SMEDWI-3

Overview
NameSMEDWI-3 (ACC97187.1)
Smed IDSMED30001362
Uniprot Best hitPiwi-like protein Ago3 OS=Bombyx mori OX=7091 GN=AGO3 PE=1 SV=2 (E=0)
Length (bp)3093
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMEDWI-3 (SMED30001362) t-SNE clustered cells

Violin plots show distribution of expression levels for SMEDWI-3 (SMED30001362) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMEDWI-3 (SMED30001362) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMEDWI-3 (SMED30001362) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: Sir5g2Sk

 

back to top

Expression Details

SMEDWI-3 ( piwi-3 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the neoblast and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and piwi-3 (green). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S3 embryo costained with piwi-1 (green) and piwi-3 (red). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S5 embryo costained with piwi-1 (green) and piwi-3 (red). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

Anatomical Expression

PAGE et. al., 2020




SMED30001362

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 45

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30001362SMESG000081970.1 dd_Smed_v4_1258_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30001362SMESG000081970.1 dd_Smed_v4_1258_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
epidermal cellSMED30001362SMESG000081970.1 dd_Smed_v4_1258_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
protonephridiaSMED30001362SMESG000081970.1 dd_Smed_v4_1258_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30001362SMESG000081970.1 SMED_13525_V2_1GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30001362SMESG000081970.1 SMED_13525_V2_1GPL14150PMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
blastomereSMED30001362SMESG000081970.1 EU586258.1smed_ncbi_20200123PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
neoblastSMED30001362SMESG000081970.1 EU586258.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 EU586258.1smed_ncbi_20200123PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 EU586258.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
neoblastSMED30001362SMESG000081970.1 EU586258.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 EU586258.1smed_ncbi_20200123PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 EU586258.1smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 EU586258.1smed_ncbi_20200123PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
neoblastSMED30001362SMESG000081970.1 EU586258.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 EU586258.1smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 SMED30001362smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
neoblastSMED30001362SMESG000081970.1 SMED30001362smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 SMED30001362smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 SMED30001362smed_20140614PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
neoblastSMED30001362SMESG000081970.1 SMED30001362smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
neoblastSMED30001362SMESG000081970.1 SMED30001362smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 SMED30001362smed_20140614PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 SMED30001362smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 SMED30001362smed_20140614PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 SMED30001362smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
X1 cellSMED30001362SMESG000081970.1 SmedASXL_002725SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
X2 cellSMED30001362SMESG000081970.1 SmedASXL_002725SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
neoblastSMED30001362SMESG000081970.1 DN315298ncbi_smed_estsPMID:16344473whole organismadult hermaphroditecolorimetric in situ hybridization evidence
central nervous systemSMED30001362SMESG000081970.1 DN315298ncbi_smed_estsPMID:16344473whole organismadult hermaphroditecolorimetric in situ hybridization evidence
testisSMED30001362SMESG000081970.1 DN315298ncbi_smed_estsPMID:16344473whole organismadult hermaphroditecolorimetric in situ hybridization evidence
ovarySMED30001362SMESG000081970.1 DN315298ncbi_smed_estsPMID:16344473whole organismadult hermaphroditecolorimetric in situ hybridization evidence
neoblastSMED30001362SMESG000081970.1 EU586258smed_ncbi_20200123PMID:18456843whole organismadult hermaphroditecolorimetric in situ hybridization evidence
X1 cellSMED30001362SMESG000081970.1 isotig00135be_Smed_v2PMID:22543868FACS sorted cell populationasexual adultRNA-sequencing evidence
blastomereSMED30001362SMESG000081970.1 ACC97187.1smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
neoblastSMED30001362SMESG000081970.1 ACC97187.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 ACC97187.1smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 ACC97187.1smed_ncbi_20200123PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 ACC97187.1smed_ncbi_20200123PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 ACC97187.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
neoblastSMED30001362SMESG000081970.1 ACC97187.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 ACC97187.1smed_ncbi_20200123PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
neoblastSMED30001362SMESG000081970.1 ACC97187.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30001362SMESG000081970.1 ACC97187.1smed_ncbi_20200123PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
neoblastSMED30001362SMESG000081970.1 dd_Smed_v6_1258_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
Homology
BLAST of SMEDWI-3 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 295/766 (38.51%), Postives = 465/766 (60.70%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  + +  AFDG  L++P+ L+ K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M    ++T  +K Q Q +   +L+G +VLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V IP+K  M+VG+D +HD     RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  I +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+NTR +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ DNS   P  +Q + YK CHIYYNWPG +RVPAPC YAHKLA++VGQ++  EP+  L +RL+YL
Sbjct:  114 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPIDIPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS--KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYYL 861          
BLAST of SMEDWI-3 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 295/766 (38.51%), Postives = 465/766 (60.70%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  + +  AFDG  L++P+ L+ K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M    ++T  +K Q Q +   +L+G +VLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V IP+K  M+VG+D +HD     RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  I +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+NTR +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ DNS   P  +Q + YK CHIYYNWPG +RVPAPC YAHKLA++VGQ++  EP+  L +RL+YL
Sbjct:  114 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPIDIPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS--KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYYL 861          
BLAST of SMEDWI-3 vs. Ensembl Human
Match: PIWIL2 (piwi like RNA-mediated gene silencing 2 [Source:HGNC Symbol;Acc:HGNC:17644])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 301/766 (39.30%), Postives = 443/766 (57.83%), Query Frame = 1
Query:  733 TLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNV-APG-VQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +L  N VK++     +YQYHV+F+P ++ + MR     G+ +    V     AFDG  LY+P  L+    +    K     +     +       S+ C   YNV+F+R+   L M  +GR+++ P   +VL + R++IWPGY  SI+  DGGL L  DVSHKVIRND V D+M  I +   NK   Q      L+G IV+T +NNR YRI D+DW K     F    G++I++ +Y+   YG+ +++ +QP+++ + + R   N G      +  G + L+PEL  +TG+ + M KDFR M++L +   ++PK+ H AL   +  I   E A   L  WG+ ++KD   I    +  E I   N + +++ E    K+ +  +  I  I +  W L  PK  + +A  L+  L   +  +G+    P  VE+ +DR E Y++ ++  + A G +Q+VV I+   R+D Y AIKK C V  PVPSQVV  +T+ +  +L SVA  I LQIN KLGGELW V IP+K+ MV+G+DV+HD     RSV   V S N   T+W+S+   Q   +EI+  L+ C++  LK ++E N+ LPE I +YRDGVSDGQL  V   EI Q  K FE+F  +Y+P MV  VVQK+I+T LY++ P+N      P PGT+VDHT+T     DF+L++  VRQG   PTHYV + + +  +P  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ G  L  EP+  LC+ LF+L
Sbjct:  225 SLGLNLVKIQCHNEAVYQYHVTFSPNVECKSMRF----GMLKDHQAVTGNVTAFDGSILYLPVKLQQVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPGYAASIRRTDGGLFLLADVSHKVIRNDCVLDVMHAIYQ--QNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQ-DNHG-----MLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIAKNEAATNELMRWGLRLQKDVHKIEGRVLPMERINLKNTSFITSQELNWVKE-VTRDPSILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYVRTIQSTLGAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQINCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFE-NYQPKMVVFVVQKKISTNLYLAAPQN---FVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHHEPAIQLCENLFFL 973          
BLAST of SMEDWI-3 vs. Ensembl Human
Match: PIWIL2 (piwi like RNA-mediated gene silencing 2 [Source:HGNC Symbol;Acc:HGNC:17644])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 301/766 (39.30%), Postives = 443/766 (57.83%), Query Frame = 1
Query:  733 TLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNV-APG-VQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +L  N VK++     +YQYHV+F+P ++ + MR     G+ +    V     AFDG  LY+P  L+    +    K     +     +       S+ C   YNV+F+R+   L M  +GR+++ P   +VL + R++IWPGY  SI+  DGGL L  DVSHKVIRND V D+M  I +   NK   Q      L+G IV+T +NNR YRI D+DW K     F    G++I++ +Y+   YG+ +++ +QP+++ + + R   N G      +  G + L+PEL  +TG+ + M KDFR M++L +   ++PK+ H AL   +  I   E A   L  WG+ ++KD   I    +  E I   N + +++ E    K+ +  +  I  I +  W L  PK  + +A  L+  L   +  +G+    P  VE+ +DR E Y++ ++  + A G +Q+VV I+   R+D Y AIKK C V  PVPSQVV  +T+ +  +L SVA  I LQIN KLGGELW V IP+K+ MV+G+DV+HD     RSV   V S N   T+W+S+   Q   +EI+  L+ C++  LK ++E N+ LPE I +YRDGVSDGQL  V   EI Q  K FE+F  +Y+P MV  VVQK+I+T LY++ P+N      P PGT+VDHT+T     DF+L++  VRQG   PTHYV + + +  +P  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ G  L  EP+  LC+ LF+L
Sbjct:  225 SLGLNLVKIQCHNEAVYQYHVTFSPNVECKSMRF----GMLKDHQAVTGNVTAFDGSILYLPVKLQQVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPGYAASIRRTDGGLFLLADVSHKVIRNDCVLDVMHAIYQ--QNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQ-DNHG-----MLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIAKNEAATNELMRWGLRLQKDVHKIEGRVLPMERINLKNTSFITSQELNWVKE-VTRDPSILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYVRTIQSTLGAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQINCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFE-NYQPKMVVFVVQKKISTNLYLAAPQN---FVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHHEPAIQLCENLFFL 973          
BLAST of SMEDWI-3 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 516.153 bits (1328), Expect = 2.913e-168
Identity = 272/728 (37.36%), Postives = 434/728 (59.62%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWP 2904
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  + +  AFDG  L++P+ L+ K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M    ++T  +K Q Q +   +L+G +VLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V IP+K  M+VG+D +HD     RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  I +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+NTR +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ DNS   P  +Q + YK CHIYYNWP
Sbjct:  114 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPIDIPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS--KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWP 823          
BLAST of SMEDWI-3 vs. Ensembl Celegans
Match: prg-1 (Piwi-like protein [Source:UniProtKB/TrEMBL;Acc:P90786])

HSP 1 Score: 430.639 bits (1106), Expect = 4.514e-136
Identity = 257/790 (32.53%), Postives = 440/790 (55.70%), Query Frame = 1
Query:  742 ANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETI-IXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYF-YPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLG-QIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLL-QALMSKSPRVG----VMFGKPKIVEMNNDRTEEYLKELKRNV----APGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLK-------EGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENN-FLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFS---------ADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            AN++ +  TQ    IYQYHV F P +DS+  R K+++  + +D   +     FDGM LY+ +  +  + I ++         +  K      V+  +   ++N + +R  ++L++ ++GR+YF + + + V D   M I PGY T+I+ ++   +L  +   K++R +S+Y +  +  ++  N  Q     +N++ G   ++T +NN+ +R T +D++ + LSEF K G+ I+ ++YFKN YG++I   +QP+I+S+     GK + P    +V     Y++PELC  TGLTD+M KDF++M+E+ +H R++P++R     + + ++   E+  +   YWGI++ +D  N+ A  +  E +          G+QAE+ + +    +  G  + NWI+I P S     +GLL Q  + ++ R+G    V  G+P  V +      +YL+ +K  +       + ++V +L+   + RY+++KKF  V+CP+P+Q V  +TL        E   L S+ + I LQ+  K GG LW V IP+K  M+VG D++HD+  + ++VGA V +T+   T+++S++   E   ++   L   +   LK Y++ N+  LP  + +YRDG  DGQ+ Y++ TE++      ++ +            K  + + +V KR+N R+          IN P PGT+VD TVTR    DF+LV Q V QGTVTP  Y ++ D++   P + Q +A+K CH+YYNW GTVRVPAPC YAHKLA++  Q+L  + +  L D+LF+L
Sbjct:   54 ANFIPIEMTQSDYSIYQYHVEFEPTVDSKANREKMLRDNNVTD--EIGHHFVFDGMILYLKEEWEQNQMIEVQHPIDRSLICIRFKQTNRFLVDDPQTINIFNTIIRRSFDALQLTQLGRNYFNWGDSRAVPDYN-MSILPGYETAIRMYEENFMLCVENRFKMVREESMYILFHKELRSCQNNPQRVQEKMNEMYGGTTIITRYNNKLHRYTRLDYSISPLSEFVKDGQSITLKEYFKNQYGIEITVDDQPIIISE-----GKPKQPGEPPQVS----YIVPELCFPTGLTDEMRKDFKMMKEIAKHTRMSPQQRLVESRKLIVDLSKNEKVMECFKYWGISLGQDLANVQARVLKSEPL---QGKKTYEGKQAEWARGVKECGIYRGSNMTNWIVIGPGS---GNSGLLSQKFIEEARRLGKILQVQLGEPMCVPIRGISPNDYLEGVKGAIKQVDGEDIHMLVVMLADDNKTRYDSLKKFLCVECPIPNQCVNLRTLAGKSKDGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKNTMIVGYDLYHDSTLKGKTVGACVSTTSNDFTQFYSQTRPHENPTQLGNNLTHFVRKALKQYYDSNDQTLPSRLILYRDGAGDGQIPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLAFIIVTKRVNMRILKQGSSLDNAIN-PQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHDDTDLGPDKHQQLAFKLCHLYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDANGCLRDKLFFL 824          
BLAST of SMEDWI-3 vs. Ensembl Celegans
Match: alg-2 (pep chromosome:WBcel235:II:874160:879001:1 gene:WBGene00000106.1 transcript:T07D3.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 168.703 bits (426), Expect = 1.485e-42
Identity = 166/685 (24.23%), Postives = 298/685 (43.50%), Query Frame = 1
Query: 1066 SLRMVKIGRDYFYP------------EKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVI-RNDSVYDIMMEI----------NKTVNNKGQMQ-TAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD---KGGEKI--SYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHE-----HCRVTPKKRHEALLEFVDNIYSCE-EAKKLLGYWGITIEKDTVNINACKMN-PEMIYFG-NEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKI-------VEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ-TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPI-------KKFMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAY 2955
            SL+   +GR +F P            E K+   R   E+W G+  S++     ++L  DVS     R   V + + E+           + +++  +++ T  I  L  +I       R YR+ ++         F    + G+ I  +   YF + Y +Q++    P +      +                  YL PE+C       D++   R +++L +       + T +   E   E    +   E  A      +GITI      +    ++ P+++Y G + A+ +   Q  +   +   +   G+ +  W +             L+   ++  R+    G P I            ++ E   K LK+  +  +QL+V +L   +   Y  +K+       + +Q V A+  ++  P+  S   N+ L++N KLGG + ++ +P        +  + +G D+ H   G +R  S+ AVVGS +A  +R+ +   +Q+  +EI+  L   +  LL  ++    F P  I +YRDGVS+GQL  V + E+    +      + Y+P + +  VQKR +TRL+ +D  ++ G+  N  PGT VD  +T    +DFFL S +  QGT  P+HY VL D++  T  ++Q + Y+ CH Y     +V +PAP  YAH +A+
Sbjct:  191 SLKYTPVGRSFFTPPGVMKPGMQMHQESKLGGGR---EVWFGFHQSVRPSQWKMMLNIDVSATAFYRAMPVIEFVAEVLELPVQALAERRALSDAQRVKFTKEIRGLKIEITHCGAVRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFFDKYRIQLKYPHLPCLQVGQEQKH----------------TYLPPEVC-------DIVPGQRCLKKLTDVQTSTMIKATARSAPEREREICKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWD--MRGKQFHTGMEVRTWAIACFAQQSHVKENDLRMFTTQLQRISTDAGMPIIGTPMFCKYASGVEQVEPMFKYLKQTYS-AIQLIVVVLPG-KTPIYAEVKRVGDTVLGIATQCVQAKNAIRTTPQTLS---NLCLKMNVKLGG-VNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQPGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWDDNDLTADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAF 841          
BLAST of SMEDWI-3 vs. Ensembl Celegans
Match: alg-2 (pep chromosome:WBcel235:II:873176:878945:1 gene:WBGene00000106.1 transcript:T07D3.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 168.318 bits (425), Expect = 1.996e-42
Identity = 166/685 (24.23%), Postives = 298/685 (43.50%), Query Frame = 1
Query: 1066 SLRMVKIGRDYFYP------------EKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVI-RNDSVYDIMMEI----------NKTVNNKGQMQ-TAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD---KGGEKI--SYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHE-----HCRVTPKKRHEALLEFVDNIYSCE-EAKKLLGYWGITIEKDTVNINACKMN-PEMIYFG-NEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKI-------VEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ-TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPI-------KKFMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAY 2955
            SL+   +GR +F P            E K+   R   E+W G+  S++     ++L  DVS     R   V + + E+           + +++  +++ T  I  L  +I       R YR+ ++         F    + G+ I  +   YF + Y +Q++    P +      +                  YL PE+C       D++   R +++L +       + T +   E   E    +   E  A      +GITI      +    ++ P+++Y G + A+ +   Q  +   +   +   G+ +  W +             L+   ++  R+    G P I            ++ E   K LK+  +  +QL+V +L   +   Y  +K+       + +Q V A+  ++  P+  S   N+ L++N KLGG + ++ +P        +  + +G D+ H   G +R  S+ AVVGS +A  +R+ +   +Q+  +EI+  L   +  LL  ++    F P  I +YRDGVS+GQL  V + E+    +      + Y+P + +  VQKR +TRL+ +D  ++ G+  N  PGT VD  +T    +DFFL S +  QGT  P+HY VL D++  T  ++Q + Y+ CH Y     +V +PAP  YAH +A+
Sbjct:  210 SLKYTPVGRSFFTPPGVMKPGMQMHQESKLGGGR---EVWFGFHQSVRPSQWKMMLNIDVSATAFYRAMPVIEFVAEVLELPVQALAERRALSDAQRVKFTKEIRGLKIEITHCGAVRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFFDKYRIQLKYPHLPCLQVGQEQKH----------------TYLPPEVC-------DIVPGQRCLKKLTDVQTSTMIKATARSAPEREREICKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWD--MRGKQFHTGMEVRTWAIACFAQQSHVKENDLRMFTTQLQRISTDAGMPIIGTPMFCKYASGVEQVEPMFKYLKQTYS-AIQLIVVVLPG-KTPIYAEVKRVGDTVLGIATQCVQAKNAIRTTPQTLS---NLCLKMNVKLGG-VNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQPGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWDDNDLTADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAF 860          
BLAST of SMEDWI-3 vs. Ensembl Celegans
Match: alg-1 (pep chromosome:WBcel235:X:13951262:13956261:1 gene:WBGene00000105.1 transcript:F48F7.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 166.392 bits (420), Expect = 1.014e-41
Identity = 162/659 (24.58%), Postives = 289/659 (43.85%), Query Frame = 1
Query: 1099 FYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVI-RNDSVYDIMMEI----------NKTVNNKGQMQ-TAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD---KGGEKI--SYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIK--DFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEE--AKKLLGYWGITIEKDTVNINACKMN-PEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKI-------VEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ-TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPI-------KKFMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAY 2955
            ++ E K+   R   E+W G+  S++     ++L  DVS     R+  V + + E+           + +++  +++ T  I  L  +I       R YR+ ++         F    + G+ I  +   YF + Y +Q++    P +      +                  YL PE+C +      + K  D +    +    R  P++  E     + N+    E  A      +GITI      +    ++ P+++Y G   + +   Q  +   +   +   GI +  W +             L+   ++  R+    G P +         +  ++ E   K LK+N + G+QLVV +L   +   Y  +K+       + +Q V A+  ++  P+  S   N+ L++N KLGG + ++ +P        +  +  G D+ H   G SR  S+ AVVGS +A  +R+ +   +Q+  +EI+  L   +  LL  ++    F P  I +YRDGVS+GQ   V + E+    +        Y+P + +  VQKR +TRL+  D K++ G+  N  PGT VD  +T    +DF+L S +  QGT  P+HY VL D++  T  ++Q + Y+ CH Y     +V +PAP  YAH +A+
Sbjct:  328 YHAESKLGGGR---EVWFGFHQSVRPSQWKMMLNIDVSATAFYRSMPVIEFIAEVLELPVQALAERRALSDAQRVKFTKEIRGLKIEITHCGQMRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFYDKYRIQLKYPHLPCLQVGQEQKH----------------TYLPPEVCNIVPGQRCIKKLTDVQTSTMIKATARSAPERERE-----ISNLVRKAEFSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRTRATALPNQGVWD--MRGKQFHTGIDVRVWAIACFAQQQHVKENDLRMFTNQLQRISNDAGMPIVGNPCFCKYAVGVEQVEPMFKYLKQNYS-GIQLVVVVLPG-KTPVYAEVKRVGDTVLGIATQCVQAKNAIRTTPQTLS---NLCLKMNVKLGG-VNSILLPNVRPRIFNEPVIFFGCDITHPPAGDSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQPGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNLTADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAF 954          
BLAST of SMEDWI-3 vs. Ensembl Celegans
Match: alg-1 (pep chromosome:WBcel235:X:13949114:13956261:1 gene:WBGene00000105.1 transcript:F48F7.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 166.392 bits (420), Expect = 1.335e-41
Identity = 162/659 (24.58%), Postives = 289/659 (43.85%), Query Frame = 1
Query: 1099 FYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVI-RNDSVYDIMMEI----------NKTVNNKGQMQ-TAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD---KGGEKI--SYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIK--DFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEE--AKKLLGYWGITIEKDTVNINACKMN-PEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKI-------VEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ-TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPI-------KKFMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAY 2955
            ++ E K+   R   E+W G+  S++     ++L  DVS     R+  V + + E+           + +++  +++ T  I  L  +I       R YR+ ++         F    + G+ I  +   YF + Y +Q++    P +      +                  YL PE+C +      + K  D +    +    R  P++  E     + N+    E  A      +GITI      +    ++ P+++Y G   + +   Q  +   +   +   GI +  W +             L+   ++  R+    G P +         +  ++ E   K LK+N + G+QLVV +L   +   Y  +K+       + +Q V A+  ++  P+  S   N+ L++N KLGG + ++ +P        +  +  G D+ H   G SR  S+ AVVGS +A  +R+ +   +Q+  +EI+  L   +  LL  ++    F P  I +YRDGVS+GQ   V + E+    +        Y+P + +  VQKR +TRL+  D K++ G+  N  PGT VD  +T    +DF+L S +  QGT  P+HY VL D++  T  ++Q + Y+ CH Y     +V +PAP  YAH +A+
Sbjct:  349 YHAESKLGGGR---EVWFGFHQSVRPSQWKMMLNIDVSATAFYRSMPVIEFIAEVLELPVQALAERRALSDAQRVKFTKEIRGLKIEITHCGQMRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFYDKYRIQLKYPHLPCLQVGQEQKH----------------TYLPPEVCNIVPGQRCIKKLTDVQTSTMIKATARSAPERERE-----ISNLVRKAEFSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRTRATALPNQGVWD--MRGKQFHTGIDVRVWAIACFAQQQHVKENDLRMFTNQLQRISNDAGMPIVGNPCFCKYAVGVEQVEPMFKYLKQNYS-GIQLVVVVLPG-KTPVYAEVKRVGDTVLGIATQCVQAKNAIRTTPQTLS---NLCLKMNVKLGG-VNSILLPNVRPRIFNEPVIFFGCDITHPPAGDSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQPGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNLTADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAF 975          
BLAST of SMEDWI-3 vs. Ensembl Fly
Match: AGO3 (gene:FBgn0250816 transcript:FBtr0299882)

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 301/766 (39.30%), Postives = 456/766 (59.53%), Query Frame = 1
Query:  727 SLTLSANYVKVRTTQPH-IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVY-LIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S+ +  NY+K+ T +   ++ Y V F PPIDS  +RIK +    +  LG  K    FDG  LY+P LL NK T+        +  + +       +    C  +YN+LF R+   L  VK  R  F P +  ++   ++E+WPGYVT++  + GGL+L CDVSH+++   +V ++++++ +   N    Q +A   L+G IVLT +NNR Y+I DI + +N   +F+      SY +Y+K  + + I+D+ QP+I S       K+RG    +E    L + LIPELC LTGL D++  D +LMRE+    RV+P +R  AL +F +N+ +   A+++L  WG+++  ++  I+  +M+ E IYF ++ SVSAG  AEF +    N+++  + +  WI+I  ++    A  LL  +      +G+    P ++ +++DR + Y++ L+RN+    Q+VV I    R+DRY AIKK C  + P+PSQV+ A+TL+   K+ SV   I LQ+N KLGG LW VKIP K  M+ G+D +HD   R  SV A V S N+  ++W+SK+ +Q + +EI+  L +     LK Y + N  LP  I +YRDG+ DGQL      EI QF  V  +     +  + Y VVQKRINTR++     +   + NP PGT+VD  +T++N+YDFFLVSQ VRQGTVTPTHYVVL D+  Y P  +Q ++YK C +YYNW GTVR+PA CMYAHKLAY++GQ+++ + +  L ++LFYL
Sbjct:  127 SVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND-HKDKLGGTK---TFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEM--RNCTQLYNILFDRVMKVLNYVKFDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQ--QNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIK-----KSRGIPAERE---NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF-SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGN-----RIKISYIVVQKRINTRIF---SGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-3 vs. Ensembl Fly
Match: AGO3 (gene:FBgn0250816 transcript:FBtr0299881)

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 301/766 (39.30%), Postives = 456/766 (59.53%), Query Frame = 1
Query:  727 SLTLSANYVKVRTTQPH-IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVY-LIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S+ +  NY+K+ T +   ++ Y V F PPIDS  +RIK +    +  LG  K    FDG  LY+P LL NK T+        +  + +       +    C  +YN+LF R+   L  VK  R  F P +  ++   ++E+WPGYVT++  + GGL+L CDVSH+++   +V ++++++ +   N    Q +A   L+G IVLT +NNR Y+I DI + +N   +F+      SY +Y+K  + + I+D+ QP+I S       K+RG    +E    L + LIPELC LTGL D++  D +LMRE+    RV+P +R  AL +F +N+ +   A+++L  WG+++  ++  I+  +M+ E IYF ++ SVSAG  AEF +    N+++  + +  WI+I  ++    A  LL  +      +G+    P ++ +++DR + Y++ L+RN+    Q+VV I    R+DRY AIKK C  + P+PSQV+ A+TL+   K+ SV   I LQ+N KLGG LW VKIP K  M+ G+D +HD   R  SV A V S N+  ++W+SK+ +Q + +EI+  L +     LK Y + N  LP  I +YRDG+ DGQL      EI QF  V  +     +  + Y VVQKRINTR++     +   + NP PGT+VD  +T++N+YDFFLVSQ VRQGTVTPTHYVVL D+  Y P  +Q ++YK C +YYNW GTVR+PA CMYAHKLAY++GQ+++ + +  L ++LFYL
Sbjct:  127 SVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND-HKDKLGGTK---TFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEM--RNCTQLYNILFDRVMKVLNYVKFDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQ--QNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIK-----KSRGIPAERE---NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF-SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGN-----RIKISYIVVQKRINTRIF---SGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-3 vs. Ensembl Fly
Match: AGO3 (gene:FBgn0250816 transcript:FBtr0299880)

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 301/766 (39.30%), Postives = 456/766 (59.53%), Query Frame = 1
Query:  727 SLTLSANYVKVRTTQPH-IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVY-LIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S+ +  NY+K+ T +   ++ Y V F PPIDS  +RIK +    +  LG  K    FDG  LY+P LL NK T+        +  + +       +    C  +YN+LF R+   L  VK  R  F P +  ++   ++E+WPGYVT++  + GGL+L CDVSH+++   +V ++++++ +   N    Q +A   L+G IVLT +NNR Y+I DI + +N   +F+      SY +Y+K  + + I+D+ QP+I S       K+RG    +E    L + LIPELC LTGL D++  D +LMRE+    RV+P +R  AL +F +N+ +   A+++L  WG+++  ++  I+  +M+ E IYF ++ SVSAG  AEF +    N+++  + +  WI+I  ++    A  LL  +      +G+    P ++ +++DR + Y++ L+RN+    Q+VV I    R+DRY AIKK C  + P+PSQV+ A+TL+   K+ SV   I LQ+N KLGG LW VKIP K  M+ G+D +HD   R  SV A V S N+  ++W+SK+ +Q + +EI+  L +     LK Y + N  LP  I +YRDG+ DGQL      EI QF  V  +     +  + Y VVQKRINTR++     +   + NP PGT+VD  +T++N+YDFFLVSQ VRQGTVTPTHYVVL D+  Y P  +Q ++YK C +YYNW GTVR+PA CMYAHKLAY++GQ+++ + +  L ++LFYL
Sbjct:  127 SVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND-HKDKLGGTK---TFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEM--RNCTQLYNILFDRVMKVLNYVKFDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQ--QNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIK-----KSRGIPAERE---NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF-SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGN-----RIKISYIVVQKRINTRIF---SGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-3 vs. Ensembl Fly
Match: AGO3 (gene:FBgn0250816 transcript:FBtr0301725)

HSP 1 Score: 526.554 bits (1355), Expect = 4.447e-172
Identity = 288/741 (38.87%), Postives = 433/741 (58.43%), Query Frame = 1
Query:  727 SLTLSANYVKVRTTQPH-IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVY-LIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAH 2943
            S+ +  NY+K+ T +   ++ Y V F PPIDS  +RIK +    +  LG  K    FDG  LY+P LL NK T+        +  + +       +    C  +YN+LF R+   L  VK  R  F P +  ++   ++E+WPGYVT++  + GGL+L CDVSH+++   +V ++++++ +   N    Q +A   L+G IVLT +NNR Y+I DI + +N   +F+      SY +Y+K  + + I+D+ QP+I S       K+RG    +E    L + LIPELC LTGL D++  D +LMRE+    RV+P +R  AL +F +N+ +   A+++L  WG+++  ++  I+  +M+ E IYF  + SVSAG  AEF +    N+++  + +  WI+I  ++    A  LL  +      +G+    P ++ +++DR + Y++ L+RN+    Q+VV I    R+DRY AIKK C  + P+PSQV+ A+TL+   K+ SV   I LQ+N KLGG LW VKIP K  M+ G+D +HD   R  SV A V S N+  ++W+SK+ +Q + +EI+  L +     LK Y + N  LP  I +YRDG+ DGQL      EI QF  V        +  + Y VVQKRINTR++     +   + NP PGT+VD  +T++N+YDFFLVSQ VRQGTVTPTHYVVL D+  Y P  +Q ++YK C +YYNW GTVR+PA CM +H
Sbjct:  127 SVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND-HKDKLGGTK---TFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEM--RNCTQLYNILFDRVMKVLNYVKFDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQ--QNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIK-----KSRGIPAERE---NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFS-KISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMV-----CGNRIKISYIVVQKRINTRIF---SGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMVSH 842          
BLAST of SMEDWI-3 vs. Ensembl Fly
Match: aub (gene:FBgn0000146 transcript:FBtr0112793)

HSP 1 Score: 425.631 bits (1093), Expect = 1.799e-134
Identity = 253/783 (32.31%), Postives = 420/783 (53.64%), Query Frame = 1
Query:  730 LTLSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKET------IIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK---SNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQV----VLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCT-RWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEI----EQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +T+ ANY KV   +P+  IYQY V F P +++  +R    +       G++     FDG N++     K  +       ++  ++  +   + +K V +     +E   V N++ +R    L +  + R Y+ P+ KI L+  RM++WPGY TSI+  +  +LL  ++ HKV+R +++Y+I+ +    + +    Q+     ++G ++LT +NN+ YRI D+D+    L +F     +ISY DY+K  Y + IRDL+QP+++S+    N R G ++            + +IPEL   TG+TD M  DFR +R + EH R+ P +R E L  F   + SC+++ + L  W I ++   V I A  + PE I FGN+       +A++        +   + I  W +I+P   L +    +Q  +  +  + +    P   E+ +DR   Y + +    A   Q+V+ ++ +  E++Y+ IKK   VD PVPSQV    V+A   ++   L S+A  + +Q+NAKL G  W V IP+   M VG DV H  K +++S GA V + +   + R+FS  +   + +E+   +   M   L++Y E++  LPE I  +RDGV DGQL  V  +E+    ++  ++++S        M + +V KRIN+R +           NP PGT+VD  +T    YDFFLVSQ+VR GTV+PT Y V+ DN      ++Q+++YK  H+YYN+ GT+RVPA C YAHKLA++V +++   PS  L ++L++L
Sbjct:   40 ITVQANYFKV-LKRPNWTIYQYRVDFTPDVEATRLR----RSFLYEHKGILG-GYIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYYDPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICHKVMRTETLYNILSD---AIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSRPTDKNIRGGNDQA-----------IMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWTNEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGH-------RNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAESINRAPSAGLQNQLYFL 795          
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 290/781 (37.13%), Postives = 456/781 (58.39%), Query Frame = 1
Query:  688 IKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVA--PGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +KEP          + + +NY+ +      ++QYHV+F P ++S  MR     G+ +       E  AFDG  LY+P+ L+    +    K  ++ +     +       S+ C   YNV+ +R+   L +  +GR+++ P   ++L + R+++WPGY TSI++ DGGL L  DVSHKV+RNDSV D+M  I +   ++   Q     + +G IV+T +NNR YRI DI+W+K+    F    G   ++ DY++  YG+ I++L+QP+++ +   RS      +   +V  G + L+PEL  +TG+ + M KDFR M++L  H  V  ++  ++L + + NI S  EA   LG WG++I ++ +      +  E I   + AS       ++ + L  +  I  + +  W +  P+    +A  L+      +  +G+   +P  VE+ +DRTE ++K +   +   P VQLVV I++  R+D Y+AIKK C +  PVPSQ +  +T+ +  KL SVA  I LQIN KLGGELW V +P+K  MV+G+DV HDT  +SRSV   V S N++ T+W+S+   Q  ++EI+   + C+L+ L+ Y+E N+  PE I +YRDGVSDGQL  V+  EI Q  K FE+   +Y+P + + VVQKRI+T LY     + G    P+PGT++DHTVT  +  DF+L++ S+RQG   PTHY+ + + +  TP  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L +EP+  L ++LF+L
Sbjct:  283 VKEPLQKIGTKGSPIPIGSNYIPICCKNDAVFQYHVTFTPNVESLSMRF----GMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAERKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPNAVVILGKHRLQVWPGYSTSIKHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQ--GSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLIHRPKERS------RPGGKVITGEILLLPELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICL-HSASFVTSPAVDWSRELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETI-PNYEPKLAFIVVQKRISTTLYSYGSDHFG---TPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLSEKLFFL 1046          
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 290/781 (37.13%), Postives = 456/781 (58.39%), Query Frame = 1
Query:  688 IKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVA--PGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +KEP          + + +NY+ +      ++QYHV+F P ++S  MR     G+ +       E  AFDG  LY+P+ L+    +    K  ++ +     +       S+ C   YNV+ +R+   L +  +GR+++ P   ++L + R+++WPGY TSI++ DGGL L  DVSHKV+RNDSV D+M  I +   ++   Q     + +G IV+T +NNR YRI DI+W+K+    F    G   ++ DY++  YG+ I++L+QP+++ +   RS      +   +V  G + L+PEL  +TG+ + M KDFR M++L  H  V  ++  ++L + + NI S  EA   LG WG++I ++ +      +  E I   + AS       ++ + L  +  I  + +  W +  P+    +A  L+      +  +G+   +P  VE+ +DRTE ++K +   +   P VQLVV I++  R+D Y+AIKK C +  PVPSQ +  +T+ +  KL SVA  I LQIN KLGGELW V +P+K  MV+G+DV HDT  +SRSV   V S N++ T+W+S+   Q  ++EI+   + C+L+ L+ Y+E N+  PE I +YRDGVSDGQL  V+  EI Q  K FE+   +Y+P + + VVQKRI+T LY     + G    P+PGT++DHTVT  +  DF+L++ S+RQG   PTHY+ + + +  TP  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L +EP+  L ++LF+L
Sbjct:  283 VKEPLQKIGTKGSPIPIGSNYIPICCKNDAVFQYHVTFTPNVESLSMRF----GMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAERKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPNAVVILGKHRLQVWPGYSTSIKHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQ--GSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLIHRPKERS------RPGGKVITGEILLLPELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICL-HSASFVTSPAVDWSRELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETI-PNYEPKLAFIVVQKRISTTLYSYGSDHFG---TPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLSEKLFFL 1046          
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:368200])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 295/770 (38.31%), Postives = 452/770 (58.70%), Query Frame = 1
Query:  718 SSPSLTLSANYVKVRTTQP--HIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S  ++ L AN++++  ++P   +YQYHV + PP++SR +R  ++    E+    + +A  FDG  L++P  L+N ET++       + V     +       S  C   YN+LF+RI   L M +IGR Y+ P+    + + R+ IWPG++T+I  ++  ++L  DVSHKV+R+++V D M  + +   ++ +   A   +L+G I+LT +NN+ YRI DI W     + F KG  +IS+++YFK+ YGL I D  Q ++VS              S     G   L+PE C LTGLTD M  DF +M++L  H R++P++R   +   + NI    + +  L  WG++ E   +++N   +  E I  G  A       A++ + +    +I  + ++NW++   +     A  LLQ L   S  +G+   +  ++E   DR E  L+ L++NVA   Q+VV IL   R+D+Y+ +KK+  VDCP PSQ V+++T+ +   L +VA  IALQ+N K+GGELW+V+IP+++ M+VG+D +HDT    RS+GA+V S N   +RWFSK  LQ + +EI+  L+  +   LKAY + NN LP  I +YRDGV DG L  V   E+ Q  +  ++   DY+P +   VV+KRI++R +    +  G+I NP PGT++D  VTR   YDFF+VSQ+VR G V PTHY V+ DNS   P  +Q + YK CH+YYNW G VRVPAPC YAHKLA++VGQ++  EP+  L D L+YL
Sbjct:  106 SGTAIELRANFMRL-LSRPMWALYQYHVDYKPPMESRRLRSALLFQHEET----LGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDDPFNIPQHRLTIWPGFMTTILQYESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQ-RFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGP-------SGRPPPGPAMLVPEFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYE-DRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYEPKLSVVVVKKRISSRFFA---RIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPNMNLDDFLYYL 858          
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:368200])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 295/770 (38.31%), Postives = 452/770 (58.70%), Query Frame = 1
Query:  718 SSPSLTLSANYVKVRTTQP--HIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S  ++ L AN++++  ++P   +YQYHV + PP++SR +R  ++    E+    + +A  FDG  L++P  L+N ET++       + V     +       S  C   YN+LF+RI   L M +IGR Y+ P+    + + R+ IWPG++T+I  ++  ++L  DVSHKV+R+++V D M  + +   ++ +   A   +L+G I+LT +NN+ YRI DI W     + F KG  +IS+++YFK+ YGL I D  Q ++VS              S     G   L+PE C LTGLTD M  DF +M++L  H R++P++R   +   + NI    + +  L  WG++ E   +++N   +  E I  G  A       A++ + +    +I  + ++NW++   +     A  LLQ L   S  +G+   +  ++E   DR E  L+ L++NVA   Q+VV IL   R+D+Y+ +KK+  VDCP PSQ V+++T+ +   L +VA  IALQ+N K+GGELW+V+IP+++ M+VG+D +HDT    RS+GA+V S N   +RWFSK  LQ + +EI+  L+  +   LKAY + NN LP  I +YRDGV DG L  V   E+ Q  +  ++   DY+P +   VV+KRI++R +    +  G+I NP PGT++D  VTR   YDFF+VSQ+VR G V PTHY V+ DNS   P  +Q + YK CH+YYNW G VRVPAPC YAHKLA++VGQ++  EP+  L D L+YL
Sbjct:  106 SGTAIELRANFMRL-LSRPMWALYQYHVDYKPPMESRRLRSALLFQHEET----LGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDDPFNIPQHRLTIWPGFMTTILQYESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQ-RFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGP-------SGRPPPGPAMLVPEFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYE-DRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYEPKLSVVVVKKRISSRFFA---RIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPNMNLDDFLYYL 858          
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 480.33 bits (1235), Expect = 7.698e-152
Identity = 260/729 (35.67%), Postives = 414/729 (56.79%), Query Frame = 1
Query:  688 IKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVA--PGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQ 2862
            +KEP          + + +NY+ +      ++QYHV+F P ++S  MR     G+ +       E  AFDG  LY+P+ L+    +    K  ++ +     +       S+ C   YNV+ +R+   L +  +GR+++ P   ++L + R+++WPGY TSI++ DGGL L  DVSHKV+RNDSV D+M  I +   ++   Q     + +G IV+T +NNR YRI DI+W+K+    F    G   ++ DY++  YG+ I++L+QP+++ +   RS      +   +V  G + L+PEL  +TG+ + M KDFR M++L  H  V  ++  ++L + + NI S  EA   LG WG++I ++ +      +  E I   + AS       ++ + L  +  I  + +  W +  P+    +A  L+      +  +G+   +P  VE+ +DRTE ++K +   +   P VQLVV I++  R+D Y+AIKK C +  PVPSQ +  +T+ +  KL SVA  I LQIN KLGGELW V +P+K  MV+G+DV HDT  +SRSV   V S N++ T+W+S+   Q  ++EI+   + C+L+ L+ Y+E N+  PE I +YRDGVSDGQL  V+  EI Q  K FE+   +Y+P + + VVQKRI+T LY     + G    P+PGT++DHTVT  +  DF+L++ S+RQG   PTHY+ + + +  TP  +Q
Sbjct:  283 VKEPLQKIGTKGSPIPIGSNYIPICCKNDAVFQYHVTFTPNVESLSMRF----GMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAERKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPNAVVILGKHRLQVWPGYSTSIKHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQ--GSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLIHRPKERS------RPGGKVITGEILLLPELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICL-HSASFVTSPAVDWSRELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETI-PNYEPKLAFIVVQKRISTTLYSYGSDHFG---TPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLTPDHLQ 994          
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Match: cd74 (CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 320/856 (37.38%), Postives = 489/856 (57.13%), Query Frame = 1
Query:  460 ENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLT-LSANYVK-VRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            E  EP    + VGRGR     +   ++STP   + +L+      +  +      +  F ++         R+    +KE   ++  SS S+  LS N++K +   Q  ++QYH+ +AP ++SR +R  ++    E    ++ +ARAFDG  L++P+ L     +    +  +   + + +          C   YN++F+R+   + M +IGR+Y+ P  +I +    + I+PG+ TSI  ++  ++L  DVSHKV+R+++V D M  +N+ V +  +        L+GQIVLT +NN+ YRI DI+W     S F K  G +IS+ DY++  Y   I DL QP +V          + P+G + V  G + LIPE C LTGLTD M  DF +M++L  H R+ P++R   + +F+ NI+  +  +K L  WG+  +   +         E I    + +    + A++ + L    +I    ++NW+L+  +     AN L Q L   S ++G+   +  +VE++ D T+ Y+K L++ V P VQ+VV +LS+ R+D+Y+AIKK+  +DCPVPSQ VLA+TL +   + SVA  IALQ+N K+GGELW V+IP+K+ M+VG+D +HDT    RS+GA V S N   TRWFS+  LQ Q +EI+  L+ CM + LKA+F  N  LP  I +YRDGV DGQL  + + EI Q      S   DY P +   VV+KR++ R +       G++ NP PGTIVD  +TR   YDFF++SQSVR G+V+PTHY V+ D+    P  +Q + YK CH+YYNWPG +RVPAPC YAHKLA++VGQ++  EP   L DRL+YL
Sbjct:   37 EQAEP----EIVGRGR---QKRASVAHSTPVTQAGDLQISAGFQEISLGDRGGRRRDFHDL-----GINTRQAIEHVKE---SKTGSSGSIIQLSTNHIKLISRPQWVLFQYHIDYAPQMESRGLRCALLFQHEE----LIGKARAFDGTMLFLPKRLDKVNEVFSQTRNGETVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYYNPNDQIEISSHGLTIYPGFSTSILQYENNIMLSIDVSHKVLRSETVLDYMYNVNQKVESH-KFHDICSKDLIGQIVLTKYNNKTYRIDDINWDFTPESTFKKSDGSEISFVDYYRTQYNKGITDLNQPALVHNP-------KKPRGPQNVPAGPILLIPEFCFLTGLTDRMRSDFNVMKDLAIHTRLAPEQREIQVGKFLKNIHKDDSVQKELQDWGLNFDSKLLPFAGRVAPAEKILQAGKTADYNPQFADWSRELRGPTLIRVKHLDNWVLLYTRRNYDAANTLTQNLFKVSGQMGIKMNRAVMVEVD-DTTDAYVKVLQQKVTPDVQMVVCLLSSNRKDKYDAIKKYLCIDCPVPSQCVLAKTLNKPQTVVSVATKIALQMNCKMGGELWTVEIPLKELMIVGIDCYHDTLSGKRSIGAFVASLNPSMTRWFSRCVLQAQKQEIVDGLKVCMHAALKAWFNCNKSLPSRIIIYRDGVGDGQLKTMVEYEIPQLQDCIRSAEKDYSPKLTVIVVKKRVSARFFA---HVGGRLQNPPPGTIVDVEITRPEWYDFFIISQSVRVGSVSPTHYNVVYDSGALKPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPHLTLSDRLYYL 861          
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Match: cd74 (CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847])

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 320/856 (37.38%), Postives = 489/856 (57.13%), Query Frame = 1
Query:  460 ENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLT-LSANYVK-VRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            E  EP    + VGRGR     +   ++STP   + +L+      +  +      +  F ++         R+    +KE   ++  SS S+  LS N++K +   Q  ++QYH+ +AP ++SR +R  ++    E    ++ +ARAFDG  L++P+ L     +    +  +   + + +          C   YN++F+R+   + M +IGR+Y+ P  +I +    + I+PG+ TSI  ++  ++L  DVSHKV+R+++V D M  +N+ V +  +        L+GQIVLT +NN+ YRI DI+W     S F K  G +IS+ DY++  Y   I DL QP +V          + P+G + V  G + LIPE C LTGLTD M  DF +M++L  H R+ P++R   + +F+ NI+  +  +K L  WG+  +   +         E I    + +    + A++ + L    +I    ++NW+L+  +     AN L Q L   S ++G+   +  +VE++ D T+ Y+K L++ V P VQ+VV +LS+ R+D+Y+AIKK+  +DCPVPSQ VLA+TL +   + SVA  IALQ+N K+GGELW V+IP+K+ M+VG+D +HDT    RS+GA V S N   TRWFS+  LQ Q +EI+  L+ CM + LKA+F  N  LP  I +YRDGV DGQL  + + EI Q      S   DY P +   VV+KR++ R +       G++ NP PGTIVD  +TR   YDFF++SQSVR G+V+PTHY V+ D+    P  +Q + YK CH+YYNWPG +RVPAPC YAHKLA++VGQ++  EP   L DRL+YL
Sbjct:   17 EQAEP----EIVGRGR---QKRASVAHSTPVTQAGDLQISAGFQEISLGDRGGRRRDFHDL-----GINTRQAIEHVKE---SKTGSSGSIIQLSTNHIKLISRPQWVLFQYHIDYAPQMESRGLRCALLFQHEE----LIGKARAFDGTMLFLPKRLDKVNEVFSQTRNGETVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYYNPNDQIEISSHGLTIYPGFSTSILQYENNIMLSIDVSHKVLRSETVLDYMYNVNQKVESH-KFHDICSKDLIGQIVLTKYNNKTYRIDDINWDFTPESTFKKSDGSEISFVDYYRTQYNKGITDLNQPALVHNP-------KKPRGPQNVPAGPILLIPEFCFLTGLTDRMRSDFNVMKDLAIHTRLAPEQREIQVGKFLKNIHKDDSVQKELQDWGLNFDSKLLPFAGRVAPAEKILQAGKTADYNPQFADWSRELRGPTLIRVKHLDNWVLLYTRRNYDAANTLTQNLFKVSGQMGIKMNRAVMVEVD-DTTDAYVKVLQQKVTPDVQMVVCLLSSNRKDKYDAIKKYLCIDCPVPSQCVLAKTLNKPQTVVSVATKIALQMNCKMGGELWTVEIPLKELMIVGIDCYHDTLSGKRSIGAFVASLNPSMTRWFSRCVLQAQKQEIVDGLKVCMHAALKAWFNCNKSLPSRIIIYRDGVGDGQLKTMVEYEIPQLQDCIRSAEKDYSPKLTVIVVKKRVSARFFA---HVGGRLQNPPPGTIVDVEITRPEWYDFFIISQSVRVGSVSPTHYNVVYDSGALKPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPHLTLSDRLYYL 841          
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Match: piwil3 (piwi-like RNA-mediated gene silencing 3 [Source:NCBI gene;Acc:100496286])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 294/770 (38.18%), Postives = 449/770 (58.31%), Query Frame = 1
Query:  718 SSPSLTLSANYVK-VRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVS-KSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S  ++ LS N++K V   Q  +YQYH+ + P ++SR +R  ++    E    ++ +ARAFDG  L+ P+ L     +    +  +   + + +          C   YN++F+R+   + M +IGR+Y+ P   I + +  + IWPG+ TSI  ++  ++L  DVSHKV+R+++V D+M ++ +   ++     A   +LLGQIVLT +NN+ YRI +I W     S F K  G  IS+ DY++  Y  +IRDL Q +I +     R G + GP          + L+PELC LTGLTD M  DF +MR+L  H R+ P +R + +  F++ I+  E  +K L  WG+  +K  +        PE I      +    + A++ + +    +I    ++NW+L+ P+     A  L+Q L   + ++G+     ++ E++ DR   Y++ L   V P  Q+VV +LS++ +++Y++IKK+  +  P PSQ V+A+TL +   + SVA  IA+Q+N K+GGELW+V+IP+ + MV+G+D +HDT    RS+   V S N   TRW+S+  LQ+Q +EI+  L+ C+ + L A+F  N  LP  I +YRDGV DGQL  +   EI QF    +S   DY P +   VV+KRIN R +       G+I NP PGT+VD  VTR   YDFF+VSQSVRQGTV+PTHY V+ D+S   P  +Q + YK CH+YYNWPG +RVPAPC YAHKLA++VGQ++  EP   L +RL+YL
Sbjct:  119 SGSTIQLSTNHIKLVSRPQWVLYQYHIDYNPQMESRRLRTALLYQHEE----LIGKARAFDGTMLFAPKRLNKATEVFSQTRNGENVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYYNPSDPIEISQHNLTIWPGFTTSILQYETSIMLSLDVSHKVLRSETVLDVMTKLYRMHGDR-DFADAVTKELLGQIVLTKYNNKTYRIDEICWNMTPQSTFKKSDGSDISFVDYYRMQYNKEIRDLRQALIANIPRRVRPGGDTGP----------IVLVPELCNLTGLTDRMRNDFGVMRDLAVHTRLPPDQREKQVARFLNYIHKDENVQKELRDWGLNFDKQLLPFVGRVSPPERILQAGRTADYNPQFADWSREMRGQTLISVRHLDNWMLLYPRRCYDAAQTLVQTLNKVAQQIGMRMNNVRMFEVD-DRANSYIQVLNAEVNPDTQMVVCVLSSIHKEKYDSIKKYLCLQIPTPSQCVVARTLSKPQTVLSVATKIAMQMNCKMGGELWSVEIPLGEMMVIGIDCYHDTLSGKRSIAGFVASMNRNLTRWYSRCVLQDQKQEIVDGLKVCLQASLHAWFNCNKNLPSRILIYRDGVGDGQLKTLVNYEIPQFLDCIKSAGRDYCPKLSIIVVKKRINARFFA---HLGGRIQNPPPGTVVDVEVTRPEWYDFFIVSQSVRQGTVSPTHYNVVYDSSGLKPDYMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHKEPHLALSNRLYYL 869          
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Match: setx (senataxin [Source:Xenbase;Acc:XB-GENE-966858])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 301/781 (38.54%), Postives = 446/781 (57.11%), Query Frame = 1
Query:  694 EPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNP-EMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPG---VQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            EP   +        L  N +K+      +YQYHV+F P ++ R MR     G+ +    V     AFDG  LY+P  L     +    +   + +     +       S+ C   YNV+ +R+   L +  +GR+++ P    VL + R+++WPGY  +I+  DGGL L  D++HK+IR+DSV DIM  + +   +    Q     QL+G IV+T +NNR YRI DI+W  +    F    G K+S+ DY+   YG+ +++L+QP+++ + + R    + PKG K +D  +V L+PEL  +TG+ + M KDFR M++L +   ++PK+ H +L + +  I S  +AK  L  WG+ ++ D +++   ++ P E I   N  S  AGE   + + +        + +  W +I PK    +A  L   L      +G+    P  VE+ +DR E Y + +K ++  G   VQL+V ++S  R+D Y AIKK C V  PVPSQV+  +T+ +  KL S+A  I LQIN KLGGELW V IP+K  MV+G+DV+HD     RSV   V S N+  T W+S+   Q  ++EIM  L+ C+++ L+ +FE N+ LPE I +YRDGVSDGQL  V+  EI Q    F++F  +Y P MV  VVQKR++T LY +     GQ   P PGT++DHTVT     DFFL+S  VRQG   PTHY+ + + +   P  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L  EPS  LCD+LF+L
Sbjct:  189 EPLPKKGSKGSPCQLGLNLIKINFQNEAVYQYHVTFTPIVECRSMRF----GMMKDHRSVTGPVTAFDGSILYLPVKLAQTVELESERRTDGQKIKITIQMTKILDPSSDLCLPFYNVVMRRVFKILDLKLVGRNFYDPASSTVLQQYRLQVWPGYAANIRKTDGGLFLLVDITHKIIRSDSVLDIMNILYQ--QSPENFQDEVTKQLVGSIVITRYNNRTYRIDDIEWNMSPKDSFSMSDGSKVSFIDYYSKNYGITVKELDQPLLLHRPSER----KAPKG-KALD--IVLLLPELAFMTGIPEKMRKDFRAMKDLTQQIHLSPKQHHISLGKLLKRIESSADAKNELQRWGLFLDTD-IHMTTGRILPIEKINLRNN-SFPAGEDLNWNREVTREACRSSVHLLYWAMIYPKRASAQAQELSSMLERIGGPIGIRVNHPNCVELRDDRVETYARSIK-SLLEGEGKVQLLVCLISGTRDDLYGAIKKLCCVQNPVPSQVINTRTISQPQKLRSIAQKILLQINCKLGGELWGVDIPLKSVMVIGMDVYHDPSRGMRSVLGFVASINSCLTAWYSRVVFQLPNQEIMDSLKLCLVAALQKFFEVNHSLPEKIVVYRDGVSDGQLNTVENYEIPQLQTCFQTFD-NYNPRMVVIVVQKRVSTNLYST---ATGQFLTPQPGTVIDHTVTNRKWIDFFLMSHHVRQGCGIPTHYICVMNTANLGPDHLQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQFLHHEPSIKLCDKLFFL 949          
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Match: setx (senataxin [Source:Xenbase;Acc:XB-GENE-966858])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 302/791 (38.18%), Postives = 453/791 (57.27%), Query Frame = 1
Query:  691 KEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNP-EMIYFGNEASVSAGEQAEF---------KQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPG---VQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +EP   +        L  N +K+      +YQYHV+F P ++ R MR     G+ +    V     AFDG  LY+P  L     +    +   + +     +       S+ C   YNV+ +R+   L +  +GR+++ P    VL + R+++WPGY  +I+  DGGL L  D++HK+IR+DSV DIM  + +   +    Q     QL+G IV+T +NNR YRI DI+W  +    F    G K+S+ DY+   YG+ +++L+QP+++ + + R    + PKG K +D  +V L+PEL  +TG+ + M KDFR M++L +   ++PK+ H +L + +  I S  +AK  L  WG+ ++ D +++   ++ P E I   N  S  AGE   +         + ++++N ++  + +  W +I PK    +A  L   L      +G+    P  VE+ +DR E Y + +K ++  G   VQL+V ++S  R+D Y AIKK C V  PVPSQV+  +T+ +  KL S+A  I LQIN KLGGELW V IP+K  MV+G+DV+HD     RSV   V S N+  T W+S+   Q  ++EIM  L+ C+++ L+ +FE N+ LPE I +YRDGVSDGQL  V+  EI Q    F++F  +Y P MV  VVQKR++T LY +     GQ   P PGT++DHTVT     DFFL+S  VRQG   PTHY+ + + +   P  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L  EPS  LCD+LF+L
Sbjct:   36 REPLPKKGSKGSPCQLGLNLIKINFQNEAVYQYHVTFTPIVECRSMRF----GMMKDHRSVTGPVTAFDGSILYLPVKLAQTVELESERRTDGQKIKITIQMTKILDPSSDLCLPFYNVVMRRVFKILDLKLVGRNFYDPASSTVLQQYRLQVWPGYAANIRKTDGGLFLLVDITHKIIRSDSVLDIMNILYQ--QSPENFQDEVTKQLVGSIVITRYNNRTYRIDDIEWNMSPKDSFSMSDGSKVSFIDYYSKNYGITVKELDQPLLLHRPSER----KAPKG-KALD--IVLLLPELAFMTGIPEKMRKDFRAMKDLTQQIHLSPKQHHISLGKLLKRIESSADAKNELQRWGLFLDTD-IHMTTGRILPIEKINLRNN-SFPAGEDLNWNREVTREACRSSVSNNTIV--VHLLYWAMIYPKRASAQAQELSSMLERIGGPIGIRVNHPNCVELRDDRVETYARSIK-SLLEGEGKVQLLVCLISGTRDDLYGAIKKLCCVQNPVPSQVINTRTISQPQKLRSIAQKILLQINCKLGGELWGVDIPLKSVMVIGMDVYHDPSRGMRSVLGFVASINSCLTAWYSRVVFQLPNQEIMDSLKLCLVAALQKFFEVNHSLPEKIVVYRDGVSDGQLNTVENYEIPQLQTCFQTFD-NYNPRMVVIVVQKRVSTNLYST---ATGQFLTPQPGTVIDHTVTNRKWIDFFLMSHHVRQGCGIPTHYICVMNTANLGPDHLQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQFLHHEPSIKLCDKLFFL 804          
BLAST of SMEDWI-3 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 292/766 (38.12%), Postives = 465/766 (60.70%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  +    AFDG  L++P+ L++K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M  +  +T  +K Q Q +   +L+G IVLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V +P+K  M+VG+D +HDT    RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  + +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+N R +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ D+S   P  +Q + YK CH+YYNWPG +RVPAPC YAHKLA++VGQ++  EP+  L +RL+YL
Sbjct:  115 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGRCHAFDGTILFLPKRLQHKVTEVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSDPIDIPNHRLVIWPGFTTSILQYENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVS--KELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQMKKAIMIEVD-DRTEAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYNPRLTVIVVKKRVNARFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDSSGLKPDHIQRLTYKLCHVYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYYL 862          
BLAST of SMEDWI-3 vs. Ensembl Mouse
Match: Piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:MGI Symbol;Acc:MGI:1930036])

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 299/766 (39.03%), Postives = 442/766 (57.70%), Query Frame = 1
Query:  733 TLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEF-DKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKR--NVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +L  N +K++     +YQYHV+F+P ++ + MR     G+ +    V     AFDG  LY+P  L+    +    K  D  +     +       S+ C   YNV+F+R+   L M  +GR+++ P   +VL + R++IWPGY  SI+  DGGL L  DVSHKVIRNDSV D+M  I +   NK   Q      L+G IV+T +NNR YRI D+DW K     F    G++I++ +Y+   YG+ +++ +QP+++ + + R   N G      +  G + L+PEL  +TG+ + M KDFR M++L +   ++PK+ H AL   +  I   E A   L  WG+++ KD   I    +  E I   N + V++ E   + + +  +  I  I +  W L  PK  + +A  L+  L   +  +G+    P  VE+ +DR E Y++ ++    V   +Q+VV I+   R+D Y AIKK C V  PVPSQV+  +T+ +  +L SVA  I LQ+N KLGGELW V IP+K+ MV+G+DV+HD     RSV   V S N   T+W+S+   Q   +EI+  L+ C++  LK Y+E N+ LPE I +YRDGVSDGQL  V   EI Q  K FE+F  +Y P MV  VVQK+I+T LY++ P +      P+PGT+VDHT+T     DF+L++  VRQG   PTHY+ + + +  +P  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L  EP+  LC  LF+L
Sbjct:  223 SLGLNLIKIQCHNEAVYQYHVTFSPSVECKSMRF----GMLKDHQSVTGNVTAFDGSILYLPVKLQQVVELKSQRKTDDAEISIKIQLTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPGYAASIRRTDGGLFLLADVSHKVIRNDSVLDVMHAIYQ--QNKEHFQDECSKLLVGSIVITRYNNRTYRIDDVDWNKTPKDSFVMSDGKEITFLEYYSKNYGITVKEDDQPLLIHRPSERQ-NNHG-----MLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLTQQINLSPKQHHGALECLLQRISQNETASNELTRWGLSLHKDVHKIEGRLLPMERINLRNTSFVTS-EDLNWVKEVTRDASILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRISPPAWVELKDDRIETYIRTIQSLLGVEGKIQMVVCIIMGTRDDLYGAIKKLCCVQSPVPSQVINVRTIGQPTRLRSVAQKILLQMNCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKYYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFD-NYHPKMVVFVVQKKISTNLYLAAPDH---FVTPSPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYICVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQILHHEPAIQLCGNLFFL 971          
BLAST of SMEDWI-3 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 514.227 bits (1323), Expect = 1.283e-167
Identity = 270/731 (36.94%), Postives = 436/731 (59.64%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTV 2913
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  +    AFDG  L++P+ L++K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M  +  +T  +K Q Q +   +L+G IVLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V +P+K  M+VG+D +HDT    RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  + +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+N R +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ D+S   P  +Q + YK CH+YYNWP +V
Sbjct:  115 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGRCHAFDGTILFLPKRLQHKVTEVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSDPIDIPNHRLVIWPGFTTSILQYENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVS--KELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQMKKAIMIEVD-DRTEAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYNPRLTVIVVKKRVNARFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDSSGLKPDHIQRLTYKLCHVYYNWPVSV 827          
BLAST of SMEDWI-3 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 474.167 bits (1219), Expect = 3.952e-152
Identity = 274/791 (34.64%), Postives = 438/791 (55.37%), Query Frame = 1
Query:  670 REYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQP-HIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDK-GGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVG----VMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKP-NMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            RE  T +K+ C T +   P + L  N   +   Q   +YQYHV+++P + SR +RI ++   S     +  +A+AFDG +L++ + L  K T +       +T+     + +     S  C   +NV+F++I  +L M +IGR+++ P + + + + ++ +WPG+  S+ +F+  LL   DV++KV+RN++V D M ++          +     QL+G +VLT +NN+ YRI DIDW+      F K  G +++Y DY+K  Y + + DL QP++VS    +   N  P+        +V+L+PELC LTGL+     DFRLM+ + E  R++P  R + L   VD+I     A+  L  WG+      +++    +  E I   +     A   A++ + +   KV+    +  W+++       +A  L++A +S   RVG       G PKI++++ +    +L+ ++ +  P VQLV+ IL + +++ Y++IKK+   DCPVPSQ VL +TL +   + SVA  IA+Q+  KLGGELW+V+IP+K  MVVG+D+  D   ++  V   V S N+  TRWFS+  LQ    +I   L+ CM   L  ++  N+ LP  I +YRDGV +GQL  V + E+ Q  K      +D +   +   VV+KR   RL+ S       + NP  GT+VD   TR   YDF+L+SQ+  +GTV+PTHY V+ D++   P  +Q + +K CH+YYNW G + VPAPC YAHKL ++V Q++  EPS  L + LFYL
Sbjct:   83 REKLTHVKD-CKTGSSGIP-VRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSI----LSDKAKAFDGASLFLSEKLDQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFYKPSEPVEIPQYKLSLWPGFAISVSHFESKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCH-KQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRNDNSEPQ--------MVHLMPELCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRNPVARFELETWGLHFGSQ-LSLTGRVVPSEKILLQDHTCQPAFA-ADWSKDMRSCKVLSSQPLNRWLIVC----CNRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVD-ETPAAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTMLSVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTECGSDARSCRLSVVVVRKRCLLRLFASTDHT---VQNPPLGTVVDSEATRPEWYDFYLISQTANRGTVSPTHYNVIYDDNALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHKEPSLELANNLFYL 848          
BLAST of SMEDWI-3 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 397.512 bits (1020), Expect = 1.052e-122
Identity = 257/818 (31.42%), Postives = 412/818 (50.37%), Query Frame = 1
Query:  670 REYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQP-HIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDK-GGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIY-SCEEAKKLLGY-----WG----------------------ITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVG----VMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            RE  T +K+ C T +   P + L  N   +   Q   +YQYHV+++P + SR +RI ++   S     +  +A+AFDG +L++ + L  K T +       +T+     + +     S  C   +NV+F++I  +L M +IGR+++ P + +       EI P Y          LL   DV++KV+RN++V D M ++          +     QL+G +VLT +NN+ YRI DIDW+      F K  G +++Y DY+K  Y + + DL QP++VS    +   N  P+        +V+L+PELC LTGL+     DFRLM+ + E  R++P  R + L   VD+I  +   ++++L +     W                       +T    +  I    + P    F  + + +A    ++ + +   KV+    +  W+++       +A  L++A +S   RVG       G PKI++++ +    +L+ ++ +  P VQLV+ IL + +++ Y++IKK+   DCPVPSQ VL +TL +   + SVA  IA+Q+  KLGGELW+V+IP+K  MVVG+D+  D   ++  V   V S N+  TRWFS+  LQ    +I   L+ CM   L  ++  N+ LP  I +YRDGV +GQL  V + E+ Q  K      +D +                                             YDF+L+SQ+  +GTV+PTHY V+ D++   P  +Q + +K CH+YYNW G + VPAPC YAHKL ++V Q++  EPS  L + LFYL
Sbjct:  146 REKLTHVKD-CKTGSSGIP-VRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSI----LSDKAKAFDGASLFLSEKLDQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFYKPSEPV-------EI-PQY--------NKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCH-KQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRNDNSEPQ--------MVHLMPELCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRTLPSSQEVLSHTSLPLWAPEPGGLSSAIPLSTVLPFAQQLLTALSLSPGIPLPHLKPPSFLFLCQPAFAA----DWSKDMRSCKVLSSQPLNRWLIVC----CNRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVD-ETPAAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTMLSVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTECGSDAR---------------------------------------------YDFYLISQTANRGTVSPTHYNVIYDDNALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHKEPSLELANNLFYL 878          
BLAST of SMEDWI-3 vs. UniProt
Match: sp|A9ZSZ2|AGO3_BOMMO (Piwi-like protein Ago3 OS=Bombyx mori OX=7091 GN=AGO3 PE=1 SV=2)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 330/854 (38.64%), Postives = 503/854 (58.90%), Query Frame = 1
Query:  496 GRGRGLLN----SQKECSNSTPSEVSNELKQMKISNDDKMT---VSSEAKSQFENIEKPISKFRRREYPTQIKE--PCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG--GE--KISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            GRG  LL     SQK  S    S+V++  +       +KM+   VS++A S  +N           +Y  ++K+  P   + ++   + ++ NY+ +   +  +++Y V F P  D + +R K++    E      KE + FDG  LY+P  L +    +    P D++ V+V ++F      SE   +YNV+FK I   L++++ GR ++     I + + ++E+WPGYVT++  ++GGL+L  D +H+V+R  +V  ++ E+ +T     + +   I  L+G  V+T +N + +R+  ID   +  S F+K   GE  +IS+ DY+K  YG++I D +QP+++S+   R        GS      ++ LIPELC LTGLTDD   +FRLM+++  + R+TP +RH A  ++++++   E AK  L  WG++I  +TVN+ A  + PE +YFG+   V     AE+   +  + V+  + I  W+L+  +     A   L  L      +G+M    ++V + NDRT+ Y+  LK+ +   VQLVV I S  R+DRY AIKK C  D PVPSQV+ A+TL    K+ S+   I LQ+N KLGG LW++ IP K  M+VG+D +HD   R+RSV + V S N   T W+SK   QE+ +EI+  L+ C++  L  Y   N  LP+ I +YRDGV DGQL  +Q+ EI Q    F    ++Y+P + Y VVQKRINTR+++   K++   +NPNPGT+VDH +TR + YDF +VSQ V QGTVTPTHYVV+ D+S  TP Q Q + YK CH+YYNWPGTVRVPAPC YAHKL+Y+VGQ + A+PS++L D+LF+L
Sbjct:  100 GRGFKLLQNLQASQKASSQIASSQVTSSAQSDIKDLTEKMSETSVSAQASSVAKN-----------KYFREVKDTPPVVKKGETGVPIEVTCNYIYLNFKENIVFEYEVKFEPDQDYKHLRFKLLNEHIEH----FKE-KTFDGTTLYVPHELPDAVRNLVSTNPYDQSKVNVSIIFRRTRRLSEMIHIYNVMFKCIMKDLKLIRFGRQHYNEHAAIQIPQHKLEVWPGYVTAVDEYEGGLMLTLDSTHRVLRTQTVLSLIKEVVQTEGANWKRKMTDI--LIGASVMTTYNKKLFRVDTIDDKMSPRSTFEKTEKGETVQISFIDYYKKNYGIEIMDWDQPLLISRDTKRM------PGSDTPTDFMICLIPELCQLTGLTDDQRSNFRLMKDVATYTRITPNQRHAAFKKYIESVMKNETAKSRLAGWGLSIAPETVNLTARTLPPETLYFGDNVRVPGKPNAEWNSEVTKHSVMQAVDIMRWVLLFTQRDKQVAMDFLSTLKRNCRPMGIMVSDAELVPLANDRTDTYVLALKKCITSSVQLVVAICSTKRDDRYAAIKKVCCADNPVPSQVINARTLMNTNKIRSITQKILLQLNCKLGGTLWSISIPFKSAMIVGIDSYHDPSRRNRSVCSFVASYNQSMTLWYSKVIFQEKGQEIVDGLKCCLVDALTHYLRSNGQLPDRIIIYRDGVGDGQLKLLQQYEIPQMKICFTILGSNYQPTLTYVVVQKRINTRIFL---KSRDGYDNPNPGTVVDHCITRRDWYDFLIVSQKVTQGTVTPTHYVVVYDDSGITPDQCQRLTYKMCHLYYNWPGTVRVPAPCQYAHKLSYLVGQCVHAQPSDVLVDKLFFL 926          
BLAST of SMEDWI-3 vs. UniProt
Match: sp|A6N7Y9|PIWL1_CHICK (Piwi-like protein 1 OS=Gallus gallus OX=9031 GN=PIWIL1 PE=2 SV=1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 295/771 (38.26%), Postives = 457/771 (59.27%), Query Frame = 1
Query:  718 SSPSLTLSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S   + L AN+ ++ T++P   +YQYHV + P +++R +R     GL      ++ +  AFDG  L++P+ L NK T +       + V     +       S  C   YN++F+R+   +   +IGR+Y+ P+  + +   R+ +WPG+ +SI  ++  ++L  DVSHK++R+++V D M  + + V  + + + A   +L+G IVLT +NNR YR+ DIDW  N    F +  G +ISY DY+K  Y   I DL QP+++S+   + G          V  G V LIPELC LTGLT+ M  DF +M++L  H R++P++R   + + VD +   E  +K L  WG++ +   ++     +  E I           + A++ +      +I    ++NW+LI  +     AN LLQ L   +P +G+   K  ++E++ DRTE YL+ L++++ P   +VV ILS+ R+D+Y+AIKK+   DCP+PSQ V+A+TL +     ++   IALQ+N K+GGELW+V+IP+K+ M+VG+D +HDT    +S+   V S N   TRWFS+  +Q + +EI+  L++C+ + L+ +F+ N +LP  I +YRDGV DGQL  +   E+ QF    ++   DY P +   VV+KR++TR +    +  G + NP PGT+VD  VTR   YDFF+VSQ+VR G V PTHY V+ D SK  P  VQ + YK CH+YYNW G +RVPAPC YAHKLA++VGQ++  EP+ LL DRL+YL
Sbjct:  116 SGAMIKLIANFFRL-TSRPQWALYQYHVDYNPEMEARRLR----SGLLFQHEDLIGKTHAFDGSILFLPKRLPNKVTEVYSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKMMNFQQIGRNYYNPKDPVSIPNHRLMVWPGFTSSILQYEESIMLCADVSHKILRSETVLDFMYSLYEQVEER-RFRDACAKELIGVIVLTKYNNRTYRVDDIDWDANPQCTFRRADGSEISYIDYYKRQYNQDISDLNQPVLISQYRRKRGN---------VTVGPVVLIPELCYLTGLTEKMRNDFNMMKDLAVHTRLSPEQRQREIGKLVDCMKKDECVQKELRDWGLSFDSSLLSFTGRVVQAEKILQAGNVFDYNPQFADWSRETRVAPLIHAKPLDNWLLIYTRRNYDAANMLLQNLFKVTPSMGIRMNKATMIEVD-DRTEAYLRVLQQSITPDTNIVVCILSSTRKDKYDAIKKYLCTDCPIPSQCVVARTLSKPQTALAIVTKIALQMNCKMGGELWSVEIPLKQLMIVGIDCYHDTLSGKQSIAGFVASLNEKMTRWFSRCVVQSRGQEIVDGLKACLQTALREWFKWNKYLPSRIIVYRDGVGDGQLNTLVNYEVPQFLDCLKTVGKDYNPRLTVIVVKKRVSTRFFA---QAGGGLKNPPPGTVVDIEVTRPEWYDFFIVSQAVRNGCVAPTHYNVVYDTSKLKPDHVQRLTYKLCHMYYNWSGVIRVPAPCQYAHKLAFLVGQSIHREPNLLLSDRLYYL 867          
BLAST of SMEDWI-3 vs. UniProt
Match: sp|Q96J94|PIWL1_HUMAN (Piwi-like protein 1 OS=Homo sapiens OX=9606 GN=PIWIL1 PE=1 SV=1)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 295/766 (38.51%), Postives = 465/766 (60.70%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  + +  AFDG  L++P+ L+ K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M    ++T  +K Q Q +   +L+G +VLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V IP+K  M+VG+D +HD     RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  I +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+NTR +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ DNS   P  +Q + YK CHIYYNWPG +RVPAPC YAHKLA++VGQ++  EP+  L +RL+YL
Sbjct:  114 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPIDIPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS--KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYYL 861          
BLAST of SMEDWI-3 vs. UniProt
Match: sp|Q9JMB7|PIWL1_MOUSE (Piwi-like protein 1 OS=Mus musculus OX=10090 GN=Piwil1 PE=1 SV=1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 292/766 (38.12%), Postives = 465/766 (60.70%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  +    AFDG  L++P+ L++K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M  +  +T  +K Q Q +   +L+G IVLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V +P+K  M+VG+D +HDT    RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  + +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+N R +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ D+S   P  +Q + YK CH+YYNWPG +RVPAPC YAHKLA++VGQ++  EP+  L +RL+YL
Sbjct:  115 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGRCHAFDGTILFLPKRLQHKVTEVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSDPIDIPNHRLVIWPGFTTSILQYENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVS--KELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQMKKAIMIEVD-DRTEAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYNPRLTVIVVKKRVNARFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDSSGLKPDHIQRLTYKLCHVYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYYL 862          
BLAST of SMEDWI-3 vs. UniProt
Match: sp|Q8TC59|PIWL2_HUMAN (Piwi-like protein 2 OS=Homo sapiens OX=9606 GN=PIWIL2 PE=1 SV=1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 301/766 (39.30%), Postives = 443/766 (57.83%), Query Frame = 1
Query:  733 TLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNV-APG-VQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +L  N VK++     +YQYHV+F+P ++ + MR     G+ +    V     AFDG  LY+P  L+    +    K     +     +       S+ C   YNV+F+R+   L M  +GR+++ P   +VL + R++IWPGY  SI+  DGGL L  DVSHKVIRND V D+M  I +   NK   Q      L+G IV+T +NNR YRI D+DW K     F    G++I++ +Y+   YG+ +++ +QP+++ + + R   N G      +  G + L+PEL  +TG+ + M KDFR M++L +   ++PK+ H AL   +  I   E A   L  WG+ ++KD   I    +  E I   N + +++ E    K+ +  +  I  I +  W L  PK  + +A  L+  L   +  +G+    P  VE+ +DR E Y++ ++  + A G +Q+VV I+   R+D Y AIKK C V  PVPSQVV  +T+ +  +L SVA  I LQIN KLGGELW V IP+K+ MV+G+DV+HD     RSV   V S N   T+W+S+   Q   +EI+  L+ C++  LK ++E N+ LPE I +YRDGVSDGQL  V   EI Q  K FE+F  +Y+P MV  VVQK+I+T LY++ P+N      P PGT+VDHT+T     DF+L++  VRQG   PTHYV + + +  +P  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ G  L  EP+  LC+ LF+L
Sbjct:  225 SLGLNLVKIQCHNEAVYQYHVTFSPNVECKSMRF----GMLKDHQAVTGNVTAFDGSILYLPVKLQQVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPGYAASIRRTDGGLFLLADVSHKVIRNDCVLDVMHAIYQ--QNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQ-DNHG-----MLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIAKNEAATNELMRWGLRLQKDVHKIEGRVLPMERINLKNTSFITSQELNWVKE-VTRDPSILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYVRTIQSTLGAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQINCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFE-NYQPKMVVFVVQKKISTNLYLAAPQN---FVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHHEPAIQLCENLFFL 973          
BLAST of SMEDWI-3 vs. TrEMBL
Match: gnl|BL_ORD_ID|20308729 (tr|B2Z3D6|B2Z3D6_SCHMD Piwi protein WI-3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1885.15 bits (4882), Expect = 0.000e+0
Identity = 958/960 (99.79%), Postives = 959/960 (99.90%), Query Frame = 1
Query:  139 LLMQKFLNKDVLVPSVESLEDKALNKLGIPLPGSTVEKNTEXXXXXXXXXXXXXXXXXXXNIKLQDSDIENRNITIVTRPLSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LLMQKFLNKDVLVPSVESLEDKALNKLGIP PGSTVEKNTESSSISSGDSRSNPSGDSRNNIKLQDSDIENRNITIVTRPLSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYF+NTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL
Sbjct:   15 LLMQKFLNKDVLVPSVESLEDKALNKLGIPPPGSTVEKNTESSSISSGDSRSNPSGDSRNNIKLQDSDIENRNITIVTRPLSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFRNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 974          
BLAST of SMEDWI-3 vs. TrEMBL
Match: gnl|BL_ORD_ID|19602695 (tr|D2Z0E0|D2Z0E0_DUGJA DjPiwiC OS=Dugesia japonica OX=6161 GN=DjpiwiC PE=2 SV=1)

HSP 1 Score: 1734.15 bits (4490), Expect = 0.000e+0
Identity = 871/962 (90.54%), Postives = 904/962 (93.97%), Query Frame = 1
Query:  139 LLMQKFLNKDVLVPSVESLEDKALNKLGIPLPGSTVEKNTEXXXXXXXXXXXXXXXXXXXNIKLQDSDIENRNITIVTRPLSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSS-EAKSQFENIEKPI-SKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LLMQKFLNKDV VPSVESLEDKALNKLGIP PGST EK TESSSISSGDS S         +KLQDSDIEN+NITIV RPLSCIGRGRGLSNPSSL TSSG+SDKI E +E  Q+KK +GRGRGLL+SQKECSNSTPSE+SNELK +K+SNDDKMTVSS E KSQFEN EKP  SKFRRRE+PTQIKE CNTRND SPS+ LSANYVKV TTQPHIYQYHVSFAP IDSRLMRIKIVQGLSE  LGVVKEARAFDGMNLYIPQ LKNKET+IKVNKPTD T VDVK+VFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINK+VNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDW KNCLSEFDK GEKISYRDYFKNTYGLQIRDLEQP+IVSKSNSR  K R  KGSK+ DGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIY+CEEA KLLGYWGITIEKDTVNI ACKMNPEMIYFGNEASVSAGE AEFKQALAHN+VI GIRIENW+L++PKSL+TKANGLLQALMSKSP++GV F KP+I+EMNNDRTEEY+KELKRNV   VQLVVTILSAVREDRYNAIKK CYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHD KGR RSVGAVVGSTNALCTRWFSKSHLQE DKEI+YVLQSCMLSLLKAYFEENNFLP+TIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQ+NNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNS+YTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPS+LLCDRLFYL
Sbjct:   15 LLMQKFLNKDVPVPSVESLEDKALNKLGIPPPGSTTEKTTESSSISSGDSSS--------KLKLQDSDIENKNITIVKRPLSCIGRGRGLSNPSSLATSSGQSDKIAEIDETNQVKKVIGRGRGLLSSQKECSNSTPSEISNELKDLKLSNDDKMTVSSVEDKSQFENSEKPTTSKFRRREHPTQIKEACNTRNDQSPSIILSANYVKVYTTQPHIYQYHVSFAPTIDSRLMRIKIVQGLSEDQLGVVKEARAFDGMNLYIPQQLKNKETVIKVNKPTDNTSVDVKIVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKSVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWTKNCLSEFDKSGEKISYRDYFKNTYGLQIRDLEQPLIVSKSNSRGPKGR--KGSKDADGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYNCEEANKLLGYWGITIEKDTVNIKACKMNPEMIYFGNEASVSAGENAEFKQALAHNRVISGIRIENWVLVAPKSLMTKANGLLQALMSKSPKIGVNFSKPRIIEMNNDRTEEYIKELKRNVTSSVQLVVTILSAVREDRYNAIKKHCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDAKGRGRSVGAVVGSTNALCTRWFSKSHLQEHDKEIVYVLQSCMLSLLKAYFEENNFLPDTIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQVNNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSRYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSHLLCDRLFYL 966          
BLAST of SMEDWI-3 vs. TrEMBL
Match: gnl|BL_ORD_ID|21301975 (tr|G9B7B8|G9B7B8_9PLAT Piwi C (Fragment) OS=Phagocata kawakatsui OX=1051007 GN=piwiC PE=2 SV=1)

HSP 1 Score: 887.486 bits (2292), Expect = 0.000e+0
Identity = 414/534 (77.53%), Postives = 470/534 (88.01%), Query Frame = 1
Query: 1438 FKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGG-LVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHD------TKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            FKNTY L +RDLEQP++VSK+ +R    +GPK + E +    VYLIPELCMLTGLTDDM+KDFRLMRELHEHCRVTPKKRHE LL+FV+NI +CEEA +LLGYWGITI+  TVNI+ACK+ PEMI FG +A+VSAG+QA+FKQA+ HN+VIGG+RIENW++I+PKSL++KA+  LQALMSK PR+G+MF  PK+VEM  DRTE+Y++ELKRNV  GVQLVVT+LSAVREDRYNAIKK CYVD PVPSQVVL  TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFM VGLDVWHD      +KG  +SVGAVVGSTNALCTRW SK   Q   +EI+ VLQSCM+ +LKAY+EENNFLPETIFMYRDGVSDGQLG VQ+TEIEQF K FE+FS DYKP+++YN+VQKRINTRL+V+DP++K QI NP PGT+VDHTVTR+NLYDFFLVSQSVRQGTVTPTHYVVL DNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLK EPSNL+ DRLFYL
Sbjct:    1 FKNTYNLTVRDLEQPLLVSKTKARK---QGPKPTNEKESSEFVYLIPELCMLTGLTDDMVKDFRLMRELHEHCRVTPKKRHEGLLQFVENIRNCEEATRLLGYWGITIDNGTVNIDACKLTPEMIQFGGDATVSAGDQADFKQAIGHNRVIGGMRIENWVMITPKSLVSKAHAFLQALMSKGPRIGIMFKNPKLVEMQTDRTEDYIRELKRNVTSGVQLVVTLLSAVREDRYNAIKKLCYVDSPVPSQVVLGNTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMAVGLDVWHDAAMRGRSKGAGKSVGAVVGSTNALCTRWHSKCAFQRPHQEIVDVLQSCMIGILKAYYEENNFLPETIFMYRDGVSDGQLGLVQRTEIEQFLKAFETFSPDYKPSLIYNIVQKRINTRLFVTDPRSKDQILNPGPGTVVDHTVTRSNLYDFFLVSQSVRQGTVTPTHYVVLYDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKVEPSNLMSDRLFYL 531          
BLAST of SMEDWI-3 vs. TrEMBL
Match: gnl|BL_ORD_ID|21104785 (tr|A0A2I7YUY6|A0A2I7YUY6_EISFE Piwi2 OS=Eisenia fetida OX=6396 PE=2 SV=1)

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 363/859 (42.26%), Postives = 529/859 (61.58%), Query Frame = 1
Query:  496 GRGRGLLNSQK---------ECSNSTPS------EVSNELKQMKISNDDKMTVSSEAKSQF-ENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDK-GGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQI-NNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            G GR  L SQK           S S PS      E++  L    +S   K+ +  EA  +     E+P    R  +     + P   +      ++ SANY+ +R     +YQY VSF P +DSR MR K+   L+E    V+ E +AFDG  L++P LL+ +ET++K  +  D+  + +K+     + F+ C  +YNV+F+RI + LRMV++GR+YF P   + + + R+E+WPGYVT++  ++GG++LQ DVSH+V+R ++V +++  I +  NN    Q     QL+G +VLT +NN+ YRI DI W KN LS F    GE I++ DY++  Y   I+D  QP+++     R  +   PKG K ++  ++ LIPEL  +TGLTD++ +D R+M++L  H R+TP +R  +L  F  N+ S  EA+  L  WG+ ++ D + +    ++ E I   N  +  AG +A++ +AL  + VI  + + NW++++     +KA   +   M  +  +G+   KP + ++ NDRTE YL+E+++ +   VQ+VVTI    R+DRYNAIKK C V+CPVPSQV+ A+T+ +  KL SV   IALQIN KLGGELWAVKIP K  MV G+D +HD+  +  SV   V S NA CTRW+S+   Q   +E+++ LQ C  + L+ Y E N+ LPE I +YRDGV DGQL  V   E+ Q  + F+ F ADY+PN+   VVQKRINTR+          I +NP PG+I+DHTVTR + +DFFLVSQ VRQGTV+PTHY+V+ D S +   ++Q+++YK  H+YYNWPGTVRVPAPC YAHKLAY+VGQN++ EPS LL DRLF+L
Sbjct:  147 GLGRAALLSQKYLGGTGLDAAASTSVPSGLRSVRELAAALPPPPVSGISKVEMVEEAHPESPAATEEPTKLQRMLDRLEAERAPVVRKGSLGEKVSFSANYIALRCVNAGVYQYAVSFRPAVDSRGMRFKM---LNEHK-SVIGETKAFDGAILFLPILLREQETVLKSIRQNDEQEITIKIQLVKVLPFASCRQLYNVVFRRIMSILRMVQVGRNYFLPSGAVPVPQHRLEVWPGYVTTVDEYEGGVMLQTDVSHRVLRTETVLNVISGIIR--NNPRGYQDDINKQLIGCMVLTRYNNKTYRIDDIAWDKNPLSSFASITGENITFVDYYRTAYNKVIQDHHQPLLIHIPKKRELRE-APKGKKALE--VICLIPELSFMTGLTDEIRQDHRVMKDLATHTRITPAQRRISLRNFSKNVNSVPEARAELKKWGLELDADIMELEGRILSQEKIVLRNRTT-DAGVEADWSRALTRDHVITAVDLLNWMIVTTSRDASKALEFVNMYMQCARDMGIRVEKPAVYQLQNDRTETYLREIRQKMTDQVQMVVTIFPTSRDDRYNAIKKLCCVECPVPSQVINARTISQQQKLRSVTQKIALQINCKLGGELWAVKIPTKGLMVCGVDTYHDSVQKKSSVAGFVSSVNATCTRWYSRVCCQAPGEELVHGLQVCFTASLRKYHEINHKLPERIIIYRDGVGDGQLSTVANFEVVQLMECFKHFGADYEPNLAVVVVQKRINTRILSRKGTGPNAIMDNPPPGSILDHTVTRKDWFDFFLVSQHVRQGTVSPTHYIVVHDTSNWDVDKLQMLSYKMTHLYYNWPGTVRVPAPCQYAHKLAYLVGQNIRKEPSLLLSDRLFFL 995          
BLAST of SMEDWI-3 vs. TrEMBL
Match: gnl|BL_ORD_ID|21537415 (tr|A0A0L8HBN2|A0A0L8HBN2_OCTBM Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22018299mg PE=3 SV=1)

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 346/890 (38.88%), Postives = 538/890 (60.45%), Query Frame = 1
Query:  379 LSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPS--------LTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGG--EKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS  GRG  L+          +SD  +   EP  +   V  GRGL   Q          ++N  K+  I      ++SS A +  +N  + +S    R+    +++  + ++D S S        + LSANY++++T    ++QYHVSF P IDS+ +R K++   ++    V  + RAFDG  LY+P  L N+ET++   + +D   + + +     +    C  +YN++F+R+ + L+M ++GR Y+ P     + + ++EIWPGY+T+I+  +GGLLL  D SHKV+R ++V D+++ + +   +  + +  A+  ++G +VLT +NN+ YR+ DI W  +  ++F   G  E IS+ +Y++  Y  +I D  QP+++ K   ++ ++    G   V   L+ LIPE C +TGLTDDM  DFR+M+++  H RVTP +R   L  FV++I S E+A + L  WG+  E  ++ I      PE I    E    A E+A++ + L+   VI  + ++NW++I+ K  + K+   +  +M  +  +G+   +PK++E  + RTE  ++ L+  +   +QLVV I    R+D+Y+A+KK C V+CPVPSQV++A+T+ +  KL SV   IALQIN KLGG+LWA+ IP+   MV+G+DV+HD+    RS+GA V STN   TRWFS+   Q+ ++E++  L++C++  LK Y E N+ LP+ I ++RDGVSD QL  V   E+EQ  K F+ F   Y P +   +VQKR+NTR++++    + Q++NP PGTIVDH++TR N YDFFLVSQ VRQGTVTPTHY+V+ D S      VQ + YK  H+YYNWPGT+RVPAPC YAHKLAY+VGQN+  EPS+ L DRL++L
Sbjct:   29 LSRFGRGLALTRAMEACALKEQSDSESPFPEP-LLPATVPIGRGLAAMQ---------ALTNAAKKQPIERPLGSSLSSNAPAVGKNSSQELS----RQSSVSVEDLYSPQHDLSESHRGTKGKKIPLSANYIRIKTRNEGVFQYHVSFNPEIDSKSVRYKMLYEHTD----VTGKTRAFDGAILYLPIKLPNQETVLASTRLSDGEKITITIKMVKVLKSESCIPLYNIMFRRVMSILQMKQVGRYYYNPNTPTSVPQHKLEIWPGYITAIKEHEGGLLLMADASHKVLRKETVLDVLVSLVR--QDAARFRDNAMRTIVGSVVLTRYNNKTYRVDDIAWDMSPNNKFVSSGSKESISFIEYYRKQYNREISDTNQPLLIHKPKKKALQH----GDGPVKSELICLIPEFCYMTGLTDDMRSDFRVMKDIAAHTRVTPMQRQLTLNRFVESIKSNEDAMQQLTNWGLYFEDASIQIEGRYFQPERIIM-RERDFVASEEADWGRDLSRASVITPVPLQNWVVITCKQDIGKSKDYISMMMKVTGPMGIDVSQPKLIETRDQRTETLIRLLRETIHKNLQLVVIIFPTSRDDKYSAVKKLCCVECPVPSQVIIARTISQQQKLRSVTQKIALQINCKLGGDLWALSIPLSGIMVIGIDVYHDSSKGHRSIGAFVASTNNNLTRWFSRVCFQQPNQELIDGLKTCLIGALKKYHEMNHILPKRIVVFRDGVSDSQLSVVSGYEVEQLSKCFQHFGDTYSPLLSVIIVQKRVNTRIFIN---RRNQVDNPAPGTIVDHSITRKNWYDFFLVSQHVRQGTVTPTHYIVVHDTSAMKVDHVQRLTYKMTHLYYNWPGTIRVPAPCQYAHKLAYLVGQNIHKEPSHSLADRLYFL 890          
BLAST of SMEDWI-3 vs. Ensembl Cavefish
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:103023762])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 319/855 (37.31%), Postives = 479/855 (56.02%), Query Frame = 1
Query:  472 PGQIKKFVGRGRGLLNSQKECSNSTPSE----VSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRT-TQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            P    + VGRGR     Q+    +  SE    +S   +Q+KI            +  F +     +    R+    +KE  +    S   + L AN++++ +  Q  +YQYHV F PP++SR +R  ++    E+    + +AR FDG  L++P  L N ET++       + V     +       S  C   YN++F+RI   L M +IGR Y+ P+  + + + R+ IWPG+VT+I  ++  ++L  DVSHKV+R+++V D M  + K   ++ +   A   +L+G IVLT +NN+ YRI DI W     + F +G   IS++DY+K  YGL I D  Q ++VS+             S     G   LIPE C LTGLTD M  DF +M++L  H R+TP++R   L  F+ NI    EA+  L  WG++ E   + +    +  E I  G+         A++ + +    +I  + +E+W++   +     A  LLQ L   S  +G+   +  ++E   DR E  L+ L++NV P  Q+VV IL   R+D+Y+ +KK+  VDCP PSQ V+++TL     L +VA  IALQ+N K+GGELW+++IP+K+ M+VG+D +HDT    RS+GA+V S N   +RWFSK  LQ + +EI+  L+  +   LKAY++ NN LP  I +YRDGV DG L  V   E+ Q  +  ++   DY P +   VV+KRI +R +    +  G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ DNS   P  +Q + YK CH+YYNW G VRVPAPC YAHKLA++VGQ++  EP+  L D L+YL
Sbjct:   36 PSAEGELVGRGR-----QRRAPGAVASEALLQISAGFQQVKIGE------RGGRRRDFHD-----AGVHTRQLMEHVKE--SKTGVSGSKIELRANFMRLLSRPQWALYQYHVDFKPPMESRRLRSALLFQHDET----LGKARTFDGAILFLPHRLHNTETVLCSETRHGERVQITVTLTNELPPSSPVCLQFYNIIFRRILRMLNMQQIGRHYYNPDDPLNIPQHRLTIWPGFVTNILQYESSIMLCTDVSHKVLRSETVLDFMYNLRKQCGDQ-RFPDACTKELVGLIVLTKYNNKTYRIDDIAWDHTPNNTFKRGDADISFKDYYKTQYGLDITDGNQVLLVSEVKRMGP-------SGAPPPGPALLIPEFCYLTGLTDKMRNDFNIMKDLSSHTRLTPEQRESRLNRFITNISRNTEAQNELSTWGLSFENKLLGLTGRVLPAERILQGSRTYDYNPWAADWSKEMRGLPLISSMPLESWLMFYTRRNSDVAQSLLQTLNRVSGPMGIRMQRAVMIEYE-DRQESLLRALQQNVGPDTQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTLSRPQALMTVATKIALQMNCKMGGELWSIEIPLKQLMIVGIDCYHDTAAGKRSIGALVASLNHGMSRWFSKCVLQSRGQEIIDGLKGALKGALKAYWKYNNCLPSRIIVYRDGVGDGMLQSVVNYEVPQIMQSIKTMGEDYMPKLTVVVVKKRIASRFFA---RIDGKLTNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVFDNSGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPNINLDDFLYYL 856          
BLAST of SMEDWI-3 vs. Ensembl Cavefish
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:103024883])

HSP 1 Score: 555.058 bits (1429), Expect = 3.217e-180
Identity = 293/782 (37.47%), Postives = 450/782 (57.54%), Query Frame = 1
Query:  691 KEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPM---VYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVA--PGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +EP         S+T+ ANY+ +R     ++QYHV+F P +++  MR     G+ +       E  AFDG  LY+P+ L   E +    +           +    V    C +    YNV+ +R+   + +  +GRD++ P   IVL + R+++WPGY T I+  DGGL L  DVSHKV+RNDSV +IM  I +   +    Q     + +G IV+T +NNR YRI DI W+K+    F    G + ++ DY++  YG+ +++++QP++V +   RS       G K++  G + L+PEL  +TG+ + M KDFR M++L  H  V+ ++   ++ + + NI S  EA   L  WG+ I  + +      +  E I     AS  +   A++ + +  +  I  I +  W +  P+    +A  L+      +  +G+   +P  VE+ +DRTE Y+K ++  +   P VQLVV I++  R+D Y+AIKK C V  P PSQ +  +T+ +  KL S+A  I LQ+N KLGGELW V +P+K  MV+G+DV HD   + RSV   V S N+L TRW+S+   Q  ++EI+   + C+L+ L+ Y+E N+  PE I +YRDGVSDGQL  V++ EI Q  K FE+F  +Y+P + + VVQKRI+T LY    +  G    P PGT++DHTVT  +  DFFL++ S+RQG   PTHY+ + + +  TP  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L +EP+  L D+L++L
Sbjct:  341 REPLKKAGTKGNSITIGANYIPIRCKNEAVFQYHVTFTPNVEALSMRF----GMMKDHRSTTGEVVAFDGSILYLPKRL--DEVVHLKAERKTDNQEIDIKIQMTKVLPPHCDLCIPFYNVVLRRVMKIVGLKLVGRDHYDPSNAIVLGKHRLQVWPGYSTCIKETDGGLYLGVDVSHKVLRNDSVLNIMGVIYQ--QSPEHFQDECTKEFVGAIVITRYNNRTYRIDDIKWSKSPKDSFTLADGSETTFIDYYRKNYGITVKEIDQPLLVHRPKERSK-----PGGKQIITGEILLLPELSFMTGIPEKMRKDFRAMKDLTVHINVSAEQHTHSIKQLLQNINSNPEALNELQRWGLEISPEILMTQGRTLPMETICL-QSASFVSSSSADWSREVVRDASISSIPLYCWAVFYPRRAAEQAEELVTMFGKVAGPIGIKLERPIRVELRDDRTETYVKSIQSQLTSEPNVQLVVCIITGNRDDLYSAIKKLCCVQSPCPSQAINVRTISQPQKLRSIAQKILLQMNCKLGGELWTVSVPLKHLMVIGVDVHHDVSKKKRSVMGFVASLNSLLTRWYSRVTFQMPNEEIINGFRVCLLAALQKYYEMNHSFPEKIVIYRDGVSDGQLKTVEQYEIPQILKCFETF-PNYEPKLTFIVVQKRISTTLYSYGGERFG---TPPPGTVLDHTVTNKDWVDFFLMAHSIRQGCGLPTHYISVYNTANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLADKLYFL 1104          
BLAST of SMEDWI-3 vs. Ensembl Cavefish
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:103024883])

HSP 1 Score: 554.673 bits (1428), Expect = 1.214e-179
Identity = 293/782 (37.47%), Postives = 450/782 (57.54%), Query Frame = 1
Query:  691 KEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPM---VYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVA--PGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +EP         S+T+ ANY+ +R     ++QYHV+F P +++  MR     G+ +       E  AFDG  LY+P+ L   E +    +           +    V    C +    YNV+ +R+   + +  +GRD++ P   IVL + R+++WPGY T I+  DGGL L  DVSHKV+RNDSV +IM  I +   +    Q     + +G IV+T +NNR YRI DI W+K+    F    G + ++ DY++  YG+ +++++QP++V +   RS       G K++  G + L+PEL  +TG+ + M KDFR M++L  H  V+ ++   ++ + + NI S  EA   L  WG+ I  + +      +  E I     AS  +   A++ + +  +  I  I +  W +  P+    +A  L+      +  +G+   +P  VE+ +DRTE Y+K ++  +   P VQLVV I++  R+D Y+AIKK C V  P PSQ +  +T+ +  KL S+A  I LQ+N KLGGELW V +P+K  MV+G+DV HD   + RSV   V S N+L TRW+S+   Q  ++EI+   + C+L+ L+ Y+E N+  PE I +YRDGVSDGQL  V++ EI Q  K FE+F  +Y+P + + VVQKRI+T LY    +  G    P PGT++DHTVT  +  DFFL++ S+RQG   PTHY+ + + +  TP  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L +EP+  L D+L++L
Sbjct:  371 REPLKKAGTKGNSITIGANYIPIRCKNEAVFQYHVTFTPNVEALSMRF----GMMKDHRSTTGEVVAFDGSILYLPKRL--DEVVHLKAERKTDNQEIDIKIQMTKVLPPHCDLCIPFYNVVLRRVMKIVGLKLVGRDHYDPSNAIVLGKHRLQVWPGYSTCIKETDGGLYLGVDVSHKVLRNDSVLNIMGVIYQ--QSPEHFQDECTKEFVGAIVITRYNNRTYRIDDIKWSKSPKDSFTLADGSETTFIDYYRKNYGITVKEIDQPLLVHRPKERSK-----PGGKQIITGEILLLPELSFMTGIPEKMRKDFRAMKDLTVHINVSAEQHTHSIKQLLQNINSNPEALNELQRWGLEISPEILMTQGRTLPMETICL-QSASFVSSSSADWSREVVRDASISSIPLYCWAVFYPRRAAEQAEELVTMFGKVAGPIGIKLERPIRVELRDDRTETYVKSIQSQLTSEPNVQLVVCIITGNRDDLYSAIKKLCCVQSPCPSQAINVRTISQPQKLRSIAQKILLQMNCKLGGELWTVSVPLKHLMVIGVDVHHDVSKKKRSVMGFVASLNSLLTRWYSRVTFQMPNEEIINGFRVCLLAALQKYYEMNHSFPEKIVIYRDGVSDGQLKTVEQYEIPQILKCFETF-PNYEPKLTFIVVQKRISTTLYSYGGERFG---TPPPGTVLDHTVTNKDWVDFFLMAHSIRQGCGLPTHYISVYNTANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLADKLYFL 1134          
BLAST of SMEDWI-3 vs. Ensembl Cavefish
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:103024883])

HSP 1 Score: 513.842 bits (1322), Expect = 1.681e-164
Identity = 260/648 (40.12%), Postives = 393/648 (60.65%), Query Frame = 1
Query: 1084 IGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVA--PGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +GRD++ P   IVL + R+++WPGY T I+  DGGL L  DVSHKV+RNDSV +IM  I +   +    Q     + +G IV+T +NNR YRI DI W+K+    F    G + ++ DY++  YG+ +++++QP++V +   RS       G K++  G + L+PEL  +TG+ + M KDFR M++L  H  V+ ++   ++ + + NI S  EA   L  WG+ I  + +      +  E I     AS  +   A++ + +  +  I  I +  W +  P+    +A  L+      +  +G+   +P  VE+ +DRTE Y+K ++  +   P VQLVV I++  R+D Y+AIKK C V  P PSQ +  +T+ +  KL S+A  I LQ+N KLGGELW V +P+K  MV+G+DV HD   + RSV   V S N+L TRW+S+   Q  ++EI+   + C+L+ L+ Y+E N+  PE I +YRDGVSDGQL  V++ EI Q  K FE+F  +Y+P + + VVQKRI+T LY    +  G    P PGT++DHTVT  +  DFFL++ S+RQG   PTHY+ + + +  TP  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L +EP+  L D+L++L
Sbjct:  468 VGRDHYDPSNAIVLGKHRLQVWPGYSTCIKETDGGLYLGVDVSHKVLRNDSVLNIMGVIYQ--QSPEHFQDECTKEFVGAIVITRYNNRTYRIDDIKWSKSPKDSFTLADGSETTFIDYYRKNYGITVKEIDQPLLVHRPKERSKP-----GGKQIITGEILLLPELSFMTGIPEKMRKDFRAMKDLTVHINVSAEQHTHSIKQLLQNINSNPEALNELQRWGLEISPEILMTQGRTLPMETICL-QSASFVSSSSADWSREVVRDASISSIPLYCWAVFYPRRAAEQAEELVTMFGKVAGPIGIKLERPIRVELRDDRTETYVKSIQSQLTSEPNVQLVVCIITGNRDDLYSAIKKLCCVQSPCPSQAINVRTISQPQKLRSIAQKILLQMNCKLGGELWTVSVPLKHLMVIGVDVHHDVSKKKRSVMGFVASLNSLLTRWYSRVTFQMPNEEIINGFRVCLLAALQKYYEMNHSFPEKIVIYRDGVSDGQLKTVEQYEIPQILKCFETF-PNYEPKLTFIVVQKRISTTLYSYGGERFG---TPPPGTVLDHTVTNKDWVDFFLMAHSIRQGCGLPTHYISVYNTANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLADKLYFL 1103          
BLAST of SMEDWI-3 vs. Ensembl Cavefish
Match: ago4 (protein argonaute-4 [Source:NCBI gene;Acc:103043810])

HSP 1 Score: 175.637 bits (444), Expect = 1.119e-44
Identity = 177/693 (25.54%), Postives = 286/693 (41.27%), Query Frame = 1
Query: 1066 SLRMVKIGRDYFYPEKKIV--LDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVI-RNDSVYDIMMEINKTVNNKGQMQ----------TAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD---KGGEKI--SYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTG-------LTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAH----------NKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVE-------MNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVV-LAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKK-------FMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQ--EQD--------KEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAY 2955
            S+R   +GR +F P +     L   R E+W G+  S++     ++L  DVS     R   V + M E+    N   Q +          T  I  L  ++       R YR+ ++         F    + G+ +  +   YFK  Y LQ++    P +      +                  YL  E+C +         LTD+          +    R  P  R E +   V +          L  +GI +  D   +    +   M+ +G   S   G      + +A            +   GI I+ W +            LL++   +  ++    G P   +          D  E   K LK +   G+QL+V IL   +   Y  +K+       + +Q V +   +K  P+  S   N+ L+INAKLGG +  V +P ++        + +G DV H   G  +  S+ AVVGS +   +R+ +   +Q   QD        +E++  L + +  LL  +++   F P  I  YR GVS+GQ+  V   E+    K   S   DY+P + Y VVQKR +TRL+ SD   + G+  N   GT VD T+T  + +DF+L S +  QGT  P+HY VL D++ +T  ++QL+ Y+ CH Y     +V +PAP  YA  +A+
Sbjct:  163 SMRYTPVGRSFFSPPEGYYHPLGGGR-EVWFGFHQSVRPAMWNMMLNIDVSATAFYRAQPVIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQYFKQKYSLQLKYPHLPCLQVGQEQKH----------------TYLPLEVCNIVAGQRCIKKLTDNQTSTM-----IKATARSAPD-RQEEISRLVKSNSMVGGPDPYLKEFGIVVHNDMTEVTGRVLPAPMLQYGGRVSTDTGRDCGRNKTVATPNQGVWDMRGKQFYAGIEIKVWAVACFAPQKQCREDLLKSFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFKHLKMSYV-GLQLIVVILPG-KTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLS---NLCLKINAKLGG-INNVLVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQDLSQEQLYSQEVIQDLTNMVRELLIQFYKSTRFKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCSDKAERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAF 826          
BLAST of SMEDWI-3 vs. Ensembl Sea Lamprey
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 293/781 (37.52%), Postives = 459/781 (58.77%), Query Frame = 1
Query:  688 IKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEF-DKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVA--PGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +++P          L ++ NY+++R +   IYQYHV+F+P +DS   R     GL      V+   +AFDG  LY+P+ L +   +          +             S+ C  +YN++FK+I   L +  IG+ Y  P + IV++R R+ IWPGYV ++Q  DGGL+L  DVSH+V+R DSV ++M  + ++  +    Q      L+G +V+T +NNR YRI DI W K   S F +  G+ +S+ +Y+K  Y + I DL QP+++ ++  R+      +   +V    + LIPEL  +TG+TD M  DF +M+ + EH R+ P  RH +L+EF+ N+    EA++ L  WG+ ++ D   ++  ++ PE+I    +A   + E A++ + + +   I  + ++NW ++         +  +  + +  P +G++   P I+E+ ND T+ Y+  +++N +   GVQ+V+ I   +R+DRY+ +K+ C V+  VPSQVV  +T+ +  +L SVA  + LQ+N KLGGELW + IP+K  MVVG+DV+H+     +SV   V S N   +RW+S+   Q   +E++  L  CM S +K Y+E N++LPE I MYRDGVSD QL  V+  E+ Q    F +F   Y+P M+  VVQKRI+T ++++   N G + N   G+++D   T    +DFFLVSQ VRQGTV+PTHYVV+ ++ K +   VQ + YK  H+YYNW GTVRVPAPC YAHKLA +VG+NL ++P   LCD+LF+L
Sbjct:    9 VRQPIQKIGTYGTPLEIATNYIRLRCSNEAIYQYHVTFSPDVDSTNTRF----GLLNEHKSVIGNTKAFDGCVLYLPRKLDDNLNLTSKRISDGVEITLSIKCTKIIKPDSDLCLPIYNIIFKKIMRLLELKLIGKSYLNPRQPIVINRYRIHIWPGYVVAVQKKDGGLMLMLDVSHRVLRMDSVLEVMTHLYESCQSSANFQEECTKALVGHVVITRYNNRTYRIDDIAWDKTPKSTFLNSAGKTMSFVEYYKTQYEITIDDLGQPLLLHRAKQRN------RTDDQVVIQTICLIPELAYMTGITDLMRSDFSMMKAISEHMRLGPSLRHNSLMEFISNVKRNPEAQQELSNWGLQMDSDIYKLSGRQLPPEIIRLQYKAFAFSPE-ADWTRHIVNTPCITAVAMKNWQVLCTHRDSFLVHEFVTMMCNVGPPMGLVHQLPNIIELPNDHTKTYIDCIRKNYSYSQGVQMVMCIFPTLRDDRYSTVKQVCCVELAVPSQVVQTRTISQQKRLRSVAQKVVLQMNCKLGGELWILDIPLKNLMVVGVDVFHNVVLGKQSVVGFVASMNRSVSRWYSRVVRQSTSQELVDGLNLCMTSAIKKYYELNHYLPEKIIMYRDGVSDNQLAIVRDFEVMQLTNGFRTFDLSYQPKMLVVVVQKRISTNIFLN---NSGAMENAPSGSVLDTVATSQEWFDFFLVSQHVRQGTVSPTHYVVIFNSLKLSADHVQRLTYKMTHLYYNWSGTVRVPAPCQYAHKLASLVGENLHSDPDPGLCDKLFFL 775          
BLAST of SMEDWI-3 vs. Ensembl Sea Lamprey
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:368200])

HSP 1 Score: 496.893 bits (1278), Expect = 2.344e-161
Identity = 267/769 (34.72%), Postives = 448/769 (58.26%), Query Frame = 1
Query:  718 SSPSLTLSANYVKVRTTQP-HIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S   + L  NY K+ + +   +YQYHV+F+P ++S+ +RI ++   +E    ++ E RAFDG  LY+P+ L+    +    +   K  + + +      +     +++N++F+++   + M +IGR+Y+ P+    + + R+ +WPG+VTSI  ++  ++L  DVSHK++RN+SV D M  + + +  +     A   +L+GQ++LT +NNR YRI DI W +N    F K  G +++Y +Y+   Y L+++D++QP+++S+S  +    +    + E++   ++L+PE+  LTGL+D M  DF LM++L    +V P KR     +F++ + S  E       WG++ ++  +++    +  E +Y  +++      QA++ +   + K++  I +E W+L+   +   +A  ++  LM   P +G+   KP++ E+  DR + +++ L++N+    Q+V+ +L  + + +Y++IK+F  V+ P PSQ VLA+TL +   + SVA  IALQ+N KLGGELW+V+IPIK+ MVVG+D +HD+  R +SV   V S N   TRW+S+   Q   +E++  L+ CM        +  NF+   I  + + V       +    I  F     S+    +P +   VV+KR   R +      +  + NP+PGT++D   TR   YDF+LVSQSVRQGTVTPTHY V+ D S   P  +Q +AYK CH+YYNWPG +RVPAPC YAHKLA++VGQ++  EPS  L DRL+YL
Sbjct:  128 SGQPVKLLTNYFKLMSRKMWMVYQYHVTFSPELESKRLRIALLHEHNE----LLGETRAFDGCILYLPKKLEKVSEVWSKTRQEQKIKITITLTNELPPSSPTAIVLFNIIFRKVLKMVNMQQIGRNYYNPDDAFTIPQHRLHVWPGFVTSIMCYESDVMLCADVSHKILRNESVLDFMYTLFEQIEER-HFHDACQKELVGQVILTRYNNRTYRIDDISWNRNPSMTFLKSDGTEVTYYEYYTKHYSLEVKDMQQPLLISRSKRKDSVGK----TVEIE---LHLLPEISYLTGLSDKMRSDFHLMKDLGLQTQVGPDKRAMTTQKFIEKLQSNPETCNEFAKWGLSFDRQLLSLTGRVVPCEKLYQKDQSYQYNQRQADWSRESRNMKLMTPISLEEWMLLFTHNNSNEARAIVDNLMQVGPPMGMHINKPEMFEVL-DRAQSFVQTLQQNLNHHTQMVMCVLPTIHKGKYDSIKQFLCVERPFPSQCVLARTLSKPQMIRSVATKIALQMNCKLGGELWSVEIPIKQLMVVGVDSYHDSITRGQSVCGFVASLNQTLTRWYSRCIFQHAAQEMIDGLKVCM--------QCKNFISLQIASHSNDV-------MINVVIIYFLSFLNSYCCGSRPKVTVVVVKKRGIARFF---EFGRSGLQNPSPGTVIDTEATRHEWYDFYLVSQSVRQGTVTPTHYNVVYDTSNMKPDHMQRLAYKMCHLYYNWPGVIRVPAPCHYAHKLAFLVGQSIHKEPSLDLSDRLYYL 865          
BLAST of SMEDWI-3 vs. Ensembl Sea Lamprey
Match: ago2 (argonaute RISC catalytic component 2 [Source:ZFIN;Acc:ZDB-GENE-110606-6])

HSP 1 Score: 135.191 bits (339), Expect = 1.969e-35
Identity = 76/227 (33.48%), Postives = 123/227 (54.19%), Query Frame = 1
Query: 2305 MVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINN-PNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNL 2973
            + +G +V H   G  +  S+ AVVGS +A  +R+ +   +Q   +EI+  L + +  LL  +++   F P  I  YRDGVS+GQ   V   E+            DY+P + Y  VQKR +TRL+ +D   + G+  N P   T VD  +T  + +DF+L S +  QGT  P+HY VL D+++++  ++Q++ Y+ CH Y     +V +PAP  YA  +A+    +L
Sbjct:   11 IFLGAEVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQHHRQEIIQDLGTMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLFHELLAIRDACIKLEKDYQPGITYVAVQKRHHTRLFCADRNERIGKSGNIPAGTTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSADELQVLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHL 237          
BLAST of SMEDWI-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009610.1 (pep scaffold:Pmarinus_7.0:GL477777:44890:66775:1 gene:ENSPMAG00000008651.1 transcript:ENSPMAT00000009610.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 1.221e-22
Identity = 91/331 (27.49%), Postives = 156/331 (47.13%), Query Frame = 1
Query: 1744 WGITIEKDTVNINACKMNPEMI-YFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWIL--ISPKSLLTKA--NGLLQALMSKSPRVGV-MFGKPKIVE--MNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVV-LAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIP-------IKKFMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSD 2682
            +GI ++ D  ++    +NP M+ Y G   +V+   Q  +   +   +   GI I+ W +   +P+    +         L   S   G+ + G+P   +     +  E   + LK N   G+QL+V IL   +   Y  +K+       + +Q V +   LK  P+  S   N+ L+IN KLGG +  + +P        +  + +G DV H   G  +  S+ AVVGS +A  +R+ +   +Q+  +EI++ L S +  LL  +++   F P  I  YRDGVS+GQ   V   E+    +       +Y+P + + VVQKR +TRL+ +D
Sbjct:  398 FGIMVKDDMADVQGRVLNPPMLQYGGRTRAVATPNQGVWD--MRGKQFFTGIEIKVWAIACFAPQRQCREEVLKNFTDQLRKISKDAGMPIQGQPCFCKYAQGAENVEPMFRHLK-NAYMGLQLIVVILPG-KTPVYAEVKRVGDTLLGMATQCVQVKNVLKTSPQTLS---NLCLKINVKLGG-VNNILVPHIRPAVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQQHRQEIIHDLSSMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLYHELLAIREACIRLEKEYRPGITFIVVQKRHHTRLFCAD 720          
BLAST of SMEDWI-3 vs. Ensembl Nematostella
Match: EDO34027 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQI3])

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 325/768 (42.32%), Postives = 488/768 (63.54%), Query Frame = 1
Query:  730 LTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPM-VYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLV---YLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            + LS NY+++   +  ++QY VS++P ID+R  R  ++Q       G     +AFD   L++P+ L    T ++  + +D + V V + FT  V   +    VYN+LF+R+   L M ++GR ++ P+    + +  + +WPGY+TS+Q+++GGL+L CDV H+++R DS  D M+ ++  V ++ + + +   +L+G +VLT +NN+ YR+ DIDW K   S F    GE++++ +Y+K +Y ++IRDL+QPMIV++          PK +++  GG++    LIPELC LTGL D M KDFR+M+++  H RV P +R EA+ +FV +I S  EA + L  W + ++  T+     +  PE I +GN    SAG+QA++ +     KVI  + + NW++   +    KAN  +Q +   +P +G+   +PK+ ++ +DRTE YL+ ++ N+ P VQ+VV I    R+DRY A+KK C V+ PVPSQV++++T+    KL SV   IALQIN KLGGELWA+ IP +  MV G+DV+HD     RSVG +V S N   TRW+S    Q   +E++  L+  ++  ++ + + NN LPE I +YRDGV DGQL  V   E++QF + F SF   YKP +   VVQKRINTR++ ++P+    + NP PG+++DHTVTR +  DFFLVSQ VRQGTVTPTHYVV+ D S + P  +Q ++YK  H+YYNWPGTVRVPAPC YAHKLAY VGQ++  +PS  LCDRLF+L
Sbjct:    1 IPLSCNYIRIHCPEQAVFQYCVSYSPEIDNRSERFHLLQ----QHPGFRGPQKAFDSTMLFLPRRLPQPVTQLQSTRRSDGSPVTVTITFTRVVPPDDAIFQVYNILFRRVMKILDMQQVGRYFYNPKTPAHIPQHNLVLWPGYITSLQHYEGGLMLLCDVHHRLLRTDSCLDYMLNMHSKVGDRFRDEVS--KELIGSVVLTTYNNKTYRVDDIDWNKRPTSTFTFHNGEQMTFVEYYKKSYEIEIRDLDQPMIVNR----------PKKTEQKRGGVIEVILLIPELCKLTGLNDAMRKDFRVMKDIAAHTRVNPMQRQEAMKKFVMSINSTPEALEQLTAWNLRLDTSTLMTEGRQFPPEKIIYGNTTG-SAGDQADWGRDATREKVISAVNLNNWMVFFTQRDSGKANDFVQTMNKCAPAMGIQVNQPKMNQLRDDRTETYLRSIRENLHPQVQVVVVIFPTSRDDRYAAVKKLCCVESPVPSQVIISKTISNPTKLRSVVQKIALQINVKLGGELWALDIPSRSLMVCGIDVYHDKARGGRSVGGLVCSMNRSLTRWYSDVCFQSPGQELIDGLKMLLIKGIRKWHDVNNALPERIIVYRDGVGDGQLKVVAGYEVQQFEECFASFGESYKPKLAVLVVQKRINTRIFSAEPR----LGNPGPGSVLDHTVTRKDWNDFFLVSQHVRQGTVTPTHYVVVYDTSNWKPDIMQKLSYKLTHLYYNWPGTVRVPAPCQYAHKLAYQVGQSIHGQPSQELCDRLFFL 747          
BLAST of SMEDWI-3 vs. Ensembl Nematostella
Match: EDO49931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFC2])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 303/792 (38.26%), Postives = 462/792 (58.33%), Query Frame = 1
Query:  679 PTQIKEPCNTRNDSSPSLTLSANYVKVRT-TQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXX-----XXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNV-APGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTR---WFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQIN--NPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            PT  ++  N        + + +NY ++ T  Q  IYQY+VSF+P +D +  R  ++ G     LG +   RAFDGM L++P+ L ++ T I   +   +T      + + +      +   C  ++N++ KRI   + M ++GR+Y+Y +  I + +  +E+WPGY TSI  ++  +LL  DVSHKV+R  +V D + E+   +  +G     A  +L+G+IVLT +NN+ YR+ DIDW K   S F     +IS+ DY+K  Y   I D EQP++ SK   R G +             V L+PELC LTGL+DDM  DF +M++L  H R+ PK R + L + +  I +  +A   L  WG+   ++ ++ +   +  E I+  N+ S    + A++ + +    +   + +ENW+++        A    Q L      +G+   KP++V +N+DRT+ YLK L   + A   Q+VVTI+ + R+DRY++IKK C ++  VPSQVV+++TL +   L SV   I +Q+N KLGGE WAV IP+K  M+VG+D +HD+  + RSVG  V S N  CTR   ++S+   Q   +E++  L+ CM + L+ + + N  LP+ I ++RDGV DGQL  V + E+ Q    F+ F   Y P   + VV+KRI TRL++ + ++    N  NP PGT+VD  VTR+  +DFF+VSQSVRQGTV+PTHY V+ D +   P   Q ++YK  H+YYNWPGTVRVPAPC YAHKLA++VGQ+L  EPS  L D+L++L
Sbjct:   95 PTTRRDGFNKEGSVGTKVGIVSNYFRLETRPQAAIYQYNVSFSPEVDFKKARFALI-GEQRELLGNI---RAFDGMVLFLPKKLPDQVTKIMAVRTRRETPDEPVEITITLTNELPADSPTCLHLFNIILKRILKYIDMKQVGRNYYYIKNAIAIPKHGLELWPGYTTSILKYEHSILLGADVSHKVLRKQTVLDFLYELYNKMQGRGNFHDEAAKKLVGEIVLTRYNNKTYRVDDIDWNKRPNSTFTTPKGEISFNDYYKKNYDFTITDQEQPLLFSKPKKRKGADDP-----------VLLLPELCFLTGLSDDMRADFSVMKDLAVHTRLDPKARSKDLNKLISEINNNPDASGELSGWGLRFGRNLLDFDGRILPGEKIFQKNKGSNYDPKSADWSREIRGAPLHSTVNLENWVIVHTNRDSGVATDFQQTLARVCGPMGINTTKPRMVPLNDDRTDSYLKALSNEIQADFPQIVVTIVPSNRKDRYDSIKKLCCLEKGVPSQVVVSRTLSKKQMLMSVCTKIGIQLNCKLGGEAWAVDIPLKNLMIVGIDTYHDSSQKGRSVGGFVASLNKPCTRQREYYSRCTFQHSGQELVDGLKVCMTAALRQWQQINGVLPDKIIVFRDGVGDGQLRAVIEHEVPQILSTFKQFQDGYDPKFGFTVVKKRIQTRLFMREARDPDMRNLMNPPPGTVVDKEVTRSEWFDFFIVSQSVRQGTVSPTHYNVIHDTTGLRPDHWQQLSYKLTHLYYNWPGTVRVPAPCQYAHKLAFLVGQSLHKEPSLKLADKLYFL 871          
BLAST of SMEDWI-3 vs. Ensembl Nematostella
Match: EDO46431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ46])

HSP 1 Score: 166.007 bits (419), Expect = 4.215e-42
Identity = 164/642 (25.55%), Postives = 284/642 (44.24%), Query Frame = 1
Query: 1144 IWPGYVTSIQNFDGGLLLQCDVSHKVI-RNDSVYDIMMEI----------NKTVNNKGQMQ-TAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD---KGGE--KISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIK--DFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQA--LAHNKVIGGIRIENW-ILISPKSLLTKANGLLQ---ALMSKSPRVGVMFGKPKIV---EMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTL-KEGPKLNSVAVNIALQINAKLGG--ELWAVKI--PI--KKFMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAY 2955
            +W G+  SI+     +LL  DVS     +  SV + M E+          +  +N+  +++ T  I  L  +I       R YR+ ++        +F    + G+  +I+   YF++ +  ++R    P +      R                  YL  E+C +      + K  D +  + +    R  P +  E +   V      E+A   +  + I+I K+ V +    + P  + +G +  +     + F     +   ++  GI I  W I    K  +   + L +    LM  S   G+    P +      N D  E   + LK    P +Q+++ +L   +   Y  +K+       V +Q +  + + K  P+  S   N+ L+INAKLGG   + A +I  P+  +  + +G DV H   G  +  SV AVVGS +A  +R+++   +Q   +EI+  L + +  LL  ++      P+ I  YRDGVS+GQ   V   E++   +        Y+P + + VVQKR +TRL+    ++K G+  N  PGT VD  +T    +DF+L S +  QGT  P+HY VL D++ ++  ++Q + Y+ CH Y      V +PAP  YAH +A+
Sbjct:  189 VWFGFHQSIRPSQWKMLLNIDVSATAFYKCQSVVEFMCEVLRIRKDDLEKHAPLNDADRLRFTREIKGLKVEITHCGPMKRKYRVINVTKQPAQALQFPLTLESGQTAQITVARYFQDKHKQRLRYPHLPCLQVGQEQRH----------------TYLPLEVCNIVPGQRCVKKLTDTQTSKMIRATARSAPDRERE-IRGLVKKANFDEDA--YVKDFSISIGKNMVELQGRVLPPPKLVYGGKVRIEKIIHS-FSGVWDMRGRQLFHGIEIRTWAIACFVKQQMCTEDSLRRFSNQLMKISVEQGMPISCPPVFFRYARNPDEVERMFRRLK-EAHPDLQMILVVLPG-KTPVYAEVKRVGDTMLGVITQCIQGKNVTKPSPQTLS---NLCLKINAKLGGVNNILAPEIRPPVFREPVIFLGADVTHPAAGDDKRPSVAAVVGSMDAHPSRYYASVRVQTHRQEIIAELAAMVRELLVQFYRSTRHKPQRIVFYRDGVSEGQFRQVLVHELKAIREACIKLEVGYQPGISFIVVQKRHHTRLFCQRDQDKCGKSGNVPPGTTVDRGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNFSADELQALTYQLCHTYVRCTRAVSIPAPAYYAHLVAF 805          
BLAST of SMEDWI-3 vs. Ensembl Nematostella
Match: EDO28124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7C9])

HSP 1 Score: 92.4337 bits (228), Expect = 1.665e-21
Identity = 59/180 (32.78%), Postives = 81/180 (45.00%), Query Frame = 1
Query: 2296 KKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEI-------------------------------------------------MYVL-QSCML-SLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSD 2682
            +  MV G+DV+HD     RSVG +V S N   TRW+S    Q   +E+                                                 MYV+   C+L   ++ + + NN LPE I +YRDGV DGQL  V   E++QF + F SF   YKP +   VVQKRINTR++ ++
Sbjct:    1 RSLMVCGIDVYHDKARGGRSVGGLVCSMNRSLTRWYSDVCFQSPGQELIDGLKMLLIKGIRKWHDAIRKWHDVCYLTMFVSLSRPSGSGMMPSGSGMMYVIFNVCVLIKAIRKWHDVNNALPERIIVYRDGVGDGQLKVVAGYEVQQFEECFASFGESYKPKLAVLVVQKRINTRIFSAE 180          
BLAST of SMEDWI-3 vs. Ensembl Nematostella
Match: EDO28197 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T755])

HSP 1 Score: 77.7962 bits (190), Expect = 1.100e-17
Identity = 37/70 (52.86%), Postives = 52/70 (74.29%), Query Frame = 1
Query: 2086 QLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPI 2295
            Q+VVTI+ + R+DRY++IKK C ++  VPSQVV+++TL +   L SV   I +Q+N KLGGE WAV IP+
Sbjct:    1 QIVVTIVPSNRKDRYDSIKKLCCLEKGVPSQVVVSRTLSKKQMLMSVCTKIGIQLNCKLGGEAWAVDIPV 70          
BLAST of SMEDWI-3 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 310/788 (39.34%), Postives = 466/788 (59.14%), Query Frame = 1
Query:  670 REYPTQIKEP-CNTRNDSSPSLTLSANYVKVRT-TQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLY--VSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            R+    +KE  C T   S   + L+AN+ ++ +  Q  +YQYHV F PP++SR +R  ++   +E    V+ +AR FDG  L +P+ L  KET++     + + V+    +       S  C   YN+LFKR+   L M +IGR+Y+ P+  + +    + IWPGY T+I  ++  ++L  DVSHKV+R+++V D M+ + +   N+ +   A   +L+G IVLT +NN+ YRI DI W     + F +G   IS+ +Y+K  YGL I D+ Q ++VS    R+G   GP     +      LIPELC LTGLTD M  DF +MR+L E+ R++P KR   L  F+++I      ++ L  WGI  +   +N++A  + PE I+ G  +        ++ + +    +I    + NWI+ S +    +A  LLQ L   S  +G+   +  ++E   D  E  L+ LK+NV P  Q+VV +L + R+D+Y+++KK+  VDCP PSQ VL++TL     L +VA  IALQ++ K+GGELW+V+IP+K+ M+VG+D +HD     RS+GA+V S N   +RW+SK  LQ + +E+M  L+      LK Y + NN LP  I +YRDGV DGQL  V   EI Q  +  +S   DY P +   VV+KRI++R +  ++D     +++NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ D S   P  +Q + YK CH+YYNW G +RVPAPC YAHKLA++VGQ++  EP+  L + LFYL
Sbjct:   88 RQLMEHVKESKCGT---SGSPIQLTANFYRILSRPQWVLYQYHVDFKPPMESRRLRTALLYRHAE----VIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRVLRLLEMQQIGRNYYNPKNPLNIPEHNLTIWPGYSTTILQYESSIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQ-RFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKKRTGPGGGPPLGPAM------LIPELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDICGNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDWSREMRGIPIISSPPLNNWIMFSTRRNSNEAQSLLQTLGKVSGPLGLRLQRAVMIEYE-DHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSRTLSRPQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMAFTGALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSLGQDYNPKVSVVVVKKRISSRFFAMIND-----KVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDTSGLKPDHMQRLTYKLCHMYYNWQGLIRVPAPCQYAHKLAFLVGQSIHREPNIKLDNYLFYL 855          
BLAST of SMEDWI-3 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 310/788 (39.34%), Postives = 467/788 (59.26%), Query Frame = 1
Query:  670 REYPTQIKEP-CNTRNDSSPSLTLSANYVKVRT-TQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLY--VSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            R+    +KE  C T   S   + L+AN+ ++ +  Q  +YQYHV F PP++SR +R  ++   +E    V+ +AR FDG  L +P+ L  KET++     + + V+    +       S  C   YN+LFKR+   L M +IGR+Y+ P+  + +    + IWPGY T+I  ++  ++L  DVSHKV+R+++V D M+ + +   N+ +   A   +L+G IVLT +NN+ YRI DI W     + F +G   IS+ +Y+K  YGL I D+ Q ++VS    R+G   GP     +      LIPELC LTGLTD M  DF +MR+L E+ R++P KR   L  F+++I      ++ L  WGI  +   +N++A  + PE I+ G  +        ++ + +    +I    + NWI+ S +    +A  LLQ L   S  +G+   +  ++E   D  E  L+ LK+NV P  Q+VV +L + R+D+Y+++KK+  VDCP PSQ VL++TL     L +VA  IALQ++ K+GGELW+V+IP+K+ M+VG+D +HD     RS+GA+V S N   +RW+SK  LQ + +E+M  L+    + LK Y + NN LP  I +YRDGV DGQL  V   EI Q  +  +S   DY P +   VV+KRI++R +  ++D     +++NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ D S   P  +Q + YK CH+YYNW G +RVPAPC YAHKLA++VGQ++  EP+  L + LFYL
Sbjct:   58 RQLMEHVKESKCGT---SGSPIQLTANFYRILSRPQWVLYQYHVDFKPPMESRRLRTALLYRHAE----VIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRL---LEMQQIGRNYYNPKNPLNIPEHNLTIWPGYSTTILQYESSIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQ-RFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKKRTGPGGGPPLGPAM------LIPELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDICGNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDWSREMRGIPIISSPPLNNWIMFSTRRNSNEAQSLLQTLGKVSGPLGLRLQRAVMIEYE-DHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSRTLSRPQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMA-FTALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSLGQDYNPKVSVVVVKKRISSRFFAMIND-----KVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDTSGLKPDHMQRLTYKLCHMYYNWQGLIRVPAPCQYAHKLAFLVGQSIHREPNIKLDNYLFYL 821          
BLAST of SMEDWI-3 vs. Ensembl Medaka
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:100301588])

HSP 1 Score: 554.673 bits (1428), Expect = 7.435e-180
Identity = 292/779 (37.48%), Postives = 449/779 (57.64%), Query Frame = 1
Query:  694 EPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVA--PGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +P N       S+T+ +N++ +      +YQYHV+F P ++S  MR     G+         E  AFDG  LY+P  L +   +  V +  D+ +     +       S+ C   YNV+F+R+   + +  +GR+++ PE  ++L ++R+++WPGY T+I+  DGGL L  DVSHKV+RNDSV D+M  + +    K   + A   +L+G I +T +NNR YRI DI+W K+    F    G + ++ +Y+   YG+ +++  QP++V +   RS  N G K    V  G + L+PEL  LTG+ + M  D+R M++L  H  V+  +   A+ + + NI S E+  K L  WG+ +  D + I    +  E I     +S + G    + + + +   I  I +  W++  P+    +A  L+      +  +G+   +P  VE+ +DRTE Y+K +   +   P +QLVV ++   R+D Y+AIKK C + CPVPSQV+  +T+ +  KL  +A  I LQ+N+KLGGELW V IP+K  MVVG+DV HDT  + +SV   V S N+  T W+S+   Q   +E++   ++C LS L+ Y+E N+ LP+ I +YRDGVSDGQL  V+  EI Q  K FE+F  +Y+P +V+ VVQKRINT LY S       +     GT++DHT+T  +  DF+L +  +RQG   PTHYV L + +  TP  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L +EP+  L D+LF+L
Sbjct:  273 KPLNKAGVKGASITIGSNHIPISCKNQAVYQYHVTFNPNVESMSMRF----GMMRDHRSTTGEVIAFDGSILYLPVQLCDVVNLKSVRRTDDEEIEITIKMTKVLPPNSDLCIPFYNVVFRRVMKVIGLRLVGRNHYDPENAVILGKQRLQVWPGYSTAIKRMDGGLYLAVDVSHKVLRNDSVLDLMNTLYQ--QTKENFKDACTKELIGSIAITRYNNRTYRIDDIEWDKSPKDSFTLMDGTETTFLEYYSKNYGITVQETNQPLLVHRPKERS--NPGGK----VISGHILLVPELSFLTGIPEKMKNDYRAMKDLKIHINVSSDQHTHAIKQLLKNISSKEDCTKALEGWGLELGSDVMMITGRMLPFETICL-KSSSFATGANVSWSREVVNGASISSIPLNIWVVFYPRRSAEQAVELISTFHKVAGPIGLRLQRPITVELRDDRTETYVKSIHSQLTSEPHLQLVVCVIEGNRDDLYSAIKKLCCLKCPVPSQVINVRTISQQQKLRGIAQKILLQLNSKLGGELWTVGIPLKSLMVVGVDVHHDTSKKHQSVMGFVASVNSSLTHWYSRVTFQTPTEELISGFRACFLSTLQKYYELNHDLPQKIVVYRDGVSDGQLKMVELYEIPQLIKCFETF-PNYEPKLVFIVVQKRINTILYSSSANGFSSVPA---GTVLDHTLTNKDWVDFYLTAHDIRQGVGLPTHYVTLYNTANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQFLHSEPAIQLSDKLFFL 1034          
BLAST of SMEDWI-3 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 499.204 bits (1284), Expect = 4.787e-158
Identity = 287/749 (38.32%), Postives = 436/749 (58.21%), Query Frame = 1
Query:  670 REYPTQIKEP-CNTRNDSSPSLTLSANYVKVRTT-QPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLY--VSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNW 2901
            R+    +KE  C T   S   + L+AN+ ++ +  Q  +YQYHV F PP++SR +R  ++   +E    V+ +AR FDG  L +P+ L  KET++     + + V+    +       S  C   YN+LFKR+   L M +IGR+Y+ P+  + +    + IWPGY T+I  ++  ++L  DVSHKV+R+++V D M+ + +   N+ +   A   +L+G IVLT +NN+ YRI DI W     + F +G   IS+ +Y+K  YGL I D+ Q ++VS    R+G   GP     +      LIPELC LTGLTD M  DF +MR+L E+ R++P KR   L  F+++I      ++ L  WGI  +   +N++A  + PE I+ G  +        ++ + +    +I    + NWI+ S +    +A  LLQ L   S  +G+   +  ++E   D  E  L+ LK+NV P  Q+VV +L + R+D+Y+++KK+  VDCP PSQ VL++TL     L +VA  IALQ++ K+GGELW+V+IP+K+ M+VG+D +HD     RS+GA+V S N   +RW+SK  LQ + +E+M  L+      LK Y + NN LP  I +YRDGV DGQL  V   EI Q  +  +S   DY P +   VV+KRI++R +  ++D     +++NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ D S   P  +Q + YK CH+YYNW
Sbjct:   88 RQLMEHVKESKCGT---SGSPIQLTANFYRILSRPQWVLYQYHVDFKPPMESRRLRTALLYRHAE----VIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRVLRLLEMQQIGRNYYNPKNPLNIPEHNLTIWPGYSTTILQYESSIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQ-RFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKKRTGPGGGPPLGPAM------LIPELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDICGNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDWSREMRGIPIISSPPLNNWIMFSTRRNSNEAQSLLQTLGKVSGPLGLRLQRAVMIEYE-DHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSRTLSRPQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMAFTGALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSLGQDYNPKVSVVVVKKRISSRFFAMIND-----KVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDTSGLKPDHMQRLTYKLCHMYYNW 816          
BLAST of SMEDWI-3 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 499.204 bits (1284), Expect = 4.787e-158
Identity = 287/749 (38.32%), Postives = 436/749 (58.21%), Query Frame = 1
Query:  670 REYPTQIKEP-CNTRNDSSPSLTLSANYVKVRTT-QPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLY--VSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNW 2901
            R+    +KE  C T   S   + L+AN+ ++ +  Q  +YQYHV F PP++SR +R  ++   +E    V+ +AR FDG  L +P+ L  KET++     + + V+    +       S  C   YN+LFKR+   L M +IGR+Y+ P+  + +    + IWPGY T+I  ++  ++L  DVSHKV+R+++V D M+ + +   N+ +   A   +L+G IVLT +NN+ YRI DI W     + F +G   IS+ +Y+K  YGL I D+ Q ++VS    R+G   GP     +      LIPELC LTGLTD M  DF +MR+L E+ R++P KR   L  F+++I      ++ L  WGI  +   +N++A  + PE I+ G  +        ++ + +    +I    + NWI+ S +    +A  LLQ L   S  +G+   +  ++E   D  E  L+ LK+NV P  Q+VV +L + R+D+Y+++KK+  VDCP PSQ VL++TL     L +VA  IALQ++ K+GGELW+V+IP+K+ M+VG+D +HD     RS+GA+V S N   +RW+SK  LQ + +E+M  L+      LK Y + NN LP  I +YRDGV DGQL  V   EI Q  +  +S   DY P +   VV+KRI++R +  ++D     +++NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ D S   P  +Q + YK CH+YYNW
Sbjct:   88 RQLMEHVKESKCGT---SGSPIQLTANFYRILSRPQWVLYQYHVDFKPPMESRRLRTALLYRHAE----VIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRVLRLLEMQQIGRNYYNPKNPLNIPEHNLTIWPGYSTTILQYESSIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQ-RFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKKRTGPGGGPPLGPAM------LIPELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDICGNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDWSREMRGIPIISSPPLNNWIMFSTRRNSNEAQSLLQTLGKVSGPLGLRLQRAVMIEYE-DHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSRTLSRPQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMAFTGALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSLGQDYNPKVSVVVVKKRISSRFFAMIND-----KVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDTSGLKPDHMQRLTYKLCHMYYNW 816          
BLAST of SMEDWI-3 vs. Planmine SMEST
Match: SMESG000081970.1 (SMESG000081970.1)

HSP 1 Score: 1885.92 bits (4884), Expect = 0.000e+0
Identity = 959/960 (99.90%), Postives = 959/960 (99.90%), Query Frame = 1
Query:  139 LLMQKFLNKDVLVPSVESLEDKALNKLGIPLPGSTVEKNTEXXXXXXXXXXXXXXXXXXXNIKLQDSDIENRNITIVTRPLSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LLMQKFLNKDVLVPSVESLEDKALNKLGIP PGSTVEKNTESSSISSGDSRSNPSGDSRNNIKLQDSDIENRNITIVTRPLSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL
Sbjct:   15 LLMQKFLNKDVLVPSVESLEDKALNKLGIPPPGSTVEKNTESSSISSGDSRSNPSGDSRNNIKLQDSDIENRNITIVTRPLSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 974          
BLAST of SMEDWI-3 vs. Planmine SMEST
Match: SMESG000036375.1 (SMESG000036375.1)

HSP 1 Score: 240.736 bits (613), Expect = 1.275e-66
Identity = 190/699 (27.18%), Postives = 329/699 (47.07%), Query Frame = 1
Query: 1039 NVLFKRIENSLRMVKIGRDYFYP---------EKKIVLDRRRMEIWPGYVTSI-----QNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNS-----RSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFES-FSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT-----------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCD----RLFYL 3018
            N++F  I+  +   KIGR +F           E          +I  GY T+I     +N     LL  +  ++V+  ++V  +              +   I+QL+G+ ++T +NN+ YRI+DI    +   E   G +KISY +YFK  Y + +++ +QP ++S+        +      P+G  E D  L   IP ELC L G +D    +  L + L    +  P++R   + +F        ++K  +  WG+ IE+  + I   ++ P  I F NE  ++     ++K       V  G      +L+  ++  +  N  ++ +  +  R+ + +    I    ++  E+ L +  R     V  V   L  + +D+ Y  +K F  +   + +Q V  +  + ++  +  +VA    +Q+ +KLG + W + + +   M+VGLD +H   G+ RSV A V S +A  +++ S  +  +   E    L    L+ L  +  + N +P  + +YRDGV D QL + +K E +   K+ E  +     P ++Y VV+KRI+ + +           NPNPGT+VD  + + N Y+F+LVSQ   +GT +PT+Y VL D +K+T           P  +Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG+  +      + D    RLFYL
Sbjct:  144 NIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVY-------------RRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQSLS--IPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFC-KWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDI-FSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNP-SHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIR-----VSKVHMALVFIPDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA-------NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMD-TKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          
BLAST of SMEDWI-3 vs. Planmine SMEST
Match: SMESG000069984.1 (SMESG000069984.1)

HSP 1 Score: 223.402 bits (568), Expect = 1.291e-60
Identity = 174/629 (27.66%), Postives = 310/629 (49.28%), Query Frame = 1
Query: 1258 INKTVNNKGQMQT---AAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDG--------------GLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNP-EMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTK--ANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK------PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEP----SNLLCDRLFYL 3018
            IN+ +N+   M+     +I+QL+G+ ++T +NN+ YRI++I    N   +F+ GG  +SY +YFK  Y +++   +QP ++++      + R  K  + V+                +   IP ELC L G +D    +  L + L    +  P++R + +  + + I + + A  +   W + I+   + I   ++ P ++I  G++ +   G+  +F +     K      I+  +++       K   N + Q L  ++ R+    GK      N+   E  L +  R+ +   ++ +     V +DR  A  K   +   + +Q V  +  T +   +   V+    +QI AK G + W V+I ++  M+VG+D +H+ K   +S+ A V S N+  T++ S  +  +  +E    L       L+ + +  + LP+ I ++RDGV D QL + +  E++    + E+    YK      P ++Y +V+KR+ T+L+     N+G  NNPNPGT+VD  + + N Y+FFLVSQ   +GT TPT+Y VL D    T         P+++Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG+  K       +  + +RLFYL
Sbjct:  228 INRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEID-VVIVDRNDFQYKNFMNDVEQEL--RNMRIDARVGKVNTCGPND--VERCLNDAARSGSGCAKMALVF---VPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENI---YKGNGFPVPQIIYVIVKKRVGTKLF-----NRG--NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 836          
BLAST of SMEDWI-3 vs. Planmine SMEST
Match: SMESG000047591.1 (SMESG000047591.1)

HSP 1 Score: 168.703 bits (426), Expect = 1.733e-42
Identity = 166/668 (24.85%), Postives = 296/668 (44.31%), Query Frame = 1
Query: 1066 SLRMVKIGRDYFY--PEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVI-RNDSVYDIMMEI-------NKTVNNKGQMQ-TAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEF---DKGGEKI--SYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIK--DFRLMRELHEHCRVTPKKRHEALLEFVDNIY--SCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWIL--ISPKSLLTKAN--GLLQALMSKSPRVGV-MFGKPKIVE--MNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTL-KEGPKLNSVAVNIALQINAKLGGELWAVKIPI-------KKFMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAY 2955
            S+    +GR +F+   +    L   R E+W G+  S++     ++L  DVS     +  SV + M E+        + + +  +++ T  I  L  +I       R YR+ ++         F    + G+ I  +   YF++ YG++++    P +      +                  YL  E+C +      + K  D +    +    R  P +  E     ++N+   S   A   L  +G+++     +I    +    I +G      A  Q      +   +   GI I+ W +   +P+  + + +     Q L   S   G+ + G+P   +     D+ E   + LK N   G+QL+V +L   +   Y  +K+   +   + +Q V A+ + K  P+  S   N+ L+IN KLGG + ++ +P        +  + +G D  H   G     S+ AVVGS +A  +R+ +   +Q   +E +  L + +  LL  +++   F P  I  YRDGVS+GQ   V   E++   +        Y+P + + VVQKR +TRL+ SD K++ G+  N   GT VD  +T    +DF+L S +  QGT  P+HY VL D+++++  ++Q + Y+ CH Y     +V +PAP  YAH +A+
Sbjct:  242 SMTYTPVGRSFFHNTGDYDNPLGGGR-EVWFGFHQSVRPSQWKMMLNIDVSATAFYKEQSVINFMFEVLEIDKDQKRPLTDSQRVKFTKEIKGLKVEINHCGPIKRKYRVCNVTRRSAQSQTFPLQSEQGQTIECTVTKYFQDRYGMKLQHPHLPCLQVGQEQKH----------------TYLPLEVCNIVSGQRCIKKLTDMQTSTMIKATARSAPDREKE-----INNLVRRSNFNADPHLQIFGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWD-MRGKQFFSGIEIKVWAIACFAPQRTVREDSLRTFTQQLQKISNDAGMPIVGQPCFCKYATGQDQVEPMFRYLK-NSFTGLQLIVVVLPG-KTPVYAEVKRVGDIIFGLATQCVQAKNVNKPSPQTLS---NLCLKINVKLGG-INSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIREACIKLEMSYQPGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSADEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVAF 880          
BLAST of SMEDWI-3 vs. Planmine SMEST
Match: SMESG000051000.1 (SMESG000051000.1)

HSP 1 Score: 159.458 bits (402), Expect = 1.559e-39
Identity = 109/339 (32.15%), Postives = 178/339 (52.51%), Query Frame = 1
Query: 2023 MNNDRTEEYLKELKRNVAPGVQLVVTILSAVRED-RYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVK----IPIKK-FMVVGLDVWH--DTKGRSRSVGAVVGSTNALCTRWFS--KSHLQEQDK---EIMYVLQSCMLSLLKAYFEENNF-LPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLY-VSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNL 2994
            ++ND  ++ ++++K ++     L+V +   VR D  Y  +K    ++  + +Q +  + L     L+    N+ L++NAKLGG  W +K     PIK  FMV G+DV H  +  G S+SV AVVGS N   T + +  K  L +  K   E +  ++  +  L+K +++ N   LP+ +  YRDGVS+GQ   V   EI       E F  +YKP + Y +VQKR N R   ++   + G+  N  PG ++D+ +T +  +DF+L S    QGT  P HY V+ D +++  + +Q   Y  C++ +    ++  PAP  YAH LA   G+ LK +  N+
Sbjct:  589 VSNDDIKKSIEKIKEDL----DLLVVV---VRNDVEYKLVKDIGDIELGIVTQCICYENLCRQKNLSQYMGNLMLKVNAKLGGVNWEIKNIEYAPIKGLFMVFGVDVTHPSNNDGLSKSVAAVVGSINKTATIYSAVIKKQLSKDGKDAVETVVEMEDMVHRLIKVFYDLNQSKLPDHLIFYRDGVSEGQFEIVFNHEIAAIQYACEKFKKNYKPKITYIIVQKRHNIRFCPITLEDSVGRCKNVLPGVVIDNDITHSREFDFYLCSHEGIQGTSKPVHYYVILDENRWNSNDLQEFTYFLCYVCFRCTRSISYPAPTHYAH-LAAFRGRILKDDEDNI 919          
The following BLAST results are available for this feature:
BLAST of SMEDWI-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIWIL10.000e+038.51piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL10.000e+038.51piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL20.000e+039.30piwi like RNA-mediated gene silencing 2 [Source:HG... [more]
PIWIL20.000e+039.30piwi like RNA-mediated gene silencing 2 [Source:HG... [more]
PIWIL12.913e-16837.36piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prg-14.514e-13632.53Piwi-like protein [Source:UniProtKB/TrEMBL;Acc:P9... [more]
alg-21.485e-4224.23pep chromosome:WBcel235:II:874160:879001:1 gene:WB... [more]
alg-21.996e-4224.23pep chromosome:WBcel235:II:873176:878945:1 gene:WB... [more]
alg-11.014e-4124.58pep chromosome:WBcel235:X:13951262:13956261:1 gene... [more]
alg-11.335e-4124.58pep chromosome:WBcel235:X:13949114:13956261:1 gene... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGO30.000e+039.30gene:FBgn0250816 transcript:FBtr0299882[more]
AGO30.000e+039.30gene:FBgn0250816 transcript:FBtr0299881[more]
AGO30.000e+039.30gene:FBgn0250816 transcript:FBtr0299880[more]
AGO34.447e-17238.87gene:FBgn0250816 transcript:FBtr0301725[more]
aub1.799e-13432.31gene:FBgn0000146 transcript:FBtr0112793[more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piwil20.000e+037.13piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil20.000e+037.13piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil10.000e+038.31piwi-like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil10.000e+038.31piwi-like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil27.698e-15235.67piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd740.000e+037.38CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847][more]
cd740.000e+037.38CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847][more]
piwil30.000e+038.18piwi-like RNA-mediated gene silencing 3 [Source:NC... [more]
setx0.000e+038.54senataxin [Source:Xenbase;Acc:XB-GENE-966858][more]
setx0.000e+038.18senataxin [Source:Xenbase;Acc:XB-GENE-966858][more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Piwil10.000e+038.12piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil20.000e+039.03piwi-like RNA-mediated gene silencing 2 [Source:MG... [more]
Piwil11.283e-16736.94piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil43.952e-15234.64piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
Piwil41.052e-12231.42piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
back to top
BLAST of SMEDWI-3 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A9ZSZ2|AGO3_BOMMO0.000e+038.64Piwi-like protein Ago3 OS=Bombyx mori OX=7091 GN=A... [more]
sp|A6N7Y9|PIWL1_CHICK0.000e+038.26Piwi-like protein 1 OS=Gallus gallus OX=9031 GN=PI... [more]
sp|Q96J94|PIWL1_HUMAN0.000e+038.51Piwi-like protein 1 OS=Homo sapiens OX=9606 GN=PIW... [more]
sp|Q9JMB7|PIWL1_MOUSE0.000e+038.12Piwi-like protein 1 OS=Mus musculus OX=10090 GN=Pi... [more]
sp|Q8TC59|PIWL2_HUMAN0.000e+039.30Piwi-like protein 2 OS=Homo sapiens OX=9606 GN=PIW... [more]
back to top
BLAST of SMEDWI-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203087290.000e+099.79tr|B2Z3D6|B2Z3D6_SCHMD Piwi protein WI-3 OS=Schmid... [more]
gnl|BL_ORD_ID|196026950.000e+090.54tr|D2Z0E0|D2Z0E0_DUGJA DjPiwiC OS=Dugesia japonica... [more]
gnl|BL_ORD_ID|213019750.000e+077.53tr|G9B7B8|G9B7B8_9PLAT Piwi C (Fragment) OS=Phagoc... [more]
gnl|BL_ORD_ID|211047850.000e+042.26tr|A0A2I7YUY6|A0A2I7YUY6_EISFE Piwi2 OS=Eisenia fe... [more]
gnl|BL_ORD_ID|215374150.000e+038.88tr|A0A0L8HBN2|A0A0L8HBN2_OCTBM Uncharacterized pro... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piwil10.000e+037.31piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil23.217e-18037.47piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil21.214e-17937.47piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil21.681e-16440.12piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
ago41.119e-4425.54protein argonaute-4 [Source:NCBI gene;Acc:10304381... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
piwil20.000e+037.52piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil12.344e-16134.72piwi-like RNA-mediated gene silencing 1 [Source:NC... [more]
ago21.969e-3533.48argonaute RISC catalytic component 2 [Source:ZFIN;... [more]
ENSPMAT00000009610.11.221e-2227.49pep scaffold:Pmarinus_7.0:GL477777:44890:66775:1 g... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMEDWI-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO340270.000e+042.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499310.000e+038.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464314.215e-4225.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281241.665e-2132.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281971.100e-1752.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piwil10.000e+039.34piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil10.000e+039.34piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil27.435e-18037.48piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil14.787e-15838.32piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil14.787e-15838.32piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
back to top
BLAST of SMEDWI-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081970.10.000e+099.90SMESG000081970.1[more]
SMESG000036375.11.275e-6627.18SMESG000036375.1[more]
SMESG000069984.11.291e-6027.66SMESG000069984.1[more]
SMESG000047591.11.733e-4224.85SMESG000047591.1[more]
SMESG000051000.11.559e-3932.15SMESG000051000.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30001362
GenBankACC97187.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001362 ID=SMED30001362|Name=SMEDWI-3|organism=Schmidtea mediterranea sexual|type=transcript|length=3093bp
AATTAAGAGACAGCCATTTATGTTTATTTTTAAAATAAATAGTATATATT
TAAGTTTCGAATTTTCAGCTACAATTTAATAGTACATAATTATACGATGT
CAGGAAGTAGTGGAATAGGTAGAGGCCGCAGTCGTGGGCTGTTGATGCAA
AAGTTTCTGAATAAAGATGTTCTTGTTCCTTCTGTTGAATCTTTAGAAGA
CAAAGCTCTTAATAAGCTAGGAATTCCACTTCCTGGGTCTACCGTAGAAA
AAAATACAGAGTCAAGTTCTATATCAAGTGGAGATTCAAGAAGTAATCCC
AGTGGAGATTCAAGAAATAACATAAAACTACAAGATAGTGATATTGAGAA
TCGCAATATTACCATTGTTACGCGACCATTATCCTGCATAGGCAGGGGTC
GGGGTTTAAGCAATCCCTCAAGTTTAACTACGTCATCGGGTAAATCGGAT
AAAATTACTGAAAACGAAGAACCTGGTCAAATTAAAAAGTTTGTAGGTCG
CGGTAGAGGATTGTTGAATTCTCAGAAAGAATGTTCAAACTCTACTCCAT
CTGAAGTTTCAAATGAATTGAAACAAATGAAAATTTCAAATGATGATAAA
ATGACGGTTTCTTCAGAAGCAAAGTCACAATTTGAGAACATTGAAAAACC
TATTAGTAAATTTCGTCGACGCGAATATCCAACTCAAATAAAAGAACCAT
GTAATACAAGAAATGATTCATCGCCATCTTTAACTTTAAGTGCTAATTAC
GTTAAAGTTAGGACTACACAACCCCATATATATCAATACCATGTTTCCTT
TGCACCTCCGATAGATTCAAGGTTGATGAGAATTAAAATAGTTCAAGGGT
TATCAGAATCAGATTTAGGGGTTGTCAAAGAAGCAAGAGCTTTTGACGGT
ATGAATTTATACATTCCTCAACTTTTAAAAAATAAAGAGACAATAATTAA
AGTAAACAAACCGACTGATAAGACTGTCGTGGATGTTAAAGTAGTTTTTA
CTAACAATGTTAATTTTAGTGAATGTCCTATGGTTTATAATGTTCTTTTT
AAAAGAATTGAAAATTCCCTCAGAATGGTTAAAATTGGTAGGGATTATTT
CTACCCTGAAAAAAAGATAGTACTTGACCGTAGAAGGATGGAAATATGGC
CGGGATATGTAACAAGTATCCAAAATTTTGACGGTGGTTTACTGTTACAA
TGCGATGTGTCACACAAAGTTATTCGAAATGATAGTGTGTATGACATAAT
GATGGAAATTAATAAAACTGTTAACAATAAAGGTCAAATGCAAACTGCTG
CGATTAATCAACTATTGGGTCAAATTGTGTTAACTCCTCACAATAACCGA
AATTATAGAATTACTGATATAGATTGGGCTAAAAATTGTTTAAGTGAATT
CGATAAAGGAGGCGAAAAAATTAGCTACCGGGATTATTTTAAGAACACGT
ATGGGCTACAAATTCGTGATCTAGAGCAGCCTATGATAGTTAGTAAATCT
AATAGCAGATCTGGTAAAAACCGAGGTCCCAAAGGATCAAAAGAAGTGGA
TGGTGGATTGGTCTATTTAATTCCAGAATTGTGTATGCTAACTGGTTTGA
CAGATGACATGATTAAAGATTTTCGTTTGATGAGAGAATTACACGAGCAT
TGTCGAGTTACTCCCAAGAAAAGACACGAAGCCTTACTGGAATTCGTGGA
TAACATATATAGCTGTGAGGAAGCTAAGAAACTTTTAGGGTATTGGGGTA
TAACGATTGAAAAGGACACTGTCAACATAAATGCTTGTAAAATGAATCCA
GAAATGATATATTTTGGAAATGAAGCTTCTGTTAGTGCTGGGGAACAAGC
TGAATTTAAACAAGCCTTGGCACATAATAAAGTTATAGGTGGTATTCGTA
TTGAAAATTGGATATTAATTTCTCCAAAAAGTTTACTGACAAAAGCAAAT
GGTCTGTTACAGGCTTTAATGAGCAAATCTCCTAGAGTTGGAGTTATGTT
TGGAAAACCCAAAATAGTTGAAATGAACAATGATCGAACAGAAGAGTATT
TAAAAGAATTAAAGAGAAATGTGGCTCCTGGTGTGCAGTTAGTAGTTACA
ATTTTATCTGCTGTTAGAGAAGATCGATACAATGCAATAAAAAAATTTTG
TTATGTGGATTGTCCTGTTCCAAGTCAAGTGGTATTAGCCCAAACATTGA
AAGAAGGGCCTAAATTAAATAGTGTGGCAGTTAATATAGCCCTTCAAATA
AACGCAAAATTAGGTGGAGAGCTGTGGGCTGTCAAAATACCTATTAAGAA
GTTTATGGTTGTTGGACTTGATGTTTGGCATGATACTAAAGGGAGAAGTA
GATCAGTTGGAGCCGTAGTTGGTTCAACTAATGCGCTATGCACAAGGTGG
TTTTCGAAATCGCATTTGCAAGAACAAGATAAAGAAATTATGTACGTATT
ACAGTCGTGTATGTTAAGCCTTTTAAAGGCTTATTTTGAAGAAAATAATT
TTTTGCCTGAGACTATCTTTATGTATAGGGATGGTGTTAGTGATGGTCAG
TTAGGATATGTTCAAAAAACTGAAATTGAACAATTCTTTAAAGTTTTTGA
ATCGTTTAGTGCTGATTATAAACCTAATATGGTATATAATGTTGTTCAAA
AGAGAATAAATACTAGGCTCTATGTAAGTGATCCGAAAAATAAAGGACAA
ATAAATAACCCCAATCCTGGTACAATTGTCGACCATACTGTTACGAGGGC
TAACCTTTATGATTTTTTTCTTGTTTCTCAATCGGTTAGGCAGGGAACTG
TAACTCCGACGCATTACGTTGTTTTATGTGACAATTCTAAATACACTCCG
CATCAGGTTCAGTTGATGGCTTATAAAACATGTCATATATATTACAATTG
GCCGGGAACGGTTCGAGTACCAGCACCTTGTATGTATGCTCATAAATTGG
CATATATGGTTGGTCAGAATTTGAAAGCTGAACCTAGTAATCTTTTATGT
GACAGACTTTTTTATTTGTAACATATGTGTTTCTATTTGTATTATTGTTA
AACTGCATTTCGTAAAATAAATTAATTTCGTTATAAAAAAAAA
back to top

protein sequence of SMED30001362-orf-1

>SMED30001362-orf-1 ID=SMED30001362-orf-1|Name=SMED30001362-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=975bp
MSGSSGIGRGRSRGLLMQKFLNKDVLVPSVESLEDKALNKLGIPLPGSTV
EKNTESSSISSGDSRSNPSGDSRNNIKLQDSDIENRNITIVTRPLSCIGR
GRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNST
PSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKE
PCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQ
GLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVV
FTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEI
WPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQT
AAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKN
TYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTG
LTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYW
GITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGI
RIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEE
YLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQT
LKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGR
SRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEEN
NFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVV
QKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQG
TVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHK
LAYMVGQNLKAEPSNLLCDRLFYL*
back to top
Aliases
The feature 'SMEDWI-3' has the following synonyms
Synonym
piwi-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0031047gene silencing by RNA
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0004517blastomere
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036397RNaseH_sf
IPR036085PAZ_dom_sf
IPR003165Piwi
IPR003100PAZ_dom
IPR012337RNaseH-like_sf
IPR014811ArgoL1
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005515protein binding
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000008Stage 8
PLANA:0000007Stage 7
PLANA:0000004Stage 4
PLANA:0000002Stage 2
PLANA:0000006Stage 6
PLANA:0000005Stage 5
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003165Piwi domainSMARTSM00950Piwi_a_2coord: 665..960
e-value: 8.0E-102
score: 354.3
IPR003165Piwi domainPFAMPF02171Piwicoord: 666..960
e-value: 7.8E-82
score: 274.9
IPR003165Piwi domainPROSITEPS50822PIWIcoord: 665..960
score: 44.288
IPR003100PAZ domainSMARTSM00949PAZ_2_a_3coord: 379..524
e-value: 2.3E-47
score: 173.3
IPR003100PAZ domainPFAMPF02170PAZcoord: 383..520
e-value: 1.2E-26
score: 93.1
IPR003100PAZ domainPROSITEPS50821PAZcoord: 406..500
score: 19.979
IPR014811Argonaute, linker 1 domainPFAMPF08699ArgoL1coord: 330..376
e-value: 6.3E-5
score: 22.6
NoneNo IPR availableGENE3DG3DSA:2.170.260.10coord: 378..508
e-value: 2.4E-37
score: 129.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 594..721
e-value: 1.2E-30
score: 108.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 102..126
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 49..80
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 102..117
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 36..80
NoneNo IPR availablePANTHERPTHR22891:SF111PIWI-LIKE PROTEIN 2coord: 128..974
NoneNo IPR availablePANTHERPTHR22891EUKARYOTIC TRANSLATION INITIATION FACTOR 2Ccoord: 128..974
NoneNo IPR availableCDDcd04658Piwi_piwi-like_Eukcoord: 510..957
e-value: 2.9918E-167
score: 494.862
NoneNo IPR availableCDDcd02845PAZ_piwi_likecoord: 378..502
e-value: 2.29915E-35
score: 128.147
IPR036397Ribonuclease H superfamilyGENE3DG3DSA:3.30.420.10coord: 730..967
e-value: 3.4E-78
score: 264.5
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 518..974
IPR036085PAZ domain superfamilySUPERFAMILYSSF101690PAZ domaincoord: 213..541