SMEDWI-3

Overview
NameSMEDWI-3 (ACC97187.1)
Smed IDSMED30001362
Uniprot Best hitPiwi-like protein 1 OS=Gallus gallus GN=PIWIL1 PE=2 SV=1 (E=0)
Length (bp)3093
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMEDWI-3 (SMED30001362) t-SNE clustered cells

Violin plots show distribution of expression levels for SMEDWI-3 (SMED30001362) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMEDWI-3 (SMED30001362) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMEDWI-3 (SMED30001362) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

SMEDWI-3 ( piwi-3 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the blastomere, neoblast compartment and blastomere compartment

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and piwi-3 (green). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S3 embryo costained with piwi-1 (green) and piwi-3 (red). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S5 embryo costained with piwi-1 (green) and piwi-3 (red). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

Homology
BLAST of SMEDWI-3 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 295/766 (38.51%), Postives = 465/766 (60.70%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  + +  AFDG  L++P+ L+ K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M    ++T  +K Q Q +   +L+G +VLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V IP+K  M+VG+D +HD     RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  I +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+NTR +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ DNS   P  +Q + YK CHIYYNWPG +RVPAPC YAHKLA++VGQ++  EP+  L +RL+YL
Sbjct:  114 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPIDIPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS--KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYYL 861          
BLAST of SMEDWI-3 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 295/766 (38.51%), Postives = 465/766 (60.70%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  + +  AFDG  L++P+ L+ K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M    ++T  +K Q Q +   +L+G +VLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V IP+K  M+VG+D +HD     RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  I +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+NTR +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ DNS   P  +Q + YK CHIYYNWPG +RVPAPC YAHKLA++VGQ++  EP+  L +RL+YL
Sbjct:  114 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPIDIPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS--KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYYL 861          
BLAST of SMEDWI-3 vs. Ensembl Human
Match: PIWIL2 (piwi like RNA-mediated gene silencing 2 [Source:HGNC Symbol;Acc:HGNC:17644])

HSP 1 Score: 556.214 bits (1432), Expect = 3.437e-180
Identity = 301/766 (39.30%), Postives = 443/766 (57.83%), Query Frame = 1
Query:  733 TLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNV-APG-VQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +L  N VK++     +YQYHV+F+P ++ + MR     G+ +    V     AFDG  LY+P  L+    +    K     +     +       S+ C   YNV+F+R+   L M  +GR+++ P   +VL + R++IWPGY  SI+  DGGL L  DVSHKVIRND V D+M  I +   NK   Q      L+G IV+T +NNR YRI D+DW K     F    G++I++ +Y+   YG+ +++ +QP+++ + + R   N G      +  G + L+PEL  +TG+ + M KDFR M++L +   ++PK+ H AL   +  I   E A   L  WG+ ++KD   I    +  E I   N + +++ E    K+ +  +  I  I +  W L  PK  + +A  L+  L   +  +G+    P  VE+ +DR E Y++ ++  + A G +Q+VV I+   R+D Y AIKK C V  PVPSQVV  +T+ +  +L SVA  I LQIN KLGGELW V IP+K+ MV+G+DV+HD     RSV   V S N   T+W+S+   Q   +EI+  L+ C++  LK ++E N+ LPE I +YRDGVSDGQL  V   EI Q  K FE+F  +Y+P MV  VVQK+I+T LY++ P+N      P PGT+VDHT+T     DF+L++  VRQG   PTHYV + + +  +P  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ G  L  EP+  LC+ LF+L
Sbjct:  225 SLGLNLVKIQCHNEAVYQYHVTFSPNVECKSMRF----GMLKDHQAVTGNVTAFDGSILYLPVKLQQVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPGYAASIRRTDGGLFLLADVSHKVIRNDCVLDVMHAIYQ--QNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQ-DNHG-----MLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIAKNEAATNELMRWGLRLQKDVHKIEGRVLPMERINLKNTSFITSQELNWVKE-VTRDPSILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYVRTIQSTLGAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQINCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFE-NYQPKMVVFVVQKKISTNLYLAAPQN---FVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHHEPAIQLCENLFFL 973          
BLAST of SMEDWI-3 vs. Ensembl Human
Match: PIWIL2 (piwi like RNA-mediated gene silencing 2 [Source:HGNC Symbol;Acc:HGNC:17644])

HSP 1 Score: 556.214 bits (1432), Expect = 3.437e-180
Identity = 301/766 (39.30%), Postives = 443/766 (57.83%), Query Frame = 1
Query:  733 TLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNV-APG-VQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +L  N VK++     +YQYHV+F+P ++ + MR     G+ +    V     AFDG  LY+P  L+    +    K     +     +       S+ C   YNV+F+R+   L M  +GR+++ P   +VL + R++IWPGY  SI+  DGGL L  DVSHKVIRND V D+M  I +   NK   Q      L+G IV+T +NNR YRI D+DW K     F    G++I++ +Y+   YG+ +++ +QP+++ + + R   N G      +  G + L+PEL  +TG+ + M KDFR M++L +   ++PK+ H AL   +  I   E A   L  WG+ ++KD   I    +  E I   N + +++ E    K+ +  +  I  I +  W L  PK  + +A  L+  L   +  +G+    P  VE+ +DR E Y++ ++  + A G +Q+VV I+   R+D Y AIKK C V  PVPSQVV  +T+ +  +L SVA  I LQIN KLGGELW V IP+K+ MV+G+DV+HD     RSV   V S N   T+W+S+   Q   +EI+  L+ C++  LK ++E N+ LPE I +YRDGVSDGQL  V   EI Q  K FE+F  +Y+P MV  VVQK+I+T LY++ P+N      P PGT+VDHT+T     DF+L++  VRQG   PTHYV + + +  +P  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ G  L  EP+  LC+ LF+L
Sbjct:  225 SLGLNLVKIQCHNEAVYQYHVTFSPNVECKSMRF----GMLKDHQAVTGNVTAFDGSILYLPVKLQQVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPGYAASIRRTDGGLFLLADVSHKVIRNDCVLDVMHAIYQ--QNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQ-DNHG-----MLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIAKNEAATNELMRWGLRLQKDVHKIEGRVLPMERINLKNTSFITSQELNWVKE-VTRDPSILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYVRTIQSTLGAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQINCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFE-NYQPKMVVFVVQKKISTNLYLAAPQN---FVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHHEPAIQLCENLFFL 973          
BLAST of SMEDWI-3 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 516.153 bits (1328), Expect = 1.169e-166
Identity = 272/728 (37.36%), Postives = 434/728 (59.62%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWP 2904
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  + +  AFDG  L++P+ L+ K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M    ++T  +K Q Q +   +L+G +VLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V IP+K  M+VG+D +HD     RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  I +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+NTR +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ DNS   P  +Q + YK CHIYYNWP
Sbjct:  114 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPIDIPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS--KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWP 823          
BLAST of SMEDWI-3 vs. Ensembl Celegans
Match: prg-1 (Piwi-like protein [Source:RefSeq peptide;Acc:NP_492121])

HSP 1 Score: 430.639 bits (1106), Expect = 1.178e-134
Identity = 257/790 (32.53%), Postives = 440/790 (55.70%), Query Frame = 1
Query:  742 ANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETI-IXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYF-YPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLG-QIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLL-QALMSKSPRVG----VMFGKPKIVEMNNDRTEEYLKELKRNV----APGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLK-------EGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENN-FLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFS---------ADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            AN++ +  TQ    IYQYHV F P +DS+  R K+++  + +D   +     FDGM LY+ +  +  + I ++         +  K      V+  +   ++N + +R  ++L++ ++GR+YF + + + V D   M I PGY T+I+ ++   +L  +   K++R +S+Y +  +  ++  N  Q     +N++ G   ++T +NN+ +R T +D++ + LSEF K G+ I+ ++YFKN YG++I   +QP+I+S+     GK + P    +V     Y++PELC  TGLTD+M KDF++M+E+ +H R++P++R     + + ++   E+  +   YWGI++ +D  N+ A  +  E +          G+QAE+ + +    +  G  + NWI+I P S     +GLL Q  + ++ R+G    V  G+P  V +      +YL+ +K  +       + ++V +L+   + RY+++KKF  V+CP+P+Q V  +TL        E   L S+ + I LQ+  K GG LW V IP+K  M+VG D++HD+  + ++VGA V +T+   T+++S++   E   ++   L   +   LK Y++ N+  LP  + +YRDG  DGQ+ Y++ TE++      ++ +            K  + + +V KR+N R+          IN P PGT+VD TVTR    DF+LV Q V QGTVTP  Y ++ D++   P + Q +A+K CH+YYNW GTVRVPAPC YAHKLA++  Q+L  + +  L D+LF+L
Sbjct:   54 ANFIPIEMTQSDYSIYQYHVEFEPTVDSKANREKMLRDNNVTD--EIGHHFVFDGMILYLKEEWEQNQMIEVQHPIDRSLICIRFKQTNRFLVDDPQTINIFNTIIRRSFDALQLTQLGRNYFNWGDSRAVPDYN-MSILPGYETAIRMYEENFMLCVENRFKMVREESMYILFHKELRSCQNNPQRVQEKMNEMYGGTTIITRYNNKLHRYTRLDYSISPLSEFVKDGQSITLKEYFKNQYGIEITVDDQPIIISE-----GKPKQPGEPPQVS----YIVPELCFPTGLTDEMRKDFKMMKEIAKHTRMSPQQRLVESRKLIVDLSKNEKVMECFKYWGISLGQDLANVQARVLKSEPL---QGKKTYEGKQAEWARGVKECGIYRGSNMTNWIVIGPGS---GNSGLLSQKFIEEARRLGKILQVQLGEPMCVPIRGISPNDYLEGVKGAIKQVDGEDIHMLVVMLADDNKTRYDSLKKFLCVECPIPNQCVNLRTLAGKSKDGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKNTMIVGYDLYHDSTLKGKTVGACVSTTSNDFTQFYSQTRPHENPTQLGNNLTHFVRKALKQYYDSNDQTLPSRLILYRDGAGDGQIPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLAFIIVTKRVNMRILKQGSSLDNAIN-PQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHDDTDLGPDKHQQLAFKLCHLYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDANGCLRDKLFFL 824          
BLAST of SMEDWI-3 vs. Ensembl Celegans
Match: prg-2 (Piwi-like protein [Source:RefSeq peptide;Acc:NP_500994])

HSP 1 Score: 389.037 bits (998), Expect = 3.878e-120
Identity = 242/775 (31.23%), Postives = 408/775 (52.65%), Query Frame = 1
Query:  778 IYQYHVSFAPPIDSRLMRIKIVQGLSES-DLGVVKEARAFDGMNLYIPQLLKNKETI-IXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLL-QALMSKSPRVG----VMFGKPKIVEMNNDRTEEYLKELKRNV----APGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLK-------EGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENN-FLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFS---------ADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            IYQYHV F P +DS+  R  +++  S + ++G   +   FDGM LY+ +     + I ++         +  K      V+  +   ++N + +R  +++++ +IGR+YF               W                           D+   +  E+    NN+ ++Q        G  ++T +NN+ +R T +D     LS+F K GE+I  ++YFKN Y + I D EQ +I+S+     GK + P    +V+    Y++PELC  TGLTD+M KDF++M+E+ +H R++P++R +   + +  +   +   +   YWGI++ +D  N+ A  +  E +    +     G+QAE+ + +    +  G  + NWI+I P S     +GLL Q  ++++  +G    V  G+P  V++N     +YL+ LK  +       + ++V +L+   + RY+++KK+  V+CP+P+Q V  +TL        E   L S+ + I LQ+  K GG LW V IP+K  M+VG D++HD+  + ++VGA V +T+   T+++S++   E   ++   L   +   LK Y++ N+  LP  + +YRDG  DGQ+ Y++ TE++      ++ +            K  + + +V KR+N R+      +K  IN P PGT+VD TVTR    DF+LV Q V QGTVTP  Y ++ D++   P + Q +A+K CH+YYNW GTVRVPAPC YAHKLA++  Q+L  + +  L D+LF+L
Sbjct:    8 IYQYHVEFEPTVDSKATRENMLRQPSVTVEIG---KHFVFDGMILYLKEEWDQNQMIEVQHPNDNSLICIRFKKTNRFLVDDPQTINIFNTIIRRSFDAMKLTQIGRNYF--------------DW---------------------------DNSRALRKELRSCQNNRQRVQEKMNEVYGGSTIITRYNNKLHRFTRLDNEITPLSKFQKDGEQIILKEYFKNQYDIDITDDEQFIIISE-----GKPKQPGEPPQVN----YIVPELCFPTGLTDEMRKDFKMMKEIAKHTRMSPQQRLDETRKLITKLSQNQTMMECFQYWGISLGQDLANVQARVLKSEPLQGKRQYE---GKQAEWARGVKECGIYRGSNMTNWIVIGPGS---GNSGLLAQKFIAEARNLGRTLQVQLGEPMCVKINGISPNDYLEGLKAAIKSVDGEEIHMLVVMLADDNKTRYDSLKKYLCVECPIPNQCVNLRTLAGKSKDGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKSTMIVGYDLYHDSTLKGKTVGACVSTTSNDFTQFYSQTRPHENPTQLGNNLTHFVRKSLKQYYDNNDKTLPSRLILYRDGAGDGQIPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLAFIIVTKRVNMRILKQGSSSKSAIN-PQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHDDTGLGPDKHQQLAFKLCHLYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDANGYLRDKLFFL 722          
BLAST of SMEDWI-3 vs. Ensembl Celegans
Match: alg-2 (pep:known chromosome:WBcel235:II:874160:878954:1 gene:WBGene00000106 transcript:T07D3.7b gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 168.703 bits (426), Expect = 1.506e-42
Identity = 166/685 (24.23%), Postives = 298/685 (43.50%), Query Frame = 1
Query: 1066 SLRMVKIGRDYFYP------------EKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVI-RNDSVYDIMMEI----------NKTVNNKGQMQ-TAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD---KGGEKI--SYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHE-----HCRVTPKKRHEALLEFVDNIYSCE-EAKKLLGYWGITIEKDTVNINACKMN-PEMIYFG-NEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKI-------VEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ-TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPI-------KKFMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAY 2955
            SL+   +GR +F P            E K+   R   E+W G+  S++     ++L  DVS     R   V + + E+           + +++  +++ T  I  L  +I       R YR+ ++         F    + G+ I  +   YF + Y +Q++    P +      +                  YL PE+C       D++   R +++L +       + T +   E   E    +   E  A      +GITI      +    ++ P+++Y G + A+ +   Q  +   +   +   G+ +  W +             L+   ++  R+    G P I            ++ E   K LK+  +  +QL+V +L   +   Y  +K+       + +Q V A+  ++  P+  S   N+ L++N KLGG + ++ +P        +  + +G D+ H   G +R  S+ AVVGS +A  +R+ +   +Q+  +EI+  L   +  LL  ++    F P  I +YRDGVS+GQL  V + E+    +      + Y+P + +  VQKR +TRL+ +D  ++ G+  N  PGT VD  +T    +DFFL S +  QGT  P+HY VL D++  T  ++Q + Y+ CH Y     +V +PAP  YAH +A+
Sbjct:  191 SLKYTPVGRSFFTPPGVMKPGMQMHQESKLGGGR---EVWFGFHQSVRPSQWKMMLNIDVSATAFYRAMPVIEFVAEVLELPVQALAERRALSDAQRVKFTKEIRGLKIEITHCGAVRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFFDKYRIQLKYPHLPCLQVGQEQKH----------------TYLPPEVC-------DIVPGQRCLKKLTDVQTSTMIKATARSAPEREREICKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWD--MRGKQFHTGMEVRTWAIACFAQQSHVKENDLRMFTTQLQRISTDAGMPIIGTPMFCKYASGVEQVEPMFKYLKQTYS-AIQLIVVVLPG-KTPIYAEVKRVGDTVLGIATQCVQAKNAIRTTPQTLS---NLCLKMNVKLGG-VNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQPGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWDDNDLTADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAF 841          
BLAST of SMEDWI-3 vs. Ensembl Celegans
Match: alg-2 (pep:known chromosome:WBcel235:II:873176:878954:1 gene:WBGene00000106 transcript:T07D3.7a gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 168.318 bits (425), Expect = 2.018e-42
Identity = 166/685 (24.23%), Postives = 298/685 (43.50%), Query Frame = 1
Query: 1066 SLRMVKIGRDYFYP------------EKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVI-RNDSVYDIMMEI----------NKTVNNKGQMQ-TAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD---KGGEKI--SYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHE-----HCRVTPKKRHEALLEFVDNIYSCE-EAKKLLGYWGITIEKDTVNINACKMN-PEMIYFG-NEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKI-------VEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ-TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPI-------KKFMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAY 2955
            SL+   +GR +F P            E K+   R   E+W G+  S++     ++L  DVS     R   V + + E+           + +++  +++ T  I  L  +I       R YR+ ++         F    + G+ I  +   YF + Y +Q++    P +      +                  YL PE+C       D++   R +++L +       + T +   E   E    +   E  A      +GITI      +    ++ P+++Y G + A+ +   Q  +   +   +   G+ +  W +             L+   ++  R+    G P I            ++ E   K LK+  +  +QL+V +L   +   Y  +K+       + +Q V A+  ++  P+  S   N+ L++N KLGG + ++ +P        +  + +G D+ H   G +R  S+ AVVGS +A  +R+ +   +Q+  +EI+  L   +  LL  ++    F P  I +YRDGVS+GQL  V + E+    +      + Y+P + +  VQKR +TRL+ +D  ++ G+  N  PGT VD  +T    +DFFL S +  QGT  P+HY VL D++  T  ++Q + Y+ CH Y     +V +PAP  YAH +A+
Sbjct:  210 SLKYTPVGRSFFTPPGVMKPGMQMHQESKLGGGR---EVWFGFHQSVRPSQWKMMLNIDVSATAFYRAMPVIEFVAEVLELPVQALAERRALSDAQRVKFTKEIRGLKIEITHCGAVRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFFDKYRIQLKYPHLPCLQVGQEQKH----------------TYLPPEVC-------DIVPGQRCLKKLTDVQTSTMIKATARSAPEREREICKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWD--MRGKQFHTGMEVRTWAIACFAQQSHVKENDLRMFTTQLQRISTDAGMPIIGTPMFCKYASGVEQVEPMFKYLKQTYS-AIQLIVVVLPG-KTPIYAEVKRVGDTVLGIATQCVQAKNAIRTTPQTLS---NLCLKMNVKLGG-VNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQPGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWDDNDLTADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAF 860          
BLAST of SMEDWI-3 vs. Ensembl Celegans
Match: alg-1 (pep:known chromosome:WBcel235:X:13951262:13956256:1 gene:WBGene00000105 transcript:F48F7.1a gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 166.392 bits (420), Expect = 9.762e-42
Identity = 162/659 (24.58%), Postives = 289/659 (43.85%), Query Frame = 1
Query: 1099 FYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVI-RNDSVYDIMMEI----------NKTVNNKGQMQ-TAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD---KGGEKI--SYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIK--DFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEE--AKKLLGYWGITIEKDTVNINACKMN-PEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKI-------VEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ-TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPI-------KKFMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAY 2955
            ++ E K+   R   E+W G+  S++     ++L  DVS     R+  V + + E+           + +++  +++ T  I  L  +I       R YR+ ++         F    + G+ I  +   YF + Y +Q++    P +      +                  YL PE+C +      + K  D +    +    R  P++  E     + N+    E  A      +GITI      +    ++ P+++Y G   + +   Q  +   +   +   GI +  W +             L+   ++  R+    G P +         +  ++ E   K LK+N + G+QLVV +L   +   Y  +K+       + +Q V A+  ++  P+  S   N+ L++N KLGG + ++ +P        +  +  G D+ H   G SR  S+ AVVGS +A  +R+ +   +Q+  +EI+  L   +  LL  ++    F P  I +YRDGVS+GQ   V + E+    +        Y+P + +  VQKR +TRL+  D K++ G+  N  PGT VD  +T    +DF+L S +  QGT  P+HY VL D++  T  ++Q + Y+ CH Y     +V +PAP  YAH +A+
Sbjct:  328 YHAESKLGGGR---EVWFGFHQSVRPSQWKMMLNIDVSATAFYRSMPVIEFIAEVLELPVQALAERRALSDAQRVKFTKEIRGLKIEITHCGQMRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFYDKYRIQLKYPHLPCLQVGQEQKH----------------TYLPPEVCNIVPGQRCIKKLTDVQTSTMIKATARSAPERERE-----ISNLVRKAEFSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRTRATALPNQGVWD--MRGKQFHTGIDVRVWAIACFAQQQHVKENDLRMFTNQLQRISNDAGMPIVGNPCFCKYAVGVEQVEPMFKYLKQNYS-GIQLVVVVLPG-KTPVYAEVKRVGDTVLGIATQCVQAKNAIRTTPQTLS---NLCLKMNVKLGG-VNSILLPNVRPRIFNEPVIFFGCDITHPPAGDSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQPGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNLTADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAF 954          
BLAST of SMEDWI-3 vs. Ensembl Fly
Match: AGO3 (Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250816])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 301/766 (39.30%), Postives = 456/766 (59.53%), Query Frame = 1
Query:  727 SLTLSANYVKVRTTQPH-IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVY-LIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S+ +  NY+K+ T +   ++ Y V F PPIDS  +RIK +    +  LG  K    FDG  LY+P LL NK T+        +  + +       +    C  +YN+LF R+   L  VK  R  F P +  ++   ++E+WPGYVT++  + GGL+L CDVSH+++   +V ++++++ +   N    Q +A   L+G IVLT +NNR Y+I DI + +N   +F+      SY +Y+K  + + I+D+ QP+I S       K+RG    +E    L + LIPELC LTGL D++  D +LMRE+    RV+P +R  AL +F +N+ +   A+++L  WG+++  ++  I+  +M+ E IYF ++ SVSAG  AEF +    N+++  + +  WI+I  ++    A  LL  +      +G+    P ++ +++DR + Y++ L+RN+    Q+VV I    R+DRY AIKK C  + P+PSQV+ A+TL+   K+ SV   I LQ+N KLGG LW VKIP K  M+ G+D +HD   R  SV A V S N+  ++W+SK+ +Q + +EI+  L +     LK Y + N  LP  I +YRDG+ DGQL      EI QF  V  +     +  + Y VVQKRINTR++     +   + NP PGT+VD  +T++N+YDFFLVSQ VRQGTVTPTHYVVL D+  Y P  +Q ++YK C +YYNW GTVR+PA CMYAHKLAY++GQ+++ + +  L ++LFYL
Sbjct:  127 SVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND-HKDKLGGTK---TFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEM--RNCTQLYNILFDRVMKVLNYVKFDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQ--QNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIK-----KSRGIPAERE---NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF-SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGN-----RIKISYIVVQKRINTRIF---SGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-3 vs. Ensembl Fly
Match: AGO3 (Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250816])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 301/766 (39.30%), Postives = 456/766 (59.53%), Query Frame = 1
Query:  727 SLTLSANYVKVRTTQPH-IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVY-LIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S+ +  NY+K+ T +   ++ Y V F PPIDS  +RIK +    +  LG  K    FDG  LY+P LL NK T+        +  + +       +    C  +YN+LF R+   L  VK  R  F P +  ++   ++E+WPGYVT++  + GGL+L CDVSH+++   +V ++++++ +   N    Q +A   L+G IVLT +NNR Y+I DI + +N   +F+      SY +Y+K  + + I+D+ QP+I S       K+RG    +E    L + LIPELC LTGL D++  D +LMRE+    RV+P +R  AL +F +N+ +   A+++L  WG+++  ++  I+  +M+ E IYF ++ SVSAG  AEF +    N+++  + +  WI+I  ++    A  LL  +      +G+    P ++ +++DR + Y++ L+RN+    Q+VV I    R+DRY AIKK C  + P+PSQV+ A+TL+   K+ SV   I LQ+N KLGG LW VKIP K  M+ G+D +HD   R  SV A V S N+  ++W+SK+ +Q + +EI+  L +     LK Y + N  LP  I +YRDG+ DGQL      EI QF  V  +     +  + Y VVQKRINTR++     +   + NP PGT+VD  +T++N+YDFFLVSQ VRQGTVTPTHYVVL D+  Y P  +Q ++YK C +YYNW GTVR+PA CMYAHKLAY++GQ+++ + +  L ++LFYL
Sbjct:  127 SVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND-HKDKLGGTK---TFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEM--RNCTQLYNILFDRVMKVLNYVKFDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQ--QNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIK-----KSRGIPAERE---NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF-SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGN-----RIKISYIVVQKRINTRIF---SGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-3 vs. Ensembl Fly
Match: AGO3 (Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250816])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 301/766 (39.30%), Postives = 456/766 (59.53%), Query Frame = 1
Query:  727 SLTLSANYVKVRTTQPH-IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVY-LIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S+ +  NY+K+ T +   ++ Y V F PPIDS  +RIK +    +  LG  K    FDG  LY+P LL NK T+        +  + +       +    C  +YN+LF R+   L  VK  R  F P +  ++   ++E+WPGYVT++  + GGL+L CDVSH+++   +V ++++++ +   N    Q +A   L+G IVLT +NNR Y+I DI + +N   +F+      SY +Y+K  + + I+D+ QP+I S       K+RG    +E    L + LIPELC LTGL D++  D +LMRE+    RV+P +R  AL +F +N+ +   A+++L  WG+++  ++  I+  +M+ E IYF ++ SVSAG  AEF +    N+++  + +  WI+I  ++    A  LL  +      +G+    P ++ +++DR + Y++ L+RN+    Q+VV I    R+DRY AIKK C  + P+PSQV+ A+TL+   K+ SV   I LQ+N KLGG LW VKIP K  M+ G+D +HD   R  SV A V S N+  ++W+SK+ +Q + +EI+  L +     LK Y + N  LP  I +YRDG+ DGQL      EI QF  V  +     +  + Y VVQKRINTR++     +   + NP PGT+VD  +T++N+YDFFLVSQ VRQGTVTPTHYVVL D+  Y P  +Q ++YK C +YYNW GTVR+PA CMYAHKLAY++GQ+++ + +  L ++LFYL
Sbjct:  127 SVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND-HKDKLGGTK---TFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEM--RNCTQLYNILFDRVMKVLNYVKFDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQ--QNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIK-----KSRGIPAERE---NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF-SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGN-----RIKISYIVVQKRINTRIF---SGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-3 vs. Ensembl Fly
Match: AGO3 (Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250816])

HSP 1 Score: 526.554 bits (1355), Expect = 1.979e-170
Identity = 288/741 (38.87%), Postives = 433/741 (58.43%), Query Frame = 1
Query:  727 SLTLSANYVKVRTTQPH-IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVY-LIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAH 2943
            S+ +  NY+K+ T +   ++ Y V F PPIDS  +RIK +    +  LG  K    FDG  LY+P LL NK T+        +  + +       +    C  +YN+LF R+   L  VK  R  F P +  ++   ++E+WPGYVT++  + GGL+L CDVSH+++   +V ++++++ +   N    Q +A   L+G IVLT +NNR Y+I DI + +N   +F+      SY +Y+K  + + I+D+ QP+I S       K+RG    +E    L + LIPELC LTGL D++  D +LMRE+    RV+P +R  AL +F +N+ +   A+++L  WG+++  ++  I+  +M+ E IYF  + SVSAG  AEF +    N+++  + +  WI+I  ++    A  LL  +      +G+    P ++ +++DR + Y++ L+RN+    Q+VV I    R+DRY AIKK C  + P+PSQV+ A+TL+   K+ SV   I LQ+N KLGG LW VKIP K  M+ G+D +HD   R  SV A V S N+  ++W+SK+ +Q + +EI+  L +     LK Y + N  LP  I +YRDG+ DGQL      EI QF  V        +  + Y VVQKRINTR++     +   + NP PGT+VD  +T++N+YDFFLVSQ VRQGTVTPTHYVVL D+  Y P  +Q ++YK C +YYNW GTVR+PA CM +H
Sbjct:  127 SVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND-HKDKLGGTK---TFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEM--RNCTQLYNILFDRVMKVLNYVKFDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQ--QNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIK-----KSRGIPAERE---NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFS-KISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMV-----CGNRIKISYIVVQKRINTRIF---SGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMVSH 842          
BLAST of SMEDWI-3 vs. Ensembl Fly
Match: aub (aubergine [Source:FlyBase gene name;Acc:FBgn0000146])

HSP 1 Score: 425.631 bits (1093), Expect = 5.072e-133
Identity = 253/783 (32.31%), Postives = 420/783 (53.64%), Query Frame = 1
Query:  730 LTLSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKET------IIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK---SNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQV----VLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCT-RWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEI----EQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +T+ ANY KV   +P+  IYQY V F P +++  +R    +       G++     FDG N++     K  +       ++  ++  +   + +K V +     +E   V N++ +R    L +  + R Y+ P+ KI L+  RM++WPGY TSI+  +  +LL  ++ HKV+R +++Y+I+ +    + +    Q+     ++G ++LT +NN+ YRI D+D+    L +F     +ISY DY+K  Y + IRDL+QP+++S+    N R G ++            + +IPEL   TG+TD M  DFR +R + EH R+ P +R E L  F   + SC+++ + L  W I ++   V I A  + PE I FGN+       +A++        +   + I  W +I+P   L +    +Q  +  +  + +    P   E+ +DR   Y + +    A   Q+V+ ++ +  E++Y+ IKK   VD PVPSQV    V+A   ++   L S+A  + +Q+NAKL G  W V IP+   M VG DV H  K +++S GA V + +   + R+FS  +   + +E+   +   M   L++Y E++  LPE I  +RDGV DGQL  V  +E+    ++  ++++S        M + +V KRIN+R +           NP PGT+VD  +T    YDFFLVSQ+VR GTV+PT Y V+ DN      ++Q+++YK  H+YYN+ GT+RVPA C YAHKLA++V +++   PS  L ++L++L
Sbjct:   40 ITVQANYFKV-LKRPNWTIYQYRVDFTPDVEATRLR----RSFLYEHKGILG-GYIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYYDPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICHKVMRTETLYNILSD---AIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSRPTDKNIRGGNDQA-----------IMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWTNEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGH-------RNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAESINRAPSAGLQNQLYFL 795          
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:ZFIN;Acc:ZDB-GENE-030813-2])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 295/770 (38.31%), Postives = 452/770 (58.70%), Query Frame = 1
Query:  718 SSPSLTLSANYVKVRTTQP--HIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S  ++ L AN++++  ++P   +YQYHV + PP++SR +R  ++    E+    + +A  FDG  L++P  L+N ET++       + V     +       S  C   YN+LF+RI   L M +IGR Y+ P+    + + R+ IWPG++T+I  ++  ++L  DVSHKV+R+++V D M  + +   ++ +   A   +L+G I+LT +NN+ YRI DI W     + F KG  +IS+++YFK+ YGL I D  Q ++VS              S     G   L+PE C LTGLTD M  DF +M++L  H R++P++R   +   + NI    + +  L  WG++ E   +++N   +  E I  G  A       A++ + +    +I  + ++NW++   +     A  LLQ L   S  +G+   +  ++E   DR E  L+ L++NVA   Q+VV IL   R+D+Y+ +KK+  VDCP PSQ V+++T+ +   L +VA  IALQ+N K+GGELW+V+IP+++ M+VG+D +HDT    RS+GA+V S N   +RWFSK  LQ + +EI+  L+  +   LKAY + NN LP  I +YRDGV DG L  V   E+ Q  +  ++   DY+P +   VV+KRI++R +    +  G+I NP PGT++D  VTR   YDFF+VSQ+VR G V PTHY V+ DNS   P  +Q + YK CH+YYNW G VRVPAPC YAHKLA++VGQ++  EP+  L D L+YL
Sbjct:  106 SGTAIELRANFMRL-LSRPMWALYQYHVDYKPPMESRRLRSALLFQHEET----LGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDDPFNIPQHRLTIWPGFMTTILQYESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQ-RFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGP-------SGRPPPGPAMLVPEFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYE-DRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYEPKLSVVVVKKRISSRFFA---RIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPNMNLDDFLYYL 858          
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:ZFIN;Acc:ZDB-GENE-030813-2])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 295/770 (38.31%), Postives = 452/770 (58.70%), Query Frame = 1
Query:  718 SSPSLTLSANYVKVRTTQP--HIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S  ++ L AN++++  ++P   +YQYHV + PP++SR +R  ++    E+    + +A  FDG  L++P  L+N ET++       + V     +       S  C   YN+LF+RI   L M +IGR Y+ P+    + + R+ IWPG++T+I  ++  ++L  DVSHKV+R+++V D M  + +   ++ +   A   +L+G I+LT +NN+ YRI DI W     + F KG  +IS+++YFK+ YGL I D  Q ++VS              S     G   L+PE C LTGLTD M  DF +M++L  H R++P++R   +   + NI    + +  L  WG++ E   +++N   +  E I  G  A       A++ + +    +I  + ++NW++   +     A  LLQ L   S  +G+   +  ++E   DR E  L+ L++NVA   Q+VV IL   R+D+Y+ +KK+  VDCP PSQ V+++T+ +   L +VA  IALQ+N K+GGELW+V+IP+++ M+VG+D +HDT    RS+GA+V S N   +RWFSK  LQ + +EI+  L+  +   LKAY + NN LP  I +YRDGV DG L  V   E+ Q  +  ++   DY+P +   VV+KRI++R +    +  G+I NP PGT++D  VTR   YDFF+VSQ+VR G V PTHY V+ DNS   P  +Q + YK CH+YYNW G VRVPAPC YAHKLA++VGQ++  EP+  L D L+YL
Sbjct:  106 SGTAIELRANFMRL-LSRPMWALYQYHVDYKPPMESRRLRSALLFQHEET----LGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDDPFNIPQHRLTIWPGFMTTILQYESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQ-RFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGP-------SGRPPPGPAMLVPEFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYE-DRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYEPKLSVVVVKKRISSRFFA---RIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPNMNLDDFLYYL 858          
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:ZFIN;Acc:ZDB-GENE-060526-345])

HSP 1 Score: 556.984 bits (1434), Expect = 6.636e-180
Identity = 290/781 (37.13%), Postives = 456/781 (58.39%), Query Frame = 1
Query:  688 IKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVA--PGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +KEP          + + +NY+ +      ++QYHV+F P ++S  MR     G+ +       E  AFDG  LY+P+ L+    +    K  ++ +     +       S+ C   YNV+ +R+   L +  +GR+++ P   ++L + R+++WPGY TSI++ DGGL L  DVSHKV+RNDSV D+M  I +   ++   Q     + +G IV+T +NNR YRI DI+W+K+    F    G   ++ DY++  YG+ I++L+QP+++ +   RS      +   +V  G + L+PEL  +TG+ + M KDFR M++L  H  V  ++  ++L + + NI S  EA   LG WG++I ++ +      +  E I   + AS       ++ + L  +  I  + +  W +  P+    +A  L+      +  +G+   +P  VE+ +DRTE ++K +   +   P VQLVV I++  R+D Y+AIKK C +  PVPSQ +  +T+ +  KL SVA  I LQIN KLGGELW V +P+K  MV+G+DV HDT  +SRSV   V S N++ T+W+S+   Q  ++EI+   + C+L+ L+ Y+E N+  PE I +YRDGVSDGQL  V+  EI Q  K FE+   +Y+P + + VVQKRI+T LY     + G    P+PGT++DHTVT  +  DF+L++ S+RQG   PTHY+ + + +  TP  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L +EP+  L ++LF+L
Sbjct:  283 VKEPLQKIGTKGSPIPIGSNYIPICCKNDAVFQYHVTFTPNVESLSMRF----GMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAERKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPNAVVILGKHRLQVWPGYSTSIKHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQ--GSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLIHRPKERS------RPGGKVITGEILLLPELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICL-HSASFVTSPAVDWSRELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETI-PNYEPKLAFIVVQKRISTTLYSYGSDHFG---TPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLSEKLFFL 1046          
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:ZFIN;Acc:ZDB-GENE-060526-345])

HSP 1 Score: 556.984 bits (1434), Expect = 6.636e-180
Identity = 290/781 (37.13%), Postives = 456/781 (58.39%), Query Frame = 1
Query:  688 IKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVA--PGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +KEP          + + +NY+ +      ++QYHV+F P ++S  MR     G+ +       E  AFDG  LY+P+ L+    +    K  ++ +     +       S+ C   YNV+ +R+   L +  +GR+++ P   ++L + R+++WPGY TSI++ DGGL L  DVSHKV+RNDSV D+M  I +   ++   Q     + +G IV+T +NNR YRI DI+W+K+    F    G   ++ DY++  YG+ I++L+QP+++ +   RS      +   +V  G + L+PEL  +TG+ + M KDFR M++L  H  V  ++  ++L + + NI S  EA   LG WG++I ++ +      +  E I   + AS       ++ + L  +  I  + +  W +  P+    +A  L+      +  +G+   +P  VE+ +DRTE ++K +   +   P VQLVV I++  R+D Y+AIKK C +  PVPSQ +  +T+ +  KL SVA  I LQIN KLGGELW V +P+K  MV+G+DV HDT  +SRSV   V S N++ T+W+S+   Q  ++EI+   + C+L+ L+ Y+E N+  PE I +YRDGVSDGQL  V+  EI Q  K FE+   +Y+P + + VVQKRI+T LY     + G    P+PGT++DHTVT  +  DF+L++ S+RQG   PTHY+ + + +  TP  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L +EP+  L ++LF+L
Sbjct:  283 VKEPLQKIGTKGSPIPIGSNYIPICCKNDAVFQYHVTFTPNVESLSMRF----GMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAERKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPNAVVILGKHRLQVWPGYSTSIKHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQ--GSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLIHRPKERS------RPGGKVITGEILLLPELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICL-HSASFVTSPAVDWSRELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETI-PNYEPKLAFIVVQKRISTTLYSYGSDHFG---TPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLSEKLFFL 1046          
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:ZFIN;Acc:ZDB-GENE-060526-345])

HSP 1 Score: 480.33 bits (1235), Expect = 2.016e-150
Identity = 260/729 (35.67%), Postives = 414/729 (56.79%), Query Frame = 1
Query:  688 IKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVA--PGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQ 2862
            +KEP          + + +NY+ +      ++QYHV+F P ++S  MR     G+ +       E  AFDG  LY+P+ L+    +    K  ++ +     +       S+ C   YNV+ +R+   L +  +GR+++ P   ++L + R+++WPGY TSI++ DGGL L  DVSHKV+RNDSV D+M  I +   ++   Q     + +G IV+T +NNR YRI DI+W+K+    F    G   ++ DY++  YG+ I++L+QP+++ +   RS      +   +V  G + L+PEL  +TG+ + M KDFR M++L  H  V  ++  ++L + + NI S  EA   LG WG++I ++ +      +  E I   + AS       ++ + L  +  I  + +  W +  P+    +A  L+      +  +G+   +P  VE+ +DRTE ++K +   +   P VQLVV I++  R+D Y+AIKK C +  PVPSQ +  +T+ +  KL SVA  I LQIN KLGGELW V +P+K  MV+G+DV HDT  +SRSV   V S N++ T+W+S+   Q  ++EI+   + C+L+ L+ Y+E N+  PE I +YRDGVSDGQL  V+  EI Q  K FE+   +Y+P + + VVQKRI+T LY     + G    P+PGT++DHTVT  +  DF+L++ S+RQG   PTHY+ + + +  TP  +Q
Sbjct:  283 VKEPLQKIGTKGSPIPIGSNYIPICCKNDAVFQYHVTFTPNVESLSMRF----GMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAERKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPNAVVILGKHRLQVWPGYSTSIKHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQ--GSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLIHRPKERS------RPGGKVITGEILLLPELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICL-HSASFVTSPAVDWSRELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETI-PNYEPKLAFIVVQKRISTTLYSYGSDHFG---TPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLTPDHLQ 994          
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:Xenbase;Acc:XB-GENE-982236])

HSP 1 Score: 554.288 bits (1427), Expect = 3.111e-180
Identity = 301/781 (38.54%), Postives = 446/781 (57.11%), Query Frame = 1
Query:  694 EPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNP-EMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPG---VQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            EP   +        L  N +K+      +YQYHV+F P ++ R MR     G+ +    V     AFDG  LY+P  L     +    +   + +     +       S+ C   YNV+ +R+   L +  +GR+++ P    VL + R+++WPGY  +I+  DGGL L  D++HK+IR+DSV DIM  + +   +    Q     QL+G IV+T +NNR YRI DI+W  +    F    G K+S+ DY+   YG+ +++L+QP+++ + + R    + PKG K +D  +V L+PEL  +TG+ + M KDFR M++L +   ++PK+ H +L + +  I S  +AK  L  WG+ ++ D +++   ++ P E I   N  S  AGE   + + +        + +  W +I PK    +A  L   L      +G+    P  VE+ +DR E Y + +K ++  G   VQL+V ++S  R+D Y AIKK C V  PVPSQV+  +T+ +  KL S+A  I LQIN KLGGELW V IP+K  MV+G+DV+HD     RSV   V S N+  T W+S+   Q  ++EIM  L+ C+++ L+ +FE N+ LPE I +YRDGVSDGQL  V+  EI Q    F++F  +Y P MV  VVQKR++T LY +     GQ   P PGT++DHTVT     DFFL+S  VRQG   PTHY+ + + +   P  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L  EPS  LCD+LF+L
Sbjct:  189 EPLPKKGSKGSPCQLGLNLIKINFQNEAVYQYHVTFTPIVECRSMRF----GMMKDHRSVTGPVTAFDGSILYLPVKLAQTVELESERRTDGQKIKITIQMTKILDPSSDLCLPFYNVVMRRVFKILDLKLVGRNFYDPASSTVLQQYRLQVWPGYAANIRKTDGGLFLLVDITHKIIRSDSVLDIMNILYQ--QSPENFQDEVTKQLVGSIVITRYNNRTYRIDDIEWNMSPKDSFSMSDGSKVSFIDYYSKNYGITVKELDQPLLLHRPSER----KAPKG-KALD--IVLLLPELAFMTGIPEKMRKDFRAMKDLTQQIHLSPKQHHISLGKLLKRIESSADAKNELQRWGLFLDTD-IHMTTGRILPIEKINLRNN-SFPAGEDLNWNREVTREACRSSVHLLYWAMIYPKRASAQAQELSSMLERIGGPIGIRVNHPNCVELRDDRVETYARSIK-SLLEGEGKVQLLVCLISGTRDDLYGAIKKLCCVQNPVPSQVINTRTISQPQKLRSIAQKILLQINCKLGGELWGVDIPLKSVMVIGMDVYHDPSRGMRSVLGFVASINSCLTAWYSRVVFQLPNQEIMDSLKLCLVAALQKFFEVNHSLPEKIVVYRDGVSDGQLNTVENYEIPQLQTCFQTFD-NYNPRMVVIVVQKRVSTNLYST---ATGQFLTPQPGTVIDHTVTNRKWIDFFLMSHHVRQGCGIPTHYICVMNTANLGPDHLQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQFLHHEPSIKLCDKLFFL 949          
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Match: piwil3 (piwi-like RNA-mediated gene silencing 3 [Source:Xenbase;Acc:XB-GENE-6469412])

HSP 1 Score: 504.982 bits (1299), Expect = 1.890e-162
Identity = 304/881 (34.51%), Postives = 481/881 (54.60%), Query Frame = 1
Query:  433 SSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYP-------TQIKEPCNTRNDSSPSLT-LSANYVK-VRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYG--LQIRDLEQPMIVSKS-NSRSGKNRGPKGSKEV-DGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVS-----DGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            + GKS +    EE  +  + VGRGR     QK  S +  + V+  L  ++IS            + F+ I       RRR++          I+    ++  SS S+  LS N++K +   Q  ++QYH+ +AP ++SR +R  ++    E    ++ +ARAFDG  L++P+ L     +    +  +   + + +          C   YN++F+R+   + M +IGR+Y+ P  +I +    + I+PG+ TSI  ++  ++L  DVSHKV+R+++V D M  +N+ V +  +        L+GQIVLT +NN+ YRI DI+W     S F K  G +IS+ DY++  +   L IR       ++K  N    K++G KG   + D   V +IP     +GLTD M  DF +M++L  H R+ P++R   + +F+ NI+  +  +K L  WG+  +   +         E I    + +    + A++ + L    +I    ++NW+L+  +     AN L Q L   S ++G+   +  +VE++ D T+ Y+K L++ V P VQ+VV +LS+ R+D+Y+AIKK+  +DCPVPSQ VLA+TL +   + SVA  IALQ+N K+GGELW V+IP+K+ M+VG+D +HDT    RS+GA V S N   TRWFS+  LQ Q +EI+  L+ CM    + +          + +Y+  +       GQ+       +    +   +   DY P +   VV+KR++ R +       G++ NP PGTIVD  +TR   YDFF++SQSVR G+V+PTHY V+ D+    P  +Q + YK CH+YYNWPG +RVPAPC YAHKLA++VGQ++  EP   L DRL+YL
Sbjct:   20 APGKSRERALPEEQAE-PEIVGRGR-----QKRASVAHSTPVTQLLTDLQIS------------AGFQEISLGDRGGRRRDFHDLGINTRQAIEHVKESKTGSSGSIIQLSTNHIKLISRPQWVLFQYHIDYAPQMESRGLRCALLFQHEE----LIGKARAFDGTMLFLPKRLDKVNEVFSQTRNGETVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYYNPNDQIEISSHGLTIYPGFSTSILQYENNIMLSIDVSHKVLRSETVLDYMYNVNQKVESH-KFHDICSKDLIGQIVLTKYNNKTYRIDDINWDFTPESTFKKSDGSEISFVDYYRTEFEHPLPIRSAAMEQFMTKILNEAFKKDKGEKGRPIIRDVLCVKIIP---FHSGLTDRMRSDFNVMKDLAIHTRLAPEQREIQVGKFLKNIHKDDSVQKELQDWGLNFDSKLLPFAGRVAPAEKILQAGKTADYNPQFADWSRELRGPTLIRVKHLDNWVLLYTRRNYDAANTLTQNLFKVSGQMGIKMNRAVMVEVD-DTTDAYVKVLQQKVTPDVQMVVCLLSSNRKDKYDAIKKYLCIDCPVPSQCVLAKTLNKPQTVVSVATKIALQMNCKMGGELWTVEIPLKELMIVGIDCYHDTLSGKRSIGAFVASLNPSMTRWFSRCVLQAQKQEIVDGLKVCMHEGKRCFLNSCQ-----VCLYKSKIQGTVFLQGQVHLAVHFRLSVLIQSRLALQEDYNPKLTVIVVKKRVSARFFA---HVGGRLQNPPPGTIVDVEITRPEWYDFFIISQSVRVGSVSPTHYNVVYDSGALKPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPHLTLSDRLYYL 865          
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Match: piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:Xenbase;Acc:XB-GENE-993661])

HSP 1 Score: 433.335 bits (1113), Expect = 4.502e-136
Identity = 258/758 (34.04%), Postives = 399/758 (52.64%), Query Frame = 1
Query:  766 TQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFD-KGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSA-VREDRYNA----IKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGL-DVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            TQ  +YQY V F+P   SR ++  ++    E+ LG    ARAF G  L++ + +     +    +  +   + + +      +   C    +V F R+  SL M ++GR+Y+ P   +++ + R+ +WPG+V SI   +  L L  DVSHKV+RN++V D M  +   V  K +       +LLG +VLT +NN+ YR+ DIDW+      F  K G +I+Y DY+   Y + I DL+QPM+VS   ++   N  P   + V     +LIPELC LTGL+   + DFRLM++L    ++ P++R + L    D+I    EA   L  WG+ ++K  + +      PE I+  +    + G  A++ +   + KVI    ++NW+++        A  LLQ LM  +  +G     P+IV++  D    +L+ L++NV P +QL V ++S+ VR+   ++    I K CY   P P  V L    K    L  V   +  ++   LG + + + +P K  ++  + ++W  T GR +   +++ S +   T W S+  +Q+   +    L+ CM   ++ +   NN LP  I +YRDGV DGQL  V   EI Q    F      Y P +   VV+K+  +R Y    +    I NP  GTIVD   TR   YDF+L+SQ+ RQGTV PT+Y VL D +   P  +Q + YK CH+YYNWPG +RVPAPC YAHKL ++VGQ++  EPS  L  +LFYL
Sbjct:   60 TQWKLYQYRVDFSPEFASRKLKTALLYSHGET-LG---RARAFHGEILFLSRNIGKLNHLESTTRKGETVKITITLTNQLPADSPVCLEFCHVYFLRVFKSLNMYQVGRNYYNPADPVIIPQHRLMLWPGFVLSIMKLESQLALCADVSHKVLRNETVLDSMKALYSKVP-KERFTDICEKELLGLVVLTRYNNKTYRVDDIDWSTKPTDSFPRKDGSEITYTDYYSQQYSINISDLQQPMLVSALKAKKSDN--PDAPRAV-----HLIPELCYLTGLSSRALSDFRLMKDLSMETQLDPERRQQRLQRLADSIQRTPEASAELEKWGLRMDKQ-IPVTGRIAPPERIFMRDNV-CTPGSPADWARDTRNEKVICVAPLQNWLMLFSYRNADVAENLLQCLMKVASGMGFHMDMPRIVQVE-DNPVSFLRTLQKNVTPDLQLPVCLVSSPVRKFHKSSEARIIAKCCYP--PAPLCVALRSVEKRAIDLLCVGTELHTEVYCSLGSQQFCIAMPHKYRIMENISNLWSRTTGRVQIRASIIASVSPSFTLWHSRCIIQKTTSDFADCLKMCMKGAIQNWQRCNNDLPNRIVVYRDGVGDGQLKMVVDYEIPQLLSSFRETKTSYCPRLSVIVVRKKCISRFYTQTGRG---IQNPVLGTIVDSEATRPEWYDFYLISQNARQGTVNPTYYNVLLDENGLKPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLTFLVGQSIHREPSPELSHKLFYL 797          
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Match: ago3 (argonaute RISC catalytic component 3 [Source:Xenbase;Acc:XB-GENE-6462752])

HSP 1 Score: 165.622 bits (418), Expect = 1.136e-41
Identity = 109/325 (33.54%), Postives = 171/325 (52.62%), Query Frame = 1
Query: 2032 DRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVV-LAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKK-------FMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNL 2973
            D  E   + LK N   G+QL++ IL   +   Y  +K+       + +Q V +   +K  P+  S   N+ L+IN KLGG +  + +P ++        + +G DV H   G  +  S+ AVVGS +A  +R+ +   +Q   +EI++ L S +  LL  +++   F P  I  YRDGVS+GQ   V   E+    +   S   DY+P + Y VVQKR +TRL+ +D   + G+  N   GT VD  +T    +DF+L S +  QGT  P+HY VL D++ +T  ++QL+ Y+ CH Y     +V +PAP  YAH +A+    +L
Sbjct:  498 DSVEPMFRHLK-NTYSGLQLIIVILPG-KTPVYAEVKRVGDTLLGMATQCVQVKNVIKTSPQTLS---NLCLKINVKLGG-INNILVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQEIIHDLASMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQPGITYIVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHL 816          
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Match: ago2 (argonaute RISC catalytic component 2 [Source:Xenbase;Acc:XB-GENE-1001916])

HSP 1 Score: 165.622 bits (418), Expect = 1.160e-41
Identity = 127/437 (29.06%), Postives = 212/437 (48.51%), Query Frame = 1
Query: 1744 WGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALA----------HNKVIGGIRIENWIL--ISPKSLLTKAN--GLLQALMSKSPRVGV-MFGKPKIVE--MNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVV-LAQTLKEGPKLNSVAVNIALQINAKLGGE----LWAVKIPI--KKFMVVGLDVWHDTKGRSR--SVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNL 2973
            +GI ++ D  ++    + P  I +G    V     A   +A+A          + +   GI I+ W +   +P+   T+ +     + L   S   G+ + G+P   +     D  E   + LK N   G+QLVV IL   +   Y  +K+       + +Q V +    +  P+  S   N+ L+IN KLGG     L   + P+  +  + +G DV H   G  +  S+ AVVGS +A   R+ +   +Q+  +EI+  L + +  LL  +++   F P  I  YRDGVS+GQ   V   E+    +       DY+P + + VVQKR +TRL+ +D   + G+  N   GT VD  +T  + +DF+L S +  QGT  P+HY VL D+++++  ++Q++ Y+ CH Y     +V +PAP  YAH +A+    +L
Sbjct:  403 FGIMVKDDMTDVTGRVLQPPSILYGGR--VWEEPNAPLNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKTFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLK-NTYTGLQLVVVILPG-KTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLS---NLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLSAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDRNERVGKSGNIPAGTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHL 832          
BLAST of SMEDWI-3 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 292/766 (38.12%), Postives = 465/766 (60.70%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  +    AFDG  L++P+ L++K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M  +  +T  +K Q Q +   +L+G IVLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V +P+K  M+VG+D +HDT    RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  + +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+N R +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ D+S   P  +Q + YK CH+YYNWPG +RVPAPC YAHKLA++VGQ++  EP+  L +RL+YL
Sbjct:  115 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGRCHAFDGTILFLPKRLQHKVTEVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSDPIDIPNHRLVIWPGFTTSILQYENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVS--KELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQMKKAIMIEVD-DRTEAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYNPRLTVIVVKKRVNARFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDSSGLKPDHIQRLTYKLCHVYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYYL 862          
BLAST of SMEDWI-3 vs. Ensembl Mouse
Match: Piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:MGI Symbol;Acc:MGI:1930036])

HSP 1 Score: 553.132 bits (1424), Expect = 3.010e-179
Identity = 299/766 (39.03%), Postives = 442/766 (57.70%), Query Frame = 1
Query:  733 TLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEF-DKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKR--NVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            +L  N +K++     +YQYHV+F+P ++ + MR     G+ +    V     AFDG  LY+P  L+    +    K  D  +     +       S+ C   YNV+F+R+   L M  +GR+++ P   +VL + R++IWPGY  SI+  DGGL L  DVSHKVIRNDSV D+M  I +   NK   Q      L+G IV+T +NNR YRI D+DW K     F    G++I++ +Y+   YG+ +++ +QP+++ + + R   N G      +  G + L+PEL  +TG+ + M KDFR M++L +   ++PK+ H AL   +  I   E A   L  WG+++ KD   I    +  E I   N + V++ E   + + +  +  I  I +  W L  PK  + +A  L+  L   +  +G+    P  VE+ +DR E Y++ ++    V   +Q+VV I+   R+D Y AIKK C V  PVPSQV+  +T+ +  +L SVA  I LQ+N KLGGELW V IP+K+ MV+G+DV+HD     RSV   V S N   T+W+S+   Q   +EI+  L+ C++  LK Y+E N+ LPE I +YRDGVSDGQL  V   EI Q  K FE+F  +Y P MV  VVQK+I+T LY++ P +      P+PGT+VDHT+T     DF+L++  VRQG   PTHY+ + + +  +P  +Q + +K CH+Y+NWPGT+RVPAPC YAHKLA++ GQ L  EP+  LC  LF+L
Sbjct:  223 SLGLNLIKIQCHNEAVYQYHVTFSPSVECKSMRF----GMLKDHQSVTGNVTAFDGSILYLPVKLQQVVELKSQRKTDDAEISIKIQLTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPGYAASIRRTDGGLFLLADVSHKVIRNDSVLDVMHAIYQ--QNKEHFQDECSKLLVGSIVITRYNNRTYRIDDVDWNKTPKDSFVMSDGKEITFLEYYSKNYGITVKEDDQPLLIHRPSERQ-NNHG-----MLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLTQQINLSPKQHHGALECLLQRISQNETASNELTRWGLSLHKDVHKIEGRLLPMERINLRNTSFVTS-EDLNWVKEVTRDASILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRISPPAWVELKDDRIETYIRTIQSLLGVEGKIQMVVCIIMGTRDDLYGAIKKLCCVQSPVPSQVINVRTIGQPTRLRSVAQKILLQMNCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKYYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFD-NYHPKMVVFVVQKKISTNLYLAAPDH---FVTPSPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYICVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQILHHEPAIQLCGNLFFL 971          
BLAST of SMEDWI-3 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 514.227 bits (1323), Expect = 4.889e-166
Identity = 270/731 (36.94%), Postives = 436/731 (59.64%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTV 2913
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  +    AFDG  L++P+ L++K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M  +  +T  +K Q Q +   +L+G IVLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V +P+K  M+VG+D +HDT    RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  + +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+N R +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ D+S   P  +Q + YK CH+YYNWP +V
Sbjct:  115 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGRCHAFDGTILFLPKRLQHKVTEVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSDPIDIPNHRLVIWPGFTTSILQYENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVS--KELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQMKKAIMIEVD-DRTEAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYNPRLTVIVVKKRVNARFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDSSGLKPDHIQRLTYKLCHVYYNWPVSV 827          
BLAST of SMEDWI-3 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 474.167 bits (1219), Expect = 1.241e-150
Identity = 274/791 (34.64%), Postives = 438/791 (55.37%), Query Frame = 1
Query:  670 REYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQP-HIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDK-GGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVG----VMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKP-NMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            RE  T +K+ C T +   P + L  N   +   Q   +YQYHV+++P + SR +RI ++   S     +  +A+AFDG +L++ + L  K T +       +T+     + +     S  C   +NV+F++I  +L M +IGR+++ P + + + + ++ +WPG+  S+ +F+  LL   DV++KV+RN++V D M ++          +     QL+G +VLT +NN+ YRI DIDW+      F K  G +++Y DY+K  Y + + DL QP++VS    +   N  P+        +V+L+PELC LTGL+     DFRLM+ + E  R++P  R + L   VD+I     A+  L  WG+      +++    +  E I   +     A   A++ + +   KV+    +  W+++       +A  L++A +S   RVG       G PKI++++ +    +L+ ++ +  P VQLV+ IL + +++ Y++IKK+   DCPVPSQ VL +TL +   + SVA  IA+Q+  KLGGELW+V+IP+K  MVVG+D+  D   ++  V   V S N+  TRWFS+  LQ    +I   L+ CM   L  ++  N+ LP  I +YRDGV +GQL  V + E+ Q  K      +D +   +   VV+KR   RL+ S       + NP  GT+VD   TR   YDF+L+SQ+  +GTV+PTHY V+ D++   P  +Q + +K CH+YYNW G + VPAPC YAHKL ++V Q++  EPS  L + LFYL
Sbjct:   83 REKLTHVKD-CKTGSSGIP-VRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSI----LSDKAKAFDGASLFLSEKLDQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFYKPSEPVEIPQYKLSLWPGFAISVSHFESKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCH-KQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRNDNSEPQ--------MVHLMPELCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRNPVARFELETWGLHFGSQ-LSLTGRVVPSEKILLQDHTCQPAFA-ADWSKDMRSCKVLSSQPLNRWLIVC----CNRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVD-ETPAAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTMLSVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTECGSDARSCRLSVVVVRKRCLLRLFASTDHT---VQNPPLGTVVDSEATRPEWYDFYLISQTANRGTVSPTHYNVIYDDNALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHKEPSLELANNLFYL 848          
BLAST of SMEDWI-3 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 397.512 bits (1020), Expect = 2.023e-121
Identity = 257/818 (31.42%), Postives = 412/818 (50.37%), Query Frame = 1
Query:  670 REYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQP-HIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDK-GGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIY-SCEEAKKLLGY-----WG----------------------ITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVG----VMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            RE  T +K+ C T +   P + L  N   +   Q   +YQYHV+++P + SR +RI ++   S     +  +A+AFDG +L++ + L  K T +       +T+     + +     S  C   +NV+F++I  +L M +IGR+++ P + +       EI P Y          LL   DV++KV+RN++V D M ++          +     QL+G +VLT +NN+ YRI DIDW+      F K  G +++Y DY+K  Y + + DL QP++VS    +   N  P+        +V+L+PELC LTGL+     DFRLM+ + E  R++P  R + L   VD+I  +   ++++L +     W                       +T    +  I    + P    F  + + +A    ++ + +   KV+    +  W+++       +A  L++A +S   RVG       G PKI++++ +    +L+ ++ +  P VQLV+ IL + +++ Y++IKK+   DCPVPSQ VL +TL +   + SVA  IA+Q+  KLGGELW+V+IP+K  MVVG+D+  D   ++  V   V S N+  TRWFS+  LQ    +I   L+ CM   L  ++  N+ LP  I +YRDGV +GQL  V + E+ Q  K      +D +                                             YDF+L+SQ+  +GTV+PTHY V+ D++   P  +Q + +K CH+YYNW G + VPAPC YAHKL ++V Q++  EPS  L + LFYL
Sbjct:  146 REKLTHVKD-CKTGSSGIP-VRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSI----LSDKAKAFDGASLFLSEKLDQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFYKPSEPV-------EI-PQY--------NKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCH-KQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRNDNSEPQ--------MVHLMPELCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRTLPSSQEVLSHTSLPLWAPEPGGLSSAIPLSTVLPFAQQLLTALSLSPGIPLPHLKPPSFLFLCQPAFAA----DWSKDMRSCKVLSSQPLNRWLIVC----CNRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVD-ETPAAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTMLSVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTECGSDAR---------------------------------------------YDFYLISQTANRGTVSPTHYNVIYDDNALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHKEPSLELANNLFYL 878          
BLAST of SMEDWI-3 vs. UniProt
Match: sp|A6N7Y9|PIWL1_CHICK (Piwi-like protein 1 OS=Gallus gallus GN=PIWIL1 PE=2 SV=1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 295/771 (38.26%), Postives = 457/771 (59.27%), Query Frame = 1
Query:  718 SSPSLTLSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S   + L AN+ ++ T++P   +YQYHV + P +++R +R     GL      ++ +  AFDG  L++P+ L NK T +       + V     +       S  C   YN++F+R+   +   +IGR+Y+ P+  + +   R+ +WPG+ +SI  ++  ++L  DVSHK++R+++V D M  + + V  + + + A   +L+G IVLT +NNR YR+ DIDW  N    F +  G +ISY DY+K  Y   I DL QP+++S+   + G          V  G V LIPELC LTGLT+ M  DF +M++L  H R++P++R   + + VD +   E  +K L  WG++ +   ++     +  E I           + A++ +      +I    ++NW+LI  +     AN LLQ L   +P +G+   K  ++E++ DRTE YL+ L++++ P   +VV ILS+ R+D+Y+AIKK+   DCP+PSQ V+A+TL +     ++   IALQ+N K+GGELW+V+IP+K+ M+VG+D +HDT    +S+   V S N   TRWFS+  +Q + +EI+  L++C+ + L+ +F+ N +LP  I +YRDGV DGQL  +   E+ QF    ++   DY P +   VV+KR++TR +    +  G + NP PGT+VD  VTR   YDFF+VSQ+VR G V PTHY V+ D SK  P  VQ + YK CH+YYNW G +RVPAPC YAHKLA++VGQ++  EP+ LL DRL+YL
Sbjct:  116 SGAMIKLIANFFRL-TSRPQWALYQYHVDYNPEMEARRLR----SGLLFQHEDLIGKTHAFDGSILFLPKRLPNKVTEVYSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKMMNFQQIGRNYYNPKDPVSIPNHRLMVWPGFTSSILQYEESIMLCADVSHKILRSETVLDFMYSLYEQVEER-RFRDACAKELIGVIVLTKYNNRTYRVDDIDWDANPQCTFRRADGSEISYIDYYKRQYNQDISDLNQPVLISQYRRKRGN---------VTVGPVVLIPELCYLTGLTEKMRNDFNMMKDLAVHTRLSPEQRQREIGKLVDCMKKDECVQKELRDWGLSFDSSLLSFTGRVVQAEKILQAGNVFDYNPQFADWSRETRVAPLIHAKPLDNWLLIYTRRNYDAANMLLQNLFKVTPSMGIRMNKATMIEVD-DRTEAYLRVLQQSITPDTNIVVCILSSTRKDKYDAIKKYLCTDCPIPSQCVVARTLSKPQTALAIVTKIALQMNCKMGGELWSVEIPLKQLMIVGIDCYHDTLSGKQSIAGFVASLNEKMTRWFSRCVVQSRGQEIVDGLKACLQTALREWFKWNKYLPSRIIVYRDGVGDGQLNTLVNYEVPQFLDCLKTVGKDYNPRLTVIVVKKRVSTRFFA---QAGGGLKNPPPGTVVDIEVTRPEWYDFFIVSQAVRNGCVAPTHYNVVYDTSKLKPDHVQRLTYKLCHMYYNWSGVIRVPAPCQYAHKLAFLVGQSIHREPNLLLSDRLYYL 867          
BLAST of SMEDWI-3 vs. UniProt
Match: sp|Q96J94|PIWL1_HUMAN (Piwi-like protein 1 OS=Homo sapiens GN=PIWIL1 PE=1 SV=1)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 295/766 (38.51%), Postives = 465/766 (60.70%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  + +  AFDG  L++P+ L+ K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M    ++T  +K Q Q +   +L+G +VLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V IP+K  M+VG+D +HD     RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  I +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+NTR +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ DNS   P  +Q + YK CHIYYNWPG +RVPAPC YAHKLA++VGQ++  EP+  L +RL+YL
Sbjct:  114 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPIDIPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS--KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYYL 861          
BLAST of SMEDWI-3 vs. UniProt
Match: sp|Q9JMB7|PIWL1_MOUSE (Piwi-like protein 1 OS=Mus musculus GN=Piwil1 PE=1 SV=1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 292/766 (38.12%), Postives = 465/766 (60.70%), Query Frame = 1
Query:  736 LSANYVKVRTTQPH--IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXS-ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEI-NKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKG-GEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS N+ ++ T++P   +YQYH+ + P +++R +R  ++      DL  +    AFDG  L++P+ L++K T +       + V     +       S  C   YN++F+R+   + + +IGR+Y+ P   I +   R+ IWPG+ TSI  ++  ++L  DVSHKV+R+++V D M  +  +T  +K Q Q +   +L+G IVLT +NN+ YR+ DIDW +N  S F K  G ++S+ +Y++  Y  +I DL+QP++VS+   R    RGP G+     G   LIPELC LTGLTD M  DF +M++L  H R+TP++R   +   +D I+  +  ++ L  WG++ + + ++ +   +  E I+ G +      + A++ +      +I    ++NW+LI  +     AN L+Q L   +P +G+   K  ++E++ DRTE YL+ L++ V    Q+VV +LS+ R+D+Y+AIKK+   DCP PSQ V+A+TL +   + ++A  IALQ+N K+GGELW V +P+K  M+VG+D +HDT    RS+   V S N   TRWFS+   Q++ +E++  L+ C+ + L+A+   N ++P  + +YRDGV DGQL  +   E+ QF    +S    Y P +   VV+KR+N R +    ++ G++ NP PGT++D  VTR   YDFF+VSQ+VR G+V+PTHY V+ D+S   P  +Q + YK CH+YYNWPG +RVPAPC YAHKLA++VGQ++  EP+  L +RL+YL
Sbjct:  115 LSTNHFRL-TSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDL--IGRCHAFDGTILFLPKRLQHKVTEVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSDPIDIPNHRLVIWPGFTTSILQYENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVS--KELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR----RGPGGTLP---GPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQMKKAIMIEVD-DRTEAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYNPRLTVIVVKKRVNARFFA---QSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDSSGLKPDHIQRLTYKLCHVYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYYL 862          
BLAST of SMEDWI-3 vs. UniProt
Match: sp|Q7PLK0|AGO3_DROME (Protein argonaute-3 OS=Drosophila melanogaster GN=AGO3 PE=1 SV=3)

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 301/766 (39.30%), Postives = 456/766 (59.53%), Query Frame = 1
Query:  727 SLTLSANYVKVRTTQPH-IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVY-LIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S+ +  NY+K+ T +   ++ Y V F PPIDS  +RIK +    +  LG  K    FDG  LY+P LL NK T+        +  + +       +    C  +YN+LF R+   L  VK  R  F P +  ++   ++E+WPGYVT++  + GGL+L CDVSH+++   +V ++++++ +   N    Q +A   L+G IVLT +NNR Y+I DI + +N   +F+      SY +Y+K  + + I+D+ QP+I S       K+RG    +E    L + LIPELC LTGL D++  D +LMRE+    RV+P +R  AL +F +N+ +   A+++L  WG+++  ++  I+  +M+ E IYF ++ SVSAG  AEF +    N+++  + +  WI+I  ++    A  LL  +      +G+    P ++ +++DR + Y++ L+RN+    Q+VV I    R+DRY AIKK C  + P+PSQV+ A+TL+   K+ SV   I LQ+N KLGG LW VKIP K  M+ G+D +HD   R  SV A V S N+  ++W+SK+ +Q + +EI+  L +     LK Y + N  LP  I +YRDG+ DGQL      EI QF  V  +     +  + Y VVQKRINTR++     +   + NP PGT+VD  +T++N+YDFFLVSQ VRQGTVTPTHYVVL D+  Y P  +Q ++YK C +YYNW GTVR+PA CMYAHKLAY++GQ+++ + +  L ++LFYL
Sbjct:  127 SVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND-HKDKLGGTK---TFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEM--RNCTQLYNILFDRVMKVLNYVKFDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQ--QNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIK-----KSRGIPAERE---NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF-SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGN-----RIKISYIVVQKRINTRIF---SGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-3 vs. UniProt
Match: sp|Q8UVX0|PIWL1_DANRE (Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 SV=1)

HSP 1 Score: 554.288 bits (1427), Expect = 3.583e-180
Identity = 295/770 (38.31%), Postives = 452/770 (58.70%), Query Frame = 1
Query:  718 SSPSLTLSANYVKVRTTQP--HIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSE-CPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            S  ++ L AN++++  ++P   +YQYHV + PP++SR +R  ++    E+    + +A  FDG  L++P  L+N ET++       + V     +       S  C   YN+LF+RI   L M +IGR Y+ P+    + + R+ IWPG++T+I  ++  ++L  DVSHKV+R+++V D M  + +   ++ +   A   +L+G I+LT +NN+ YRI DI W     + F KG  +IS+++YFK+ YGL I D  Q ++VS              S     G   L+PE C LTGLTD M  DF +M++L  H R++P++R   +   + NI    + +  L  WG++ E   +++N   +  E I  G  A       A++ + +    +I  + ++NW++   +     A  LLQ L   S  +G+   +  ++E   DR E  L+ L++NVA   Q+VV IL   R+D+Y+ +KK+  VDCP PSQ V+++T+ +   L +VA  IALQ+N K+GGELW+V+IP+++ M+VG+D +HDT    RS+GA+V S N   +RWFSK  LQ + +EI+  L+  +   LKAY + NN LP  I +YRDGV DG L  V   E+ Q  +  ++   DY+P +   VV+KRI++R +    +  G+I NP PGT++D  VTR   YDFF+VSQ+VR G V PTHY V+ DNS   P  +Q + YK CH+YYNW G VRVPAPC YAHKLA++VGQ++  EP+  L D L+YL
Sbjct:  106 SGTAIELRANFMRL-LSRPMWALYQYHVDYKPPMESRRLRSALLFQHEET----LGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDDPFNIPQHRLTIWPGFMTTILQYESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQ-RFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGP-------SGRPPPGPAMLVPEFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYE-DRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYEPKLSVVVVKKRISSRFFA---RIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPNMNLDDFLYYL 858          
BLAST of SMEDWI-3 vs. TrEMBL
Match: tr|B2Z3D6|B2Z3D6_SCHMD (Piwi protein WI-3 OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 1890.93 bits (4897), Expect = 0.000e+0
Identity = 958/960 (99.79%), Postives = 959/960 (99.90%), Query Frame = 1
Query:  139 LLMQKFLNKDVLVPSVESLEDKALNKLGIPLPGSTVEKNTEXXXXXXXXXXXXXXXXXXXNIKLQDSDIENRNITIVTRPLSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LLMQKFLNKDVLVPSVESLEDKALNKLGIP PGSTVEKNTESSSISSGDSRSNPSGDSRNNIKLQDSDIENRNITIVTRPLSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYF+NTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL
Sbjct:   15 LLMQKFLNKDVLVPSVESLEDKALNKLGIPPPGSTVEKNTESSSISSGDSRSNPSGDSRNNIKLQDSDIENRNITIVTRPLSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFRNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 974          
BLAST of SMEDWI-3 vs. TrEMBL
Match: tr|D2Z0E0|D2Z0E0_DUGJA (DjPiwiC OS=Dugesia japonica GN=DjpiwiC PE=2 SV=1)

HSP 1 Score: 1734.15 bits (4490), Expect = 0.000e+0
Identity = 871/962 (90.54%), Postives = 904/962 (93.97%), Query Frame = 1
Query:  139 LLMQKFLNKDVLVPSVESLEDKALNKLGIPLPGSTVEKNTEXXXXXXXXXXXXXXXXXXXNIKLQDSDIENRNITIVTRPLSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSS-EAKSQFENIEKPI-SKFRRREYPTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LLMQKFLNKDV VPSVESLEDKALNKLGIP PGST EK TESSSISSGDS S         +KLQDSDIEN+NITIV RPLSCIGRGRGLSNPSSL TSSG+SDKI E +E  Q+KK +GRGRGLL+SQKECSNSTPSE+SNELK +K+SNDDKMTVSS E KSQFEN EKP  SKFRRRE+PTQIKE CNTRND SPS+ LSANYVKV TTQPHIYQYHVSFAP IDSRLMRIKIVQGLSE  LGVVKEARAFDGMNLYIPQ LKNKET+IKVNKPTD T VDVK+VFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINK+VNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDW KNCLSEFDK GEKISYRDYFKNTYGLQIRDLEQP+IVSKSNSR  K R  KGSK+ DGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIY+CEEA KLLGYWGITIEKDTVNI ACKMNPEMIYFGNEASVSAGE AEFKQALAHN+VI GIRIENW+L++PKSL+TKANGLLQALMSKSP++GV F KP+I+EMNNDRTEEY+KELKRNV   VQLVVTILSAVREDRYNAIKK CYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHD KGR RSVGAVVGSTNALCTRWFSKSHLQE DKEI+YVLQSCMLSLLKAYFEENNFLP+TIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQ+NNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNS+YTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPS+LLCDRLFYL
Sbjct:   15 LLMQKFLNKDVPVPSVESLEDKALNKLGIPPPGSTTEKTTESSSISSGDSSS--------KLKLQDSDIENKNITIVKRPLSCIGRGRGLSNPSSLATSSGQSDKIAEIDETNQVKKVIGRGRGLLSSQKECSNSTPSEISNELKDLKLSNDDKMTVSSVEDKSQFENSEKPTTSKFRRREHPTQIKEACNTRNDQSPSIILSANYVKVYTTQPHIYQYHVSFAPTIDSRLMRIKIVQGLSEDQLGVVKEARAFDGMNLYIPQQLKNKETVIKVNKPTDNTSVDVKIVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKSVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWTKNCLSEFDKSGEKISYRDYFKNTYGLQIRDLEQPLIVSKSNSRGPKGR--KGSKDADGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYNCEEANKLLGYWGITIEKDTVNIKACKMNPEMIYFGNEASVSAGENAEFKQALAHNRVISGIRIENWVLVAPKSLMTKANGLLQALMSKSPKIGVNFSKPRIIEMNNDRTEEYIKELKRNVTSSVQLVVTILSAVREDRYNAIKKHCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDAKGRGRSVGAVVGSTNALCTRWFSKSHLQEHDKEIVYVLQSCMLSLLKAYFEENNFLPDTIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQVNNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSRYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSHLLCDRLFYL 966          
BLAST of SMEDWI-3 vs. TrEMBL
Match: tr|G9B7B8|G9B7B8_9PLAT (Piwi C (Fragment) OS=Phagocata kawakatsui GN=piwiC PE=2 SV=1)

HSP 1 Score: 887.486 bits (2292), Expect = 0.000e+0
Identity = 414/534 (77.53%), Postives = 470/534 (88.01%), Query Frame = 1
Query: 1438 FKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGG-LVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHD------TKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            FKNTY L +RDLEQP++VSK+ +R    +GPK + E +    VYLIPELCMLTGLTDDM+KDFRLMRELHEHCRVTPKKRHE LL+FV+NI +CEEA +LLGYWGITI+  TVNI+ACK+ PEMI FG +A+VSAG+QA+FKQA+ HN+VIGG+RIENW++I+PKSL++KA+  LQALMSK PR+G+MF  PK+VEM  DRTE+Y++ELKRNV  GVQLVVT+LSAVREDRYNAIKK CYVD PVPSQVVL  TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFM VGLDVWHD      +KG  +SVGAVVGSTNALCTRW SK   Q   +EI+ VLQSCM+ +LKAY+EENNFLPETIFMYRDGVSDGQLG VQ+TEIEQF K FE+FS DYKP+++YN+VQKRINTRL+V+DP++K QI NP PGT+VDHTVTR+NLYDFFLVSQSVRQGTVTPTHYVVL DNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLK EPSNL+ DRLFYL
Sbjct:    1 FKNTYNLTVRDLEQPLLVSKTKARK---QGPKPTNEKESSEFVYLIPELCMLTGLTDDMVKDFRLMRELHEHCRVTPKKRHEGLLQFVENIRNCEEATRLLGYWGITIDNGTVNIDACKLTPEMIQFGGDATVSAGDQADFKQAIGHNRVIGGMRIENWVMITPKSLVSKAHAFLQALMSKGPRIGIMFKNPKLVEMQTDRTEDYIRELKRNVTSGVQLVVTLLSAVREDRYNAIKKLCYVDSPVPSQVVLGNTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMAVGLDVWHDAAMRGRSKGAGKSVGAVVGSTNALCTRWHSKCAFQRPHQEIVDVLQSCMIGILKAYYEENNFLPETIFMYRDGVSDGQLGLVQRTEIEQFLKAFETFSPDYKPSLIYNIVQKRINTRLFVTDPRSKDQILNPGPGTVVDHTVTRSNLYDFFLVSQSVRQGTVTPTHYVVLYDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKVEPSNLMSDRLFYL 531          
BLAST of SMEDWI-3 vs. TrEMBL
Match: tr|B0FLQ9|B0FLQ9_STRPU (Seali OS=Strongylocentrotus purpuratus PE=2 SV=1)

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 322/760 (42.37%), Postives = 488/760 (64.21%), Query Frame = 1
Query:  739 SANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            ++NY++++     ++QY VSF PPI+S+ +R+++V     SD  V+ + RAFDG  L++P  L  K T+ +  +  D+  + +K++    +N  EC  +YN++F+++   L+M ++GR ++ P    ++ + ++EIWPGY+T+I  ++GGL+L  DVSHKV+ N+SV + M  I + + N  + +   + Q++G +VLT +NN+ YR+ DIDW  N  + F    E+IS+ DY+K +Y L+I D  QP+++S+   +   N G    +E+      LIPEL   TGLTDDM  DFR+M++L  H RVTP++RH+++L+F+ N+Y+ E+A + L  WG+ ++ D + +   ++  E I  G  +S  A ++A++ +      VI  + + NW+++  +    KA   +Q +    P++G+    P +VE+ +DRT+ Y   +K+++ P +QLV+ I    R+DRY+A KK C ++ PVPSQV+  +T+ +  KL SV   IALQIN KLGGELWA+ +P+ K MV+G+DV+HD     +S+GA V S N   T WFS+  +Q   +E++  L+ C  S LK Y + N+ LPE I ++RDGV DGQL  V   E EQ  + F  F ADYKP +   VVQKRINTR++       G   NP PG ++DHT+TR   YDFFLVSQ VRQGTVTPTHYVV+ D+++  P  +Q +AYK  H+YYNWPGTVRVPAPC YAHKLAY+VGQNL  EPS  LCD+LF+L
Sbjct:  213 ASNYIRIKCVNKAVWQYAVSFDPPIESKKIRLRMV--FDHSD--VIGKVRAFDGAVLFLPHKLPQKVTLFESVRLFDQETITIKIILGKEINPQECTQIYNIIFRKVMKILQMKQVGRHFYNPTTPSIVPQHKLEIWPGYITAISQYEGGLMLHADVSHKVLCNESVLESMQAIYQRIPNNIRFREECVRQIVGTVVLTRYNNKTYRVDDIDWDSNPQTTFKSRDEEISFIDYYKKSYSLEISDPGQPLLISRIKKKQLNNPGTPVEEEIR-----LIPELSSRTGLTDDMRADFRIMKDLAMHTRVTPQQRHQSMLKFIKNVYANEQAAEELSGWGLELQHDLLQLTGRQLPLENIKLG-RSSFKASKEADWGRECTRQHVITAVPLRNWVVVFTRRDAPKAAEFIQMMKQVCPQMGIEIEHPSMVELQDDRTQSYTNMVKKSINPQLQLVIAIFPTSRDDRYSAFKKLCCIEAPVPSQVINGRTISQKQKLRSVTQKIALQINCKLGGELWALDVPLSKLMVIGIDVYHDPNRGKKSIGAFVASMNRDLTSWFSRVCIQTPHQELIGGLKLCFTSSLKKYHDINHALPEKIVIFRDGVGDGQLNVVATYEQEQLSQCFSMFGADYKPQLCIVVVQKRINTRIFSV---AGGNYENPYPGMVIDHTITRPTWYDFFLVSQHVRQGTVTPTHYVVVHDSTQLKPDHMQRLAYKLTHLYYNWPGTVRVPAPCQYAHKLAYLVGQNLHKEPSLELCDKLFFL 959          
BLAST of SMEDWI-3 vs. TrEMBL
Match: tr|A0A0L8HBN2|A0A0L8HBN2_OCTBM (Uncharacterized protein OS=Octopus bimaculoides GN=OCBIM_22018299mg PE=3 SV=1)

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 346/890 (38.88%), Postives = 538/890 (60.45%), Query Frame = 1
Query:  379 LSCIGRGRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNSTPSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKEPCNTRNDSSPS--------LTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIXXXXXXXXXXXXXXXXXXXXXXXSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGG--EKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCDRLFYL 3018
            LS  GRG  L+          +SD  +   EP  +   V  GRGL   Q          ++N  K+  I      ++SS A +  +N  + +S    R+    +++  + ++D S S        + LSANY++++T    ++QYHVSF P IDS+ +R K++   ++    V  + RAFDG  LY+P  L N+ET++   + +D   + + +     +    C  +YN++F+R+ + L+M ++GR Y+ P     + + ++EIWPGY+T+I+  +GGLLL  D SHKV+R ++V D+++ + +   +  + +  A+  ++G +VLT +NN+ YR+ DI W  +  ++F   G  E IS+ +Y++  Y  +I D  QP+++ K   ++ ++    G   V   L+ LIPE C +TGLTDDM  DFR+M+++  H RVTP +R   L  FV++I S E+A + L  WG+  E  ++ I      PE I    E    A E+A++ + L+   VI  + ++NW++I+ K  + K+   +  +M  +  +G+   +PK++E  + RTE  ++ L+  +   +QLVV I    R+D+Y+A+KK C V+CPVPSQV++A+T+ +  KL SV   IALQIN KLGG+LWA+ IP+   MV+G+DV+HD+    RS+GA V STN   TRWFS+   Q+ ++E++  L++C++  LK Y E N+ LP+ I ++RDGVSD QL  V   E+EQ  K F+ F   Y P +   +VQKR+NTR++++    + Q++NP PGTIVDH++TR N YDFFLVSQ VRQGTVTPTHY+V+ D S      VQ + YK  H+YYNWPGT+RVPAPC YAHKLAY+VGQN+  EPS+ L DRL++L
Sbjct:   29 LSRFGRGLALTRAMEACALKEQSDSESPFPEP-LLPATVPIGRGLAAMQ---------ALTNAAKKQPIERPLGSSLSSNAPAVGKNSSQELS----RQSSVSVEDLYSPQHDLSESHRGTKGKKIPLSANYIRIKTRNEGVFQYHVSFNPEIDSKSVRYKMLYEHTD----VTGKTRAFDGAILYLPIKLPNQETVLASTRLSDGEKITITIKMVKVLKSESCIPLYNIMFRRVMSILQMKQVGRYYYNPNTPTSVPQHKLEIWPGYITAIKEHEGGLLLMADASHKVLRKETVLDVLVSLVR--QDAARFRDNAMRTIVGSVVLTRYNNKTYRVDDIAWDMSPNNKFVSSGSKESISFIEYYRKQYNREISDTNQPLLIHKPKKKALQH----GDGPVKSELICLIPEFCYMTGLTDDMRSDFRVMKDIAAHTRVTPMQRQLTLNRFVESIKSNEDAMQQLTNWGLYFEDASIQIEGRYFQPERIIM-RERDFVASEEADWGRDLSRASVITPVPLQNWVVITCKQDIGKSKDYISMMMKVTGPMGIDVSQPKLIETRDQRTETLIRLLRETIHKNLQLVVIIFPTSRDDKYSAVKKLCCVECPVPSQVIIARTISQQQKLRSVTQKIALQINCKLGGDLWALSIPLSGIMVIGIDVYHDSSKGHRSIGAFVASTNNNLTRWFSRVCFQQPNQELIDGLKTCLIGALKKYHEMNHILPKRIVVFRDGVSDSQLSVVSGYEVEQLSKCFQHFGDTYSPLLSVIIVQKRVNTRIFIN---RRNQVDNPAPGTIVDHSITRKNWYDFFLVSQHVRQGTVTPTHYIVVHDTSAMKVDHVQRLTYKMTHLYYNWPGTIRVPAPCQYAHKLAYLVGQNIHKEPSHSLADRLYFL 890          
The following BLAST results are available for this feature:
BLAST of SMEDWI-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
PIWIL10.000e+038.51piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL10.000e+038.51piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL23.437e-18039.30piwi like RNA-mediated gene silencing 2 [Source:HG... [more]
PIWIL23.437e-18039.30piwi like RNA-mediated gene silencing 2 [Source:HG... [more]
PIWIL11.169e-16637.36piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
prg-11.178e-13432.53Piwi-like protein [Source:RefSeq peptide;Acc:NP_4... [more]
prg-23.878e-12031.23Piwi-like protein [Source:RefSeq peptide;Acc:NP_5... [more]
alg-21.506e-4224.23pep:known chromosome:WBcel235:II:874160:878954:1 g... [more]
alg-22.018e-4224.23pep:known chromosome:WBcel235:II:873176:878954:1 g... [more]
alg-19.762e-4224.58pep:known chromosome:WBcel235:X:13951262:13956256:... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
AGO30.000e+039.30Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250... [more]
AGO30.000e+039.30Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250... [more]
AGO30.000e+039.30Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250... [more]
AGO31.979e-17038.87Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250... [more]
aub5.072e-13332.31aubergine [Source:FlyBase gene name;Acc:FBgn000014... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
piwil10.000e+038.31piwi-like RNA-mediated gene silencing 1 [Source:ZF... [more]
piwil10.000e+038.31piwi-like RNA-mediated gene silencing 1 [Source:ZF... [more]
piwil26.636e-18037.13piwi-like RNA-mediated gene silencing 2 [Source:ZF... [more]
piwil26.636e-18037.13piwi-like RNA-mediated gene silencing 2 [Source:ZF... [more]
piwil22.016e-15035.67piwi-like RNA-mediated gene silencing 2 [Source:ZF... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
piwil23.111e-18038.54piwi-like RNA-mediated gene silencing 2 [Source:Xe... [more]
piwil31.890e-16234.51piwi-like RNA-mediated gene silencing 3 [Source:Xe... [more]
piwil44.502e-13634.04piwi-like RNA-mediated gene silencing 4 [Source:Xe... [more]
ago31.136e-4133.54argonaute RISC catalytic component 3 [Source:Xenba... [more]
ago21.160e-4129.06argonaute RISC catalytic component 2 [Source:Xenba... [more]
back to top
BLAST of SMEDWI-3 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Piwil10.000e+038.12piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil23.010e-17939.03piwi-like RNA-mediated gene silencing 2 [Source:MG... [more]
Piwil14.889e-16636.94piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil41.241e-15034.64piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
Piwil42.023e-12131.42piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
back to top
BLAST of SMEDWI-3 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6N7Y9|PIWL1_CHICK0.000e+038.26Piwi-like protein 1 OS=Gallus gallus GN=PIWIL1 PE=... [more]
sp|Q96J94|PIWL1_HUMAN0.000e+038.51Piwi-like protein 1 OS=Homo sapiens GN=PIWIL1 PE=1... [more]
sp|Q9JMB7|PIWL1_MOUSE0.000e+038.12Piwi-like protein 1 OS=Mus musculus GN=Piwil1 PE=1... [more]
sp|Q7PLK0|AGO3_DROME0.000e+039.30Protein argonaute-3 OS=Drosophila melanogaster GN=... [more]
sp|Q8UVX0|PIWL1_DANRE3.583e-18038.31Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 ... [more]
back to top
BLAST of SMEDWI-3 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|B2Z3D6|B2Z3D6_SCHMD0.000e+099.79Piwi protein WI-3 OS=Schmidtea mediterranea PE=2 S... [more]
tr|D2Z0E0|D2Z0E0_DUGJA0.000e+090.54DjPiwiC OS=Dugesia japonica GN=DjpiwiC PE=2 SV=1[more]
tr|G9B7B8|G9B7B8_9PLAT0.000e+077.53Piwi C (Fragment) OS=Phagocata kawakatsui GN=piwiC... [more]
tr|B0FLQ9|B0FLQ9_STRPU0.000e+042.37Seali OS=Strongylocentrotus purpuratus PE=2 SV=1[more]
tr|A0A0L8HBN2|A0A0L8HBN2_OCTBM0.000e+038.88Uncharacterized protein OS=Octopus bimaculoides GN... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 37..59
NoneNo IPR availableTMHMMTMhelixcoord: 15..36
NoneNo IPR availableTMHMMTMhelixcoord: 13..30
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 577..748
e-value: 6.4E-38
score: 129.9
NoneNo IPR availableGENE3DG3DSA:2.170.260.10coord: 398..516
e-value: 1.3E-11
score: 44.2
NoneNo IPR availableTMHMMTMhelixcoord: 2..19
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
NoneNo IPR availableTMHMMTMhelixcoord: 2..19
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..18
score: 0.628
NoneNo IPR availableTMHMMTMhelixcoord: 5..24
NoneNo IPR availableTMHMMTMhelixcoord: 37..59
IPR003165Piwi domainSMARTSM00950Piwi_a_2coord: 683..978
e-value: 8.0E-102
score: 354.3
IPR003165Piwi domainPFAMPF02171Piwicoord: 684..978
e-value: 2.8E-85
score: 286.0
IPR003165Piwi domainPROSITEPS50822PIWIcoord: 683..978
score: 44.288
IPR003100PAZ domainSMARTSM00949PAZ_2_a_3coord: 397..542
e-value: 2.3E-47
score: 173.3
IPR003100PAZ domainPFAMPF02170PAZcoord: 401..538
e-value: 2.9E-27
score: 95.0
IPR003100PAZ domainPROSITEPS50821PAZcoord: 424..518
score: 19.979
IPR003100PAZ domainSUPERFAMILYSSF101690PAZ domaincoord: 231..559
IPR012337Ribonuclease H-like domainGENE3DG3DSA:3.30.420.10coord: 750..992
e-value: 2.6E-48
score: 163.6
IPR012337Ribonuclease H-like domainSUPERFAMILYSSF53098Ribonuclease H-likecoord: 536..992
IPR014811Argonaute, linker 1 domainPFAMPF08699ArgoL1coord: 348..394
e-value: 8.0E-5
score: 22.0

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003165Piwi
IPR003100PAZ_dom
IPR012337RNaseH-like_dom
IPR014811ArgoL1
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005515protein binding
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000002Stage 2
PLANA:0000007Stage 7
PLANA:0000004Stage 4
PLANA:0000008Stage 8
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0004517blastomere
PLANA:0000429neoblast compartment
PLANA:0000212blastomere compartment
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001362 ID=SMED30001362|Name=SMEDWI-3|organism=Schmidtea mediterranea sexual|type=transcript|length=3093bp
AATTAAGAGACAGCCATTTATGTTTATTTTTAAAATAAATAGTATATATT
TAAGTTTCGAATTTTCAGCTACAATTTAATAGTACATAATTATACGATGT
CAGGAAGTAGTGGAATAGGTAGAGGCCGCAGTCGTGGGCTGTTGATGCAA
AAGTTTCTGAATAAAGATGTTCTTGTTCCTTCTGTTGAATCTTTAGAAGA
CAAAGCTCTTAATAAGCTAGGAATTCCACTTCCTGGGTCTACCGTAGAAA
AAAATACAGAGTCAAGTTCTATATCAAGTGGAGATTCAAGAAGTAATCCC
AGTGGAGATTCAAGAAATAACATAAAACTACAAGATAGTGATATTGAGAA
TCGCAATATTACCATTGTTACGCGACCATTATCCTGCATAGGCAGGGGTC
GGGGTTTAAGCAATCCCTCAAGTTTAACTACGTCATCGGGTAAATCGGAT
AAAATTACTGAAAACGAAGAACCTGGTCAAATTAAAAAGTTTGTAGGTCG
CGGTAGAGGATTGTTGAATTCTCAGAAAGAATGTTCAAACTCTACTCCAT
CTGAAGTTTCAAATGAATTGAAACAAATGAAAATTTCAAATGATGATAAA
ATGACGGTTTCTTCAGAAGCAAAGTCACAATTTGAGAACATTGAAAAACC
TATTAGTAAATTTCGTCGACGCGAATATCCAACTCAAATAAAAGAACCAT
GTAATACAAGAAATGATTCATCGCCATCTTTAACTTTAAGTGCTAATTAC
GTTAAAGTTAGGACTACACAACCCCATATATATCAATACCATGTTTCCTT
TGCACCTCCGATAGATTCAAGGTTGATGAGAATTAAAATAGTTCAAGGGT
TATCAGAATCAGATTTAGGGGTTGTCAAAGAAGCAAGAGCTTTTGACGGT
ATGAATTTATACATTCCTCAACTTTTAAAAAATAAAGAGACAATAATTAA
AGTAAACAAACCGACTGATAAGACTGTCGTGGATGTTAAAGTAGTTTTTA
CTAACAATGTTAATTTTAGTGAATGTCCTATGGTTTATAATGTTCTTTTT
AAAAGAATTGAAAATTCCCTCAGAATGGTTAAAATTGGTAGGGATTATTT
CTACCCTGAAAAAAAGATAGTACTTGACCGTAGAAGGATGGAAATATGGC
CGGGATATGTAACAAGTATCCAAAATTTTGACGGTGGTTTACTGTTACAA
TGCGATGTGTCACACAAAGTTATTCGAAATGATAGTGTGTATGACATAAT
GATGGAAATTAATAAAACTGTTAACAATAAAGGTCAAATGCAAACTGCTG
CGATTAATCAACTATTGGGTCAAATTGTGTTAACTCCTCACAATAACCGA
AATTATAGAATTACTGATATAGATTGGGCTAAAAATTGTTTAAGTGAATT
CGATAAAGGAGGCGAAAAAATTAGCTACCGGGATTATTTTAAGAACACGT
ATGGGCTACAAATTCGTGATCTAGAGCAGCCTATGATAGTTAGTAAATCT
AATAGCAGATCTGGTAAAAACCGAGGTCCCAAAGGATCAAAAGAAGTGGA
TGGTGGATTGGTCTATTTAATTCCAGAATTGTGTATGCTAACTGGTTTGA
CAGATGACATGATTAAAGATTTTCGTTTGATGAGAGAATTACACGAGCAT
TGTCGAGTTACTCCCAAGAAAAGACACGAAGCCTTACTGGAATTCGTGGA
TAACATATATAGCTGTGAGGAAGCTAAGAAACTTTTAGGGTATTGGGGTA
TAACGATTGAAAAGGACACTGTCAACATAAATGCTTGTAAAATGAATCCA
GAAATGATATATTTTGGAAATGAAGCTTCTGTTAGTGCTGGGGAACAAGC
TGAATTTAAACAAGCCTTGGCACATAATAAAGTTATAGGTGGTATTCGTA
TTGAAAATTGGATATTAATTTCTCCAAAAAGTTTACTGACAAAAGCAAAT
GGTCTGTTACAGGCTTTAATGAGCAAATCTCCTAGAGTTGGAGTTATGTT
TGGAAAACCCAAAATAGTTGAAATGAACAATGATCGAACAGAAGAGTATT
TAAAAGAATTAAAGAGAAATGTGGCTCCTGGTGTGCAGTTAGTAGTTACA
ATTTTATCTGCTGTTAGAGAAGATCGATACAATGCAATAAAAAAATTTTG
TTATGTGGATTGTCCTGTTCCAAGTCAAGTGGTATTAGCCCAAACATTGA
AAGAAGGGCCTAAATTAAATAGTGTGGCAGTTAATATAGCCCTTCAAATA
AACGCAAAATTAGGTGGAGAGCTGTGGGCTGTCAAAATACCTATTAAGAA
GTTTATGGTTGTTGGACTTGATGTTTGGCATGATACTAAAGGGAGAAGTA
GATCAGTTGGAGCCGTAGTTGGTTCAACTAATGCGCTATGCACAAGGTGG
TTTTCGAAATCGCATTTGCAAGAACAAGATAAAGAAATTATGTACGTATT
ACAGTCGTGTATGTTAAGCCTTTTAAAGGCTTATTTTGAAGAAAATAATT
TTTTGCCTGAGACTATCTTTATGTATAGGGATGGTGTTAGTGATGGTCAG
TTAGGATATGTTCAAAAAACTGAAATTGAACAATTCTTTAAAGTTTTTGA
ATCGTTTAGTGCTGATTATAAACCTAATATGGTATATAATGTTGTTCAAA
AGAGAATAAATACTAGGCTCTATGTAAGTGATCCGAAAAATAAAGGACAA
ATAAATAACCCCAATCCTGGTACAATTGTCGACCATACTGTTACGAGGGC
TAACCTTTATGATTTTTTTCTTGTTTCTCAATCGGTTAGGCAGGGAACTG
TAACTCCGACGCATTACGTTGTTTTATGTGACAATTCTAAATACACTCCG
CATCAGGTTCAGTTGATGGCTTATAAAACATGTCATATATATTACAATTG
GCCGGGAACGGTTCGAGTACCAGCACCTTGTATGTATGCTCATAAATTGG
CATATATGGTTGGTCAGAATTTGAAAGCTGAACCTAGTAATCTTTTATGT
GACAGACTTTTTTATTTGTAACATATGTGTTTCTATTTGTATTATTGTTA
AACTGCATTTCGTAAAATAAATTAATTTCGTTATAAAAAAAAA
back to top

protein sequence of SMED30001362-orf-1

>SMED30001362-orf-1 ID=SMED30001362-orf-1|Name=SMED30001362-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=975bp
MSGSSGIGRGRSRGLLMQKFLNKDVLVPSVESLEDKALNKLGIPLPGSTV
EKNTESSSISSGDSRSNPSGDSRNNIKLQDSDIENRNITIVTRPLSCIGR
GRGLSNPSSLTTSSGKSDKITENEEPGQIKKFVGRGRGLLNSQKECSNST
PSEVSNELKQMKISNDDKMTVSSEAKSQFENIEKPISKFRRREYPTQIKE
PCNTRNDSSPSLTLSANYVKVRTTQPHIYQYHVSFAPPIDSRLMRIKIVQ
GLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVV
FTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEI
WPGYVTSIQNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQT
AAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKN
TYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTG
LTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYW
GITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGI
RIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEE
YLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQT
LKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGR
SRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEEN
NFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVV
QKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQG
TVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHK
LAYMVGQNLKAEPSNLLCDRLFYL*
back to top
Aliases
The feature 'SMEDWI-3' has the following synonyms
Synonym
piwi-3
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30001362
GenBankACC97187.1