 vs. Planmine SMEST
Match: SMESG000000945.1 (SMESG000000945.1)

HSP 1 Score: 337.421 bits (864), Expect = 3.654e-116
Identity = 163/183 (89.07%), Postives = 171/183 (93.44%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK 665
            MGNL ++L DRLF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQG+IFVVDSNDRERV EA+EEL RMLNEDELR AVLLVFANKQDLPNAMN AE+T+KL L+SLR R WYIQ+TCATSGDGLYEGLDWLS  LKNRSKK
Sbjct:    1 MGNLFTNLFDRLFFKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGVIFVVDSNDRERVQEAKEELSRMLNEDELRGAVLLVFANKQDLPNAMNAAEVTEKLALNSLRLRDWYIQSTCATSGDGLYEGLDWLSQILKNRSKK 183          
BLAST of ADP-ribosylation factor 1 vs. Planmine SMEST
Match: SMESG000000928.1 (SMESG000000928.1)

HSP 1 Score: 337.421 bits (864), Expect = 3.654e-116
Identity = 163/183 (89.07%), Postives = 171/183 (93.44%), Query Frame = 3
Query:  117 MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK 665
            MGNL ++L DRLF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQG+IFVVDSNDRERV EA+EEL RMLNEDELR AVLLVFANKQDLPNAMN AE+T+KL L+SLR R WYIQ+TCATSGDGLYEGLDWLS  LKNRSKK
Sbjct:    1 MGNLFTNLFDRLFFKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGVIFVVDSNDRERVQEAKEELSRMLNEDELRGAVLLVFANKQDLPNAMNAAEVTEKLALNSLRLRDWYIQSTCATSGDGLYEGLDWLSQILKNRSKK 183          
BLAST of ADP-ribosylation factor 1 vs. Planmine SMEST
Match: SMESG000000945.1 (SMESG000000945.1)

HSP 1 Score: 306.22 bits (783), Expect = 2.883e-104
Identity = 147/162 (90.74%), Postives = 153/162 (94.44%), Query Frame = 3
Query:  180 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK 665
            MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQG+IFVVDSNDRERV EA+EEL RMLNEDELR AVLLVFANKQDLPNAMN AE+T+KL L+SLR R WYIQ+TCATSGDGLYEGLDWLS  LKNRSKK
Sbjct:    1 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGVIFVVDSNDRERVQEAKEELSRMLNEDELRGAVLLVFANKQDLPNAMNAAEVTEKLALNSLRLRDWYIQSTCATSGDGLYEGLDWLSQILKNRSKK 162          
BLAST of ADP-ribosylation factor 1 vs. Planmine SMEST
Match: SMESG000000928.1 (SMESG000000928.1)

HSP 1 Score: 306.22 bits (783), Expect = 2.883e-104
Identity = 147/162 (90.74%), Postives = 153/162 (94.44%), Query Frame = 3
Query:  180 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK 665
            MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQG+IFVVDSNDRERV EA+EEL RMLNEDELR AVLLVFANKQDLPNAMN AE+T+KL L+SLR R WYIQ+TCATSGDGLYEGLDWLS  LKNRSKK
Sbjct:    1 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGVIFVVDSNDRERVQEAKEELSRMLNEDELRGAVLLVFANKQDLPNAMNAAEVTEKLALNSLRLRDWYIQSTCATSGDGLYEGLDWLSQILKNRSKK 162          
The following BLAST results are available for this feature:
BLAST of ADP-ribosylation factor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARF17.487e-11891.67ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
ARF17.487e-11891.67ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
ARF17.487e-11891.67ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
ARF31.073e-11791.16ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
ARF31.073e-11791.16ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf-1.29.090e-11991.71ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.29.090e-11991.71ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.29.090e-11991.71ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-32.531e-10985.31ADP-Ribosylation Factor related; ADP-ribosylation ... [more]
arf-65.236e-8768.39ADP-Ribosylation Factor related [Source:UniProtKB... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arf79F4.189e-11890.11gene:FBgn0010348 transcript:FBtr0332054[more]
Arf79F4.189e-11890.11gene:FBgn0010348 transcript:FBtr0078573[more]
Arf79F4.189e-11890.11gene:FBgn0010348 transcript:FBtr0299906[more]
Arf79F4.189e-11890.11gene:FBgn0010348 transcript:FBtr0299907[more]
Arf79F4.189e-11890.11gene:FBgn0010348 transcript:FBtr0078571[more]
back to top
BLAST of ADP-ribosylation factor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf3b6.826e-11891.16ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
arf3b6.826e-11891.16ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
arf3a1.127e-11790.61ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GE... [more]
arf2a2.367e-11792.18ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf2a2.367e-11792.18ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf39.727e-11891.16ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
arf51.379e-11791.16ADP ribosylation factor 5 [Source:NCBI gene;Acc:39... [more]
fibp2.110e-11791.67fibroblast growth factor (acidic) intracellular bi... [more]
arf47.808e-10984.44ADP ribosylation factor 4 [Source:NCBI gene;Acc:59... [more]
slc8a11.136e-8762.96solute carrier family 8 (sodium/calcium exchanger)... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arf15.140e-11891.67ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:M... [more]
Arf15.140e-11891.67ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:M... [more]
Arf37.367e-11891.16ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:M... [more]
Arf21.090e-11691.11ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:M... [more]
Arf21.090e-11691.11ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P91924|ARF_DUGJA1.373e-13099.45ADP-ribosylation factor OS=Dugesia japonica OX=616... [more]
sp|Q61LA8|ARF12_CAEBR3.407e-11892.27ADP-ribosylation factor 1-like 2 OS=Caenorhabditis... [more]
sp|Q10943|ARF12_CAEEL1.156e-11791.71ADP-ribosylation factor 1-like 2 OS=Caenorhabditis... [more]
sp|P51643|ARF1_XENLA2.859e-11791.67ADP-ribosylation factor 1 OS=Xenopus laevis OX=835... [more]
sp|P84079|ARF1_RAT3.595e-11791.67ADP-ribosylation factor 1 OS=Rattus norvegicus OX=... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D5RLU25.381e-11691.16Putative gtp-binding adp-ribosylation factor-like ... [more]
A0A0R3RVR49.882e-11691.71Uncharacterized protein OS=Elaeophora elaphi OX=11... [more]
F1KZX19.882e-11691.71ADP-ribosylation factor 1 OS=Ascaris suum OX=6253 ... [more]
A0A238C2P49.882e-11691.71ADP-ribosylation factor family protein OS=Onchocer... [more]
A0A0M3IIK19.882e-11691.71Uncharacterized protein OS=Ascaris lumbricoides OX... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf2a2.006e-11792.18ADP-ribosylation factor 1-like [Source:NCBI gene;A... [more]
arf2b2.495e-11790.56ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf3a2.506e-11791.67ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GE... [more]
arf11.892e-11691.11ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf2b1.149e-11394.08ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf13.086e-11792.78ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
arf2a4.063e-11791.62ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf2a3.645e-11389.50ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf4a8.646e-10078.21ADP-ribosylation factor 4a [Source:ZFIN;Acc:ZDB-GE... [more]
arf4a6.169e-9978.53ADP-ribosylation factor 4a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARF11.479e-10377.35ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF21.819e-10377.35ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF31.918e-7159.43Glucose-repressible ADP-ribosylation factor; GTPas... [more]
ARL17.796e-7156.98Soluble GTPase with a role in regulation of membra... [more]
SAR11.820e-2843.08ARF family GTPase; component of the COPII vesicle ... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO421567.567e-11892.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483597.347e-10682.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483602.185e-10582.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363738.199e-8969.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409029.144e-8967.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042909.15.749e-11891.16ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
arf3b5.749e-11891.16ADP-ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
arf2b1.556e-11791.67ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000009599.22.970e-11791.67ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000030860.18.346e-11491.06ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ADP-ribosylation factor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067743.12.953e-132100.00SMESG000067743.1[more]
SMESG000000945.13.654e-11689.07SMESG000000945.1[more]
SMESG000000928.13.654e-11689.07SMESG000000928.1[more]
SMESG000000945.12.883e-10490.74SMESG000000945.1[more]
SMESG000000928.12.883e-10490.74SMESG000000928.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001367 ID=SMED30001367|Name=ADP-ribosylation factor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1283bp
AGCTTTTGTTTAGTCAAATATCGGTAATCTAGCACATTTATATTTGTTTG
TTTACGTTTCATTTATAAATTCCTCCAACTCATTAAAATAAATTTACTTT
CAATTGATTTTGGAAAATGGGCAATTTAGTATCTCATCTATTAGACAGAC
TTTTCGGCAAAAAGGAAATGAGAATATTGATGGTTGGTCTCGATGCGGCC
GGTAAAACTACTATTCTTTATAAATTGAAGTTGGGTGAAATCGTAACTAC
TATTCCCACAATTGGTTTTAACGTTGAAACTGTGGAATACAAAAATATTA
GTTTTACTGTTTGGGATGTTGGAGGACAGGATAAAATTCGGCCATTGTGG
AGACATTACTTCCAAAATACTCAAGGCCTTATTTTTGTCGTTGATAGTAA
TGATAGGGAAAGAGTTAACGAAGCTCGAGAAGAATTAATGAGAATGTTAA
ATGAAGATGAACTTAGAGATGCAGTCTTGTTGGTATTTGCTAACAAACAA
GATTTGCCAAATGCAATGAATCCCGCAGAAATAACAGATAAACTCGGTTT
ACACAGTTTAAGAAATCGTTCTTGGTACATTCAAGCAACATGTGCAACGT
CTGGAGATGGTTTATATGAGGGTTTGGATTGGCTCAGCACAACTCTAAAA
AATCGAAGTAAAAAGTAAACCTTCGAGCGCTAGAAATACTGAGGACATTC
CAGTGATTCAGCGTTAAATTTGACTGTTTTGTTTGTGAATAAATTAAAAT
CATGAGCGATTTTATGTTTTCACGAAATATTAGATTTGTATGATGTGTCT
AGTGTTGAATGATCATTTAATAAATTAACTGTGTTAAGGTTTTTGCTATT
TTTATTTTACAAATATTGAAAGCGATGTTTTAATAAATATTAATTATTGT
AGAAATTGTTTTGATTTATGTTGTTAAATTTTTTATGTTCATTTGCCAGA
TTTTTAAGAGCGCAGTAAATGAAATGAGTAATTTGTGCGTGTGTTTGTCA
TAGAATATTTGCATTGATGAATCATTTTATTGATTTTCCAGTTGAATGCA
ATTGCAAGTTGGCCAACTTGACACTTCTCAATCTTTTTTTATCTACTCTT
ATTTCAGGATATCACAAAGTGTTTTTATGGTTACATTATTTGTTTTGTTT
GAAATTTGGTTCGTTAAAAGTATGTAGTTTTAGCTGGAAAATAATAAAGT
TAGATGTTAGTCACGTAATTGAATGCAATTATTTTAAAAAGTAATTGTTT
TCTTATTTATGTACTTTAAATGATATTTTTTAG
back to top

protein sequence of SMED30001367-orf-1

>SMED30001367-orf-1 ID=SMED30001367-orf-1|Name=SMED30001367-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=184bp
MGNLVSHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG
FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV
NEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRN
RSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR019774Aromatic-AA_hydroxylase_C
IPR006689Small_GTPase_ARF/SAR
IPR027417P-loop_NTPase
IPR024156Small_GTPase_ARF
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0007264small GTPase mediated signal transduction
GO:0006810transport
GO:0015031protein transport
GO:0016192vesicle-mediated transport
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005794Golgi apparatus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 97..117
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 1..181
e-value: 1.8E-138
score: 476.0
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 18..180
e-value: 0.0027
score: -68.7
NoneNo IPR availableSMARTSM00178sar_sub_1coord: 1..177
e-value: 4.1E-24
score: 96.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 18..177
e-value: 3.8E-71
score: 240.0
NoneNo IPR availablePANTHERPTHR11711ADP RIBOSYLATION FACTOR-RELATEDcoord: 1..180
NoneNo IPR availablePANTHERPTHR11711:SF314coord: 1..180
NoneNo IPR availablePROSITEPS51417ARFcoord: 11..177
score: 25.528
NoneNo IPR availableCDDcd04150Arf1_5_likecoord: 18..176
e-value: 2.97227E-126
score: 349.783
IPR006689Small GTPase superfamily, ARF/SAR typePRINTSPR00328SAR1GTPBPcoord: 74..99
score: 35.07
coord: 47..71
score: 33.65
coord: 119..140
score: 31.02
coord: 19..42
score: 52.45
IPR006689Small GTPase superfamily, ARF/SAR typePFAMPF00025Arfcoord: 7..176
e-value: 4.7E-79
score: 263.9
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 16..142
e-value: 1.6E-24
score: 84.5
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 14..181