BAT2_N domain-containing protein

Overview
NameBAT2_N domain-containing protein
Smed IDSMED30001361
Length (bp)7009
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BAT2_N domain-containing protein (SMED30001361) t-SNE clustered cells

Violin plots show distribution of expression levels for BAT2_N domain-containing protein (SMED30001361) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BAT2_N domain-containing protein (SMED30001361) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BAT2_N domain-containing protein (SMED30001361) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001361

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30001361SMESG000038978.1 dd_Smed_v4_4611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001361SMESG000038978.1 dd_Smed_v4_4611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001361SMESG000038978.1 dd_Smed_v4_4611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30001361SMESG000038978.1 dd_Smed_v4_4611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001361SMESG000038978.1 dd_Smed_v4_4611_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BAT2_N domain-containing protein vs. Ensembl Human
Match: PRRC2A (proline rich coiled-coil 2A [Source:HGNC Symbol;Acc:HGNC:13918])

HSP 1 Score: 57.7658 bits (138), Expect = 3.518e-7
Identity = 34/98 (34.69%), Postives = 57/98 (58.16%), Query Frame = 3
Query:   96 NKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSNSVKSQGITSKIV 386
             KK++ LN+ + +KGKS+E Q        G+Q+LGKV+  RR+PPP  +PSLKAE   +D    ++ +  +GW +     D   S++  +Q + S+ +
Sbjct:   14 GKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQPLESQPL 111          
BLAST of BAT2_N domain-containing protein vs. Ensembl Human
Match: PRRC2A (proline rich coiled-coil 2A [Source:HGNC Symbol;Acc:HGNC:13918])

HSP 1 Score: 57.7658 bits (138), Expect = 3.518e-7
Identity = 34/98 (34.69%), Postives = 57/98 (58.16%), Query Frame = 3
Query:   96 NKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSNSVKSQGITSKIV 386
             KK++ LN+ + +KGKS+E Q        G+Q+LGKV+  RR+PPP  +PSLKAE   +D    ++ +  +GW +     D   S++  +Q + S+ +
Sbjct:   14 GKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQPLESQPL 111          
BLAST of BAT2_N domain-containing protein vs. Ensembl Human
Match: PRRC2B (proline rich coiled-coil 2B [Source:HGNC Symbol;Acc:HGNC:28121])

HSP 1 Score: 55.8398 bits (133), Expect = 4.687e-7
Identity = 35/101 (34.65%), Postives = 56/101 (55.45%), Query Frame = 3
Query:   66 LKPVMNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSNSVKSQ 365
            L  +    D   K++ L++ + +KGKSV+          G+Q+LGKV++ RR+PPP  +PSLK+E   +D    I+ +  +GW N    QD   S++  SQ
Sbjct:    5 LGQITKGKDGKSKYSTLSLFDKYKGKSVDAIRSSVIPRHGLQSLGKVAAARRMPPPANLPSLKSENKGNDPNIVIVPKDGTGWANKQDQQDPKSSSATASQ 105          
BLAST of BAT2_N domain-containing protein vs. Ensembl Human
Match: PRRC2C (proline rich coiled-coil 2C [Source:HGNC Symbol;Acc:HGNC:24903])

HSP 1 Score: 57.3806 bits (137), Expect = 4.978e-7
Identity = 31/74 (41.89%), Postives = 45/74 (60.81%), Query Frame = 3
Query:   99 KKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVN 317
            KK+  L++ N +KGKS+E Q        G+Q+LGKV   RR+PPP  +PSLKAE   +D    I+ +  +GW +
Sbjct:   15 KKYATLSLFNTYKGKSLETQKTTVAARHGLQSLGKVGISRRMPPPANLPSLKAENKGNDPNVNIVPKDGTGWAS 88          
BLAST of BAT2_N domain-containing protein vs. Ensembl Human
Match: PRRC2B (proline rich coiled-coil 2B [Source:HGNC Symbol;Acc:HGNC:28121])

HSP 1 Score: 56.6102 bits (135), Expect = 7.586e-7
Identity = 35/101 (34.65%), Postives = 56/101 (55.45%), Query Frame = 3
Query:   66 LKPVMNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSNSVKSQ 365
            L  +    D   K++ L++ + +KGKSV+          G+Q+LGKV++ RR+PPP  +PSLK+E   +D    I+ +  +GW N    QD   S++  SQ
Sbjct:    5 LGQITKGKDGKSKYSTLSLFDKYKGKSVDAIRSSVIPRHGLQSLGKVAAARRMPPPANLPSLKSENKGNDPNIVIVPKDGTGWANKQDQQDPKSSSATASQ 105          
BLAST of BAT2_N domain-containing protein vs. Ensembl Zebrafish
Match: prrc2a (proline-rich coiled-coil 2A [Source:ZFIN;Acc:ZDB-GENE-010501-4])

HSP 1 Score: 57.7658 bits (138), Expect = 1.954e-9
Identity = 28/57 (49.12%), Postives = 38/57 (66.67%), Query Frame = 3
Query:   90 DKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAE 260
            D   K+  LN+ + +KGKS+E Q        G+Q+LGKV+S RR+PPP  +PSLKAE
Sbjct:   13 DGKTKYASLNLFDTYKGKSLEAQKPVVAPRHGLQSLGKVASTRRMPPPANLPSLKAE 69          
BLAST of BAT2_N domain-containing protein vs. Ensembl Zebrafish
Match: PRRC2B (proline-rich coiled-coil 2B [Source:NCBI gene;Acc:561451])

HSP 1 Score: 60.4622 bits (145), Expect = 3.600e-8
Identity = 36/97 (37.11%), Postives = 55/97 (56.70%), Query Frame = 3
Query:   66 LKPVMNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGRQII-NQSSSGWVNPVTSQDNIDSNS 353
            L  +    D   K++ L++ + +KGKS+E Q        G+Q+LGKV++ RR+PPP  +PSLK+E+  +D   II  +  +GW N    QD  D  S
Sbjct:    5 LGQITKSKDGKSKYSSLSLFDKYKGKSIETQKTTVVARHGLQSLGKVAAARRMPPPAHLPSLKSESKGNDPNVIIVPKDGTGWAN---KQDQPDPKS 98          
BLAST of BAT2_N domain-containing protein vs. Ensembl Zebrafish
Match: prrc2c (proline-rich coiled-coil 2C [Source:ZFIN;Acc:ZDB-GENE-081104-156])

HSP 1 Score: 58.5362 bits (140), Expect = 1.218e-7
Identity = 32/77 (41.56%), Postives = 46/77 (59.74%), Query Frame = 3
Query:   90 DKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVN 317
            D   K+  L++ N +KGKS+E Q        G+Q+LGKV+  RR+PPP  +PSLKAE   +D    I+ +  SGW +
Sbjct:   13 DGKTKYATLSLFNTYKGKSLETQKTAVAARHGLQSLGKVAVSRRMPPPANLPSLKAENKGNDPNVSIVPKDGSGWAS 89          
BLAST of BAT2_N domain-containing protein vs. Ensembl Zebrafish
Match: prrc2c (proline-rich coiled-coil 2C [Source:ZFIN;Acc:ZDB-GENE-081104-156])

HSP 1 Score: 58.5362 bits (140), Expect = 1.218e-7
Identity = 32/77 (41.56%), Postives = 46/77 (59.74%), Query Frame = 3
Query:   90 DKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVN 317
            D   K+  L++ N +KGKS+E Q        G+Q+LGKV+  RR+PPP  +PSLKAE   +D    I+ +  SGW +
Sbjct:   13 DGKTKYATLSLFNTYKGKSLETQKTAVAARHGLQSLGKVAVSRRMPPPANLPSLKAENKGNDPNVSIVPKDGSGWAS 89          
BLAST of BAT2_N domain-containing protein vs. Ensembl Zebrafish
Match: prrc2a (proline-rich coiled-coil 2A [Source:ZFIN;Acc:ZDB-GENE-010501-4])

HSP 1 Score: 58.5362 bits (140), Expect = 1.328e-7
Identity = 31/76 (40.79%), Postives = 46/76 (60.53%), Query Frame = 3
Query:   90 DKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWV 314
            D   K+  LN+ + +KGKS+E Q        G+Q+LGKV+S RR+PPP  +PSLKAE   +D    ++ +  +GW 
Sbjct:   13 DGKTKYASLNLFDTYKGKSLEAQKPVVAPRHGLQSLGKVASTRRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWA 88          
BLAST of BAT2_N domain-containing protein vs. Ensembl Xenopus
Match: prrc2c (proline rich coiled-coil 2C [Source:HGNC Symbol;Acc:HGNC:24903])

HSP 1 Score: 57.3806 bits (137), Expect = 1.624e-7
Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 3
Query:   96 NKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVN 317
             KK+   ++ N +KGKS+E Q        G+Q+LGKV+  RR+PPP  +PSLKAE   +D    I+ +  +GW +
Sbjct:   14 GKKYATFSLYNTYKGKSLETQKTTVAARHGLQSLGKVAVSRRMPPPANLPSLKAENKGNDPNVNIVPKDGTGWAS 88          
BLAST of BAT2_N domain-containing protein vs. Ensembl Xenopus
Match: zswim6 (zinc finger SWIM-type containing 6 [Source:Xenbase;Acc:XB-GENE-984745])

HSP 1 Score: 58.151 bits (139), Expect = 2.774e-7
Identity = 34/96 (35.42%), Postives = 53/96 (55.21%), Query Frame = 3
Query:   66 LKPVMNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSN 350
            L  +    D   K++ LN+ + +KGKS+E          G+Q+LGKV++ RR+PPP  +PSLK+E   +D    I+ +  +GW N    QD   S+
Sbjct:    5 LGQITKGKDGKSKYSSLNLFDKYKGKSIEAVRTTVIPRHGLQSLGKVAAARRMPPPANLPSLKSENKGNDPNIFIVPKDGTGWANKQEQQDQKSSS 100          
BLAST of BAT2_N domain-containing protein vs. Ensembl Xenopus
Match: zswim6 (zinc finger SWIM-type containing 6 [Source:Xenbase;Acc:XB-GENE-984745])

HSP 1 Score: 58.151 bits (139), Expect = 2.814e-7
Identity = 34/96 (35.42%), Postives = 53/96 (55.21%), Query Frame = 3
Query:   66 LKPVMNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSN 350
            L  +    D   K++ LN+ + +KGKS+E          G+Q+LGKV++ RR+PPP  +PSLK+E   +D    I+ +  +GW N    QD   S+
Sbjct:    5 LGQITKGKDGKSKYSSLNLFDKYKGKSIEAVRTTVIPRHGLQSLGKVAAARRMPPPANLPSLKSENKGNDPNIFIVPKDGTGWANKQEQQDQKSSS 100          
BLAST of BAT2_N domain-containing protein vs. Ensembl Xenopus
Match: zswim6 (zinc finger SWIM-type containing 6 [Source:Xenbase;Acc:XB-GENE-984745])

HSP 1 Score: 57.7658 bits (138), Expect = 2.847e-7
Identity = 34/96 (35.42%), Postives = 53/96 (55.21%), Query Frame = 3
Query:   66 LKPVMNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSN 350
            L  +    D   K++ LN+ + +KGKS+E          G+Q+LGKV++ RR+PPP  +PSLK+E   +D    I+ +  +GW N    QD   S+
Sbjct:    5 LGQITKGKDGKSKYSSLNLFDKYKGKSIEAVRTTVIPRHGLQSLGKVAAARRMPPPANLPSLKSENKGNDPNIFIVPKDGTGWANKQEQQDQKSSS 100          
BLAST of BAT2_N domain-containing protein vs. Ensembl Xenopus
Match: zswim6 (zinc finger SWIM-type containing 6 [Source:Xenbase;Acc:XB-GENE-984745])

HSP 1 Score: 57.7658 bits (138), Expect = 2.990e-7
Identity = 34/96 (35.42%), Postives = 53/96 (55.21%), Query Frame = 3
Query:   66 LKPVMNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSN 350
            L  +    D   K++ LN+ + +KGKS+E          G+Q+LGKV++ RR+PPP  +PSLK+E   +D    I+ +  +GW N    QD   S+
Sbjct:    5 LGQITKGKDGKSKYSSLNLFDKYKGKSIEAVRTTVIPRHGLQSLGKVAAARRMPPPANLPSLKSENKGNDPNIFIVPKDGTGWANKQEQQDQKSSS 100          
BLAST of BAT2_N domain-containing protein vs. Ensembl Mouse
Match: Prrc2c (proline-rich coiled-coil 2C [Source:MGI Symbol;Acc:MGI:1913754])

HSP 1 Score: 56.9954 bits (136), Expect = 1.244e-8
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 3
Query:   96 NKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWV 314
             KK+  L++ N +KGKS+E Q        G+Q+LGKV   RR+PPP  +PSLKAE   +D    I+ +  +GW 
Sbjct:   14 GKKYATLSLFNTYKGKSLETQKTTVAARHGLQSLGKVGISRRMPPPANLPSLKAENKGNDPNVNIVPKDGTGWA 87          
BLAST of BAT2_N domain-containing protein vs. Ensembl Mouse
Match: Prrc2c (proline-rich coiled-coil 2C [Source:MGI Symbol;Acc:MGI:1913754])

HSP 1 Score: 56.9954 bits (136), Expect = 4.309e-7
Identity = 31/74 (41.89%), Postives = 45/74 (60.81%), Query Frame = 3
Query:   99 KKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVN 317
            KK+  L++ N +KGKS+E Q        G+Q+LGKV   RR+PPP  +PSLKAE   +D    I+ +  +GW +
Sbjct:   15 KKYATLSLFNTYKGKSLETQKTTVAARHGLQSLGKVGISRRMPPPANLPSLKAENKGNDPNVNIVPKDGTGWAS 88          
BLAST of BAT2_N domain-containing protein vs. Ensembl Mouse
Match: Prrc2c (proline-rich coiled-coil 2C [Source:MGI Symbol;Acc:MGI:1913754])

HSP 1 Score: 56.9954 bits (136), Expect = 4.550e-7
Identity = 31/74 (41.89%), Postives = 45/74 (60.81%), Query Frame = 3
Query:   99 KKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVN 317
            KK+  L++ N +KGKS+E Q        G+Q+LGKV   RR+PPP  +PSLKAE   +D    I+ +  +GW +
Sbjct:   15 KKYATLSLFNTYKGKSLETQKTTVAARHGLQSLGKVGISRRMPPPANLPSLKAENKGNDPNVNIVPKDGTGWAS 88          
BLAST of BAT2_N domain-containing protein vs. Ensembl Mouse
Match: Prrc2c (proline-rich coiled-coil 2C [Source:MGI Symbol;Acc:MGI:1913754])

HSP 1 Score: 55.4546 bits (132), Expect = 9.156e-7
Identity = 31/74 (41.89%), Postives = 46/74 (62.16%), Query Frame = 3
Query:   99 KKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVN 317
            KK+  L++ N +KGKS+E Q   +    G+Q+LGKV   RR+PPP  +PSLKAE   +D    I+ +  +GW +
Sbjct:   15 KKYATLSLFNTYKGKSLETQK--TTARHGLQSLGKVGISRRMPPPANLPSLKAENKGNDPNVNIVPKDGTGWAS 86          
BLAST of BAT2_N domain-containing protein vs. Ensembl Mouse
Match: Prrc2a (proline-rich coiled-coil 2A [Source:MGI Symbol;Acc:MGI:1915467])

HSP 1 Score: 55.8398 bits (133), Expect = 9.265e-7
Identity = 33/91 (36.26%), Postives = 53/91 (58.24%), Query Frame = 3
Query:   96 NKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSNSVKSQ 365
             KK++ LN+ + +KGKS+E Q        G+Q+LGKV+  RR+PPP  +PSLKAE   +D    ++ +  +GW +     D   S++  +Q
Sbjct:   14 GKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQ 104          
BLAST of BAT2_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3TLH4|PRC2C_MOUSE (Protein PRRC2C OS=Mus musculus OX=10090 GN=Prrc2c PE=1 SV=3)

HSP 1 Score: 56.9954 bits (136), Expect = 3.183e-6
Identity = 31/74 (41.89%), Postives = 45/74 (60.81%), Query Frame = 3
Query:   99 KKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVN 317
            KK+  L++ N +KGKS+E Q        G+Q+LGKV   RR+PPP  +PSLKAE   +D    I+ +  +GW +
Sbjct:   15 KKYATLSLFNTYKGKSLETQKTTVAARHGLQSLGKVGISRRMPPPANLPSLKAENKGNDPNVNIVPKDGTGWAS 88          
BLAST of BAT2_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5JSZ5|PRC2B_HUMAN (Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 3.643e-6
Identity = 35/101 (34.65%), Postives = 56/101 (55.45%), Query Frame = 3
Query:   66 LKPVMNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSNSVKSQ 365
            L  +    D   K++ L++ + +KGKSV+          G+Q+LGKV++ RR+PPP  +PSLK+E   +D    I+ +  +GW N    QD   S++  SQ
Sbjct:    5 LGQITKGKDGKSKYSTLSLFDKYKGKSVDAIRSSVIPRHGLQSLGKVAAARRMPPPANLPSLKSENKGNDPNIVIVPKDGTGWANKQDQQDPKSSSATASQ 105          
BLAST of BAT2_N domain-containing protein vs. UniProt/SwissProt
Match: sp|P48634|PRC2A_HUMAN (Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3)

HSP 1 Score: 56.225 bits (134), Expect = 5.618e-6
Identity = 33/91 (36.26%), Postives = 53/91 (58.24%), Query Frame = 3
Query:   96 NKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSNSVKSQ 365
             KK++ LN+ + +KGKS+E Q        G+Q+LGKV+  RR+PPP  +PSLKAE   +D    ++ +  +GW +     D   S++  +Q
Sbjct:   14 GKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQ 104          
BLAST of BAT2_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6MG48|PRC2A_RAT (Protein PRRC2A OS=Rattus norvegicus OX=10116 GN=Prrc2a PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 5.762e-6
Identity = 33/91 (36.26%), Postives = 53/91 (58.24%), Query Frame = 3
Query:   96 NKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSNSVKSQ 365
             KK++ LN+ + +KGKS+E Q        G+Q+LGKV+  RR+PPP  +PSLKAE   +D    ++ +  +GW +     D   S++  +Q
Sbjct:   14 GKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQ 104          
BLAST of BAT2_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5TM26|PRC2A_MACMU (Protein PRRC2A OS=Macaca mulatta OX=9544 GN=PRRC2A PE=3 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 5.860e-6
Identity = 33/91 (36.26%), Postives = 53/91 (58.24%), Query Frame = 3
Query:   96 NKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQDNIDSNSVKSQ 365
             KK++ LN+ + +KGKS+E Q        G+Q+LGKV+  RR+PPP  +PSLKAE   +D    ++ +  +GW +     D   S++  +Q
Sbjct:   14 GKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQ 104          
BLAST of BAT2_N domain-containing protein vs. TrEMBL
Match: A0A094ZC80 (Protein PRRC2C (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_10340 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.660e-11
Identity = 92/321 (28.66%), Postives = 135/321 (42.06%), Query Frame = 3
Query:   84 RNDKNK-KFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTS---QDNIDSNSVKSQGITSKIVSDKSQWNSKLTTN--KPFFLIGQEFPSLQSDSGPENSQDVSKEKSKDTEIKSKIDELRNRDANISVSTLNRIDALSISKSSKGDIAA-----------------------------------------TGWAA-EDEEPNFDEKIVFSDEDSSNEVHNWHSDNEEGTKSERIEKRESIDVPPIISDVWHDQNTMRYSQYQQMPIPVNVQGQFINP 899
            +++K K KF   NIN+V+KG + EPQ KP+ +  GMQ +GK+   RR+PPP WVPS+KAETG  D R  ++     GW  P TS   Q  + S +  S  I S + S      S+   N  +P +    +F    SD G      VS  K     +   +   + +DA     +   ++  S    S G +AA                                         +GW A   +EP+FDE+I+FSD D   EV +  S     T +   E+     +PP         NT++ S +  MP+       F+NP
Sbjct:    6 KSEKTKVKFAQSNINHVYKGNTTEPQHKPTVRQYGMQVVGKLQGTRRLPPPAWVPSIKAETGGLDSRVSLVPAGGGGWGAPSTSSADQPPVSSTATDSLPIVSTLPSVNGALYSETVGNSLEPAY---TKFVYGNSDMG---VTGVSTLKDTSVGVNGSVKTDKTQDAVKDKVSSQPLNPPSDKPGSSGGLAANKPFFQRPTPIVTTSSTTTTTSKSEIPAKVDGGAREIVGEPSGWVAIGQDEPDFDERIIFSD-DEEYEVKSIQST----TTTNISEQPAQFSIPP--------PNTVKTSLH-AMPM-----KPFVNP 301          
BLAST of BAT2_N domain-containing protein vs. TrEMBL
Match: A0A4S2LFT0 (BAT2_N domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007591 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 8.235e-11
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  102 KFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQ 332
            KF   NIN+V++G + E Q KP+ +  GMQ +GK+   RR+PPP WVPS+KAE+G  D R  ++    SGW  P TS+
Sbjct:   14 KFAQSNINHVYRGNTAETQYKPTVRQYGMQVVGKLQGTRRLPPPAWVPSIKAESGGLDSRVALVPPGGSGWGAPATSE 91          
BLAST of BAT2_N domain-containing protein vs. TrEMBL
Match: A0A4S2LF60 (BAT2_N domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007591 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 8.696e-11
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  102 KFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQ 332
            KF   NIN+V++G + E Q KP+ +  GMQ +GK+   RR+PPP WVPS+KAE+G  D R  ++    SGW  P TS+
Sbjct:   14 KFAQSNINHVYRGNTAETQYKPTVRQYGMQVVGKLQGTRRLPPPAWVPSIKAESGGLDSRVALVPPGGSGWGAPATSE 91          
BLAST of BAT2_N domain-containing protein vs. TrEMBL
Match: A0A4V3SDV8 (BAT2_N domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007591 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.389e-11
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  102 KFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQ 332
            KF   NIN+V++G + E Q KP+ +  GMQ +GK+   RR+PPP WVPS+KAE+G  D R  ++    SGW  P TS+
Sbjct:   14 KFAQSNINHVYRGNTAETQYKPTVRQYGMQVVGKLQGTRRLPPPAWVPSIKAESGGLDSRVALVPPGGSGWGAPATSE 91          
BLAST of BAT2_N domain-containing protein vs. TrEMBL
Match: A0A4S2LFF0 (BAT2_N domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007591 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.392e-11
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  102 KFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQ 332
            KF   NIN+V++G + E Q KP+ +  GMQ +GK+   RR+PPP WVPS+KAE+G  D R  ++    SGW  P TS+
Sbjct:   14 KFAQSNINHVYRGNTAETQYKPTVRQYGMQVVGKLQGTRRLPPPAWVPSIKAESGGLDSRVALVPPGGSGWGAPATSE 91          
BLAST of BAT2_N domain-containing protein vs. Ensembl Cavefish
Match: PRRC2B (proline rich coiled-coil 2B [Source:HGNC Symbol;Acc:HGNC:28121])

HSP 1 Score: 58.151 bits (139), Expect = 4.860e-8
Identity = 31/82 (37.80%), Postives = 49/82 (59.76%), Query Frame = 3
Query:   75 VMNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGRQII-NQSSSGWVN 317
            +    D   K++ L++ + +KGKS+E Q        G+Q+LGKV++ RR+PPP  +PSLK+E   +D   II  +  +GW N
Sbjct:    8 ITKSKDGKSKYSSLSLFDKYKGKSIETQKNTVVPRHGLQSLGKVATARRMPPPAHLPSLKSENKGNDPNVIIVPKDGTGWAN 89          
BLAST of BAT2_N domain-containing protein vs. Ensembl Cavefish
Match: PRRC2B (proline rich coiled-coil 2B [Source:HGNC Symbol;Acc:HGNC:28121])

HSP 1 Score: 58.5362 bits (140), Expect = 1.062e-7
Identity = 32/85 (37.65%), Postives = 50/85 (58.82%), Query Frame = 3
Query:   66 LKPVMNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGRQII-NQSSSGWVN 317
            L  +    D   K++ L++ + +KGKS+E Q        G+Q+LGKV++ RR+PPP  +PSLK+E   +D   II  +  +GW N
Sbjct:    5 LGQITKSKDGKSKYSSLSLFDKYKGKSIETQKNTVVPRHGLQSLGKVATARRMPPPAHLPSLKSENKGNDPNVIIVPKDGTGWAN 89          
BLAST of BAT2_N domain-containing protein vs. Ensembl Cavefish
Match: prrc2a (proline-rich coiled-coil 2A [Source:ZFIN;Acc:ZDB-GENE-010501-4])

HSP 1 Score: 58.5362 bits (140), Expect = 1.138e-7
Identity = 33/83 (39.76%), Postives = 49/83 (59.04%), Query Frame = 3
Query:   90 DKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVNPVTSQD 335
            D   K+  LN+ + +KGKS+E Q        G+Q+LGKV+S RR+PPP  +PSLKAE   +D    ++ +  +GW +   S D
Sbjct:   13 DGKTKYASLNLFDTYKGKSLEAQKPVVAPRHGLQSLGKVASARRMPPPANLPSLKAENKGNDPNVTLVPKDGTGWASKQESAD 95          
BLAST of BAT2_N domain-containing protein vs. Ensembl Cavefish
Match: prrc2c (proline-rich coiled-coil 2C [Source:ZFIN;Acc:ZDB-GENE-081104-156])

HSP 1 Score: 58.151 bits (139), Expect = 1.540e-7
Identity = 32/77 (41.56%), Postives = 46/77 (59.74%), Query Frame = 3
Query:   90 DKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWVN 317
            D   K+  L++ N +KGKS+E Q        G+Q+LGKV+  RR+PPP  +PSLKAE   +D    I+ +  SGW +
Sbjct:   13 DGKTKYATLSLFNTYKGKSLETQKTAVAARHGLQSLGKVAVSRRMPPPANLPSLKAENKGNDPNVSIVPKDGSGWAS 89          
BLAST of BAT2_N domain-containing protein vs. Ensembl Nematostella
Match: EDO44246 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWE2])

HSP 1 Score: 55.8398 bits (133), Expect = 2.298e-9
Identity = 28/76 (36.84%), Postives = 43/76 (56.58%), Query Frame = 3
Query:   87 NDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGW 311
            N    K++ LN+N  +KG  VE ++       G+Q+LGK+ S RR+PPP  +PSLK+E   +D    ++     GW
Sbjct:   12 NAGKTKYSTLNLNQTYKGTKVETKTNTGAARHGLQSLGKIGSSRRIPPPANLPSLKSENSGNDPTVSLVPSGGGGW 87          
BLAST of BAT2_N domain-containing protein vs. Ensembl Medaka
Match: prrc2c (proline rich coiled-coil 2C [Source:NCBI gene;Acc:101170751])

HSP 1 Score: 61.2326 bits (147), Expect = 1.798e-8
Identity = 48/146 (32.88%), Postives = 71/146 (48.63%), Query Frame = 3
Query:   90 DKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGW------------------VNPVTSQDNIDSNSVKSQGITSKIVSDKSQWNSKLTTNKPFFLIGQEFPSLQS 470
            D   K+  L++ N +KGKS+E Q        G+Q+LGKV++ RR+PPP  +PSLKAE   +D    I+ +  SGW                  + PV SQ+    +S       S   + ++Q +  L  +  F    QEFPSLQ+
Sbjct:   13 DGKTKYATLSLFNTYKGKSLETQKTAVAARHGLQSLGKVAASRRMPPPANLPSLKAENKGNDPNVNIVPKDGSGWASRAEGGEERQQETPPPQIKPVVSQEPPAGSS------RSWANNKQTQPDGSLRVSSHFH---QEFPSLQA 149          
BLAST of BAT2_N domain-containing protein vs. Ensembl Medaka
Match: prrc2c (proline rich coiled-coil 2C [Source:NCBI gene;Acc:101170751])

HSP 1 Score: 60.8474 bits (146), Expect = 2.374e-8
Identity = 48/146 (32.88%), Postives = 71/146 (48.63%), Query Frame = 3
Query:   90 DKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGW------------------VNPVTSQDNIDSNSVKSQGITSKIVSDKSQWNSKLTTNKPFFLIGQEFPSLQS 470
            D   K+  L++ N +KGKS+E Q        G+Q+LGKV++ RR+PPP  +PSLKAE   +D    I+ +  SGW                  + PV SQ+    +S       S   + ++Q +  L  +  F    QEFPSLQ+
Sbjct:   13 DGKTKYATLSLFNTYKGKSLETQKTAVAARHGLQSLGKVAASRRMPPPANLPSLKAENKGNDPNVNIVPKDGSGWASRAEGGEERQQETPPPQIKPVVSQEPPAGSS------RSWANNKQTQPDGSLRVSSHFH---QEFPSLQA 149          
BLAST of BAT2_N domain-containing protein vs. Ensembl Medaka
Match: PRRC2B (proline rich coiled-coil 2B [Source:NCBI gene;Acc:101162855])

HSP 1 Score: 59.3066 bits (142), Expect = 5.908e-8
Identity = 31/85 (36.47%), Postives = 51/85 (60.00%), Query Frame = 3
Query:   66 LKPVMNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGRQII-NQSSSGWVN 317
            L  +    D   K++ +++ + ++GKS+E Q   +    G+Q+LGKV++ RR+PPP  +PSLK+E   +D   II  +  SGW N
Sbjct:    5 LGQITKSKDGKSKYSSISLFDKYRGKSIETQKNTAVTRHGLQSLGKVAAARRMPPPAHLPSLKSENKGNDPNVIIVPKDGSGWAN 89          
BLAST of BAT2_N domain-containing protein vs. Ensembl Medaka
Match: prrc2a (proline rich coiled-coil 2A [Source:NCBI gene;Acc:101168471])

HSP 1 Score: 55.4546 bits (132), Expect = 8.461e-7
Identity = 29/72 (40.28%), Postives = 45/72 (62.50%), Query Frame = 3
Query:  102 KFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWV 314
            K+  LN+ + +KGKS+E Q        G+Q+LGKV++ RR+PPP  +PSLKAE   +D    ++ +  +GW 
Sbjct:   17 KYASLNLFDTYKGKSLETQKPVVTPRHGLQSLGKVAAARRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWA 88          
BLAST of BAT2_N domain-containing protein vs. Ensembl Medaka
Match: prrc2a (proline rich coiled-coil 2A [Source:NCBI gene;Acc:101168471])

HSP 1 Score: 55.4546 bits (132), Expect = 8.833e-7
Identity = 29/72 (40.28%), Postives = 45/72 (62.50%), Query Frame = 3
Query:  102 KFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGR-QIINQSSSGWV 314
            K+  LN+ + +KGKS+E Q        G+Q+LGKV++ RR+PPP  +PSLKAE   +D    ++ +  +GW 
Sbjct:   17 KYASLNLFDTYKGKSLETQKPVVTPRHGLQSLGKVAAARRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWA 88          
BLAST of BAT2_N domain-containing protein vs. Planmine SMEST
Match: SMESG000038978.1 (SMESG000038978.1)

HSP 1 Score: 3706.76 bits (9611), Expect = 0.000e+0
Identity = 2217/2217 (100.00%), Postives = 2217/2217 (100.00%), Query Frame = 3
Query:   78 MNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGRQIINQSSSGWVNPVTSQDNIDSNSVKSQGITSKIVSDKSQWNSKLTTNKPFFLIGQEFPSLQSDSGPENSQDVSKEKSKDTEIKSKIDELRNRDANISVSTLNRIDALSISKSSKGDIAATGWAAEDEEPNFDEKIVFSDEDSSNEVHNWHSDNEEGTKSERIEKRESIDVPPIISDVWHDQNTMRYSQYQQMPIPVNVQGQFINPQFPTNIISRNPPCTLGNIGDEQSAFMNSVAEQRNARNMEYYYAIERARQKKLATQSSRGSCGINEDHNQIDPSLMRSRHTSMTSDTNESMNTPIEXXXXXXXXXXXXXXXXXXXXXISPMXXXXXXXXXXXXXXXXXMYRITSHPFNIMPMSTVPMEQVDTKLMEKFVEFLKLQSTSEGNPESPMNSSVAGEQAQNIRFHESDMKTISDSNTQQQQDIERPQSHVSSLGSHVQVDKDNVNIDKFTGPSIKDNSESFEKDFQRKQKFNYSQEEDNQKYDQSKKGLKNKNFKEYRPNKTGYKGDYSSNVGGSGNIVERDYYPENNDVTAYEDYNTYKQHYSRDYKVSRGYNRNPSFXXXXXXXXXXXXXXXNNDYHYXXXXXXXXXXXXXXXXXXXXXXNTDHIQSDRETSSSKKYDNQEAWPHENDMIDGSDKRNKDQKKNPKTAKSIPYQPKKIDNRHYKEKPSESTQEYSMGFAVNPKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNKRNPKTSNIGDQWRQIKDEKSNNPRNTETTNSNPSQSKNVNRNNRKSDKRQFSNNSTLVIKYRSSGQFTYASKDNENDQEEWETASEGGSVRSNSAPREMHKLHNRQNNSQLNSTENKVISNSNSENRKVVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNKSVDSSQNKNIDKTSNENRXXXXXXXXXXXXXXXXXXXLFNCIEXXXXXXXXXXXXNAHISSQINLDKYGDFIDDEDMLFENAQFQEVLSKATXXXXXXXXXXXXXXXXXXXQKRLEALKNKNKSDNNQIRKPSSRREQPPRTNKSETNAGHKFENKAAVNIRDKETSNNALKKWEINKVAMQIGSWDNSLADEISSERKAPPKPIGTPASIPAWNKKAKVPFETNPSNVCQNSLSGEPIKMPTDIETISQTFSSENSEVXXXXXXXXXXXXXXXXQPVRXXXXXXXXXXXXXQSAEITIHENINFEYDVKNINCDKTHRNLLSTDRXXXXXXXXXXXXXINSVKTIWDNLPVSNITPESKATIASPINPDVDIHTGPVSINQDVTNTRNIDNNLSSSPVPIPNVCKVKPQLQQDFKKDHNEIILSSQAIQIRNSPAAFLSQNQGGFLPYHRFTEFLPESLHHQEAYTSMISNNQQGMHINYNLPNTHLIDSSLLRQNTQEQILSNKMNFINQSQSSFYPQQTTTPKLMSNTPGQLPINMDIGSAHAPAHHMQQLLLTRQNSLTSSMMQPNPMTIPFIQSGQQPIQAQTPLFPTTPILGATNFSSQINPFSQGHLQPHYPHGNFPSLHHTPQFQPNXXXXXXXXXXXXXXXXXXXXXXSHDRVISSGQSGVFNSVIGPSDISANTGLPDFNGQPKPLNHNNIMHGMSGSAFVLPHNLNILMKPSMFATNSQYNTFTTPIQSNLLNLKNGYDHNTNIKSLDLDHYRHDNPMNDRNIYCGDNAQLQKSNDEYYQDVPEFDNCDINYENWMPNLRYSKVDIYTANNLMPTFDFHSQKSPMQFSPMEPGGDAATYRNFITPFRDNHTSLAAAGLPTNANLQYIISPRLKSQYNQDQSAMIGRQHSKCYENQNYISSNNFNSKNESIDNKILIKCTPSCGGGSNSINEIKDNSKDISNTEKSITESKKNSKQRTSYSDNFDDKNQSWSLIEDDRSVPPEDXXXXXXXXXXXXXXXXXXKHFSNSSRPNNFDNQCQYGYDETQLSSQTAESLRKFDQDQLKKVIMKLREGPVMTDTNCNEFDFAPYKGATIPRLMPLQXXXXXXXKPNKYNNSFSSDIYTNSDSNNVGLGFYSRNRALTPPAAQFRTYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVSSRQKCDTNNAXXXXXXXXXXXLKLNSVQSKSLECDNLVHENIIDNSIL 6728
            MNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGRQIINQSSSGWVNPVTSQDNIDSNSVKSQGITSKIVSDKSQWNSKLTTNKPFFLIGQEFPSLQSDSGPENSQDVSKEKSKDTEIKSKIDELRNRDANISVSTLNRIDALSISKSSKGDIAATGWAAEDEEPNFDEKIVFSDEDSSNEVHNWHSDNEEGTKSERIEKRESIDVPPIISDVWHDQNTMRYSQYQQMPIPVNVQGQFINPQFPTNIISRNPPCTLGNIGDEQSAFMNSVAEQRNARNMEYYYAIERARQKKLATQSSRGSCGINEDHNQIDPSLMRSRHTSMTSDTNESMNTPIEMGPPGGPPMMHHLHKPHLQPQISPMIHPHNISVISPSIPPSSMYRITSHPFNIMPMSTVPMEQVDTKLMEKFVEFLKLQSTSEGNPESPMNSSVAGEQAQNIRFHESDMKTISDSNTQQQQDIERPQSHVSSLGSHVQVDKDNVNIDKFTGPSIKDNSESFEKDFQRKQKFNYSQEEDNQKYDQSKKGLKNKNFKEYRPNKTGYKGDYSSNVGGSGNIVERDYYPENNDVTAYEDYNTYKQHYSRDYKVSRGYNRNPSFNYYSDQYSSQSRDNYNNDYHYKSNSLKTKSSTSKSKDSKPSGSNTDHIQSDRETSSSKKYDNQEAWPHENDMIDGSDKRNKDQKKNPKTAKSIPYQPKKIDNRHYKEKPSESTQEYSMGFAVNPKDNRKNYYSSNYTRRYYTTDYNYYNSSSKYNEYDNDNSYYQDNYYPQEYYGYDKDYSSSKYPNKRNPKTSNIGDQWRQIKDEKSNNPRNTETTNSNPSQSKNVNRNNRKSDKRQFSNNSTLVIKYRSSGQFTYASKDNENDQEEWETASEGGSVRSNSAPREMHKLHNRQNNSQLNSTENKVISNSNSENRKVVMNKNGSNYSCNGGNSFNDNNGNQDGSGGASGSSGGTRFRSSASQNKSVDSSQNKNIDKTSNENRNSDSTSKNCSNNNNSNKDNLFNCIESRQTDSSQRSSDNAHISSQINLDKYGDFIDDEDMLFENAQFQEVLSKATKKSRKLEEQKRLKEEFRLEQKRLEALKNKNKSDNNQIRKPSSRREQPPRTNKSETNAGHKFENKAAVNIRDKETSNNALKKWEINKVAMQIGSWDNSLADEISSERKAPPKPIGTPASIPAWNKKAKVPFETNPSNVCQNSLSGEPIKMPTDIETISQTFSSENSEVNFNPTSYNSYNNSIYNQPVRTSEESKIETSIESQSAEITIHENINFEYDVKNINCDKTHRNLLSTDRNLQNNDQKLLNDKINSVKTIWDNLPVSNITPESKATIASPINPDVDIHTGPVSINQDVTNTRNIDNNLSSSPVPIPNVCKVKPQLQQDFKKDHNEIILSSQAIQIRNSPAAFLSQNQGGFLPYHRFTEFLPESLHHQEAYTSMISNNQQGMHINYNLPNTHLIDSSLLRQNTQEQILSNKMNFINQSQSSFYPQQTTTPKLMSNTPGQLPINMDIGSAHAPAHHMQQLLLTRQNSLTSSMMQPNPMTIPFIQSGQQPIQAQTPLFPTTPILGATNFSSQINPFSQGHLQPHYPHGNFPSLHHTPQFQPNHQHMLLNQHQHQQQQQLIQGQLSHDRVISSGQSGVFNSVIGPSDISANTGLPDFNGQPKPLNHNNIMHGMSGSAFVLPHNLNILMKPSMFATNSQYNTFTTPIQSNLLNLKNGYDHNTNIKSLDLDHYRHDNPMNDRNIYCGDNAQLQKSNDEYYQDVPEFDNCDINYENWMPNLRYSKVDIYTANNLMPTFDFHSQKSPMQFSPMEPGGDAATYRNFITPFRDNHTSLAAAGLPTNANLQYIISPRLKSQYNQDQSAMIGRQHSKCYENQNYISSNNFNSKNESIDNKILIKCTPSCGGGSNSINEIKDNSKDISNTEKSITESKKNSKQRTSYSDNFDDKNQSWSLIEDDRSVPPEDNKSSIKSSNTENSSHSPNKHFSNSSRPNNFDNQCQYGYDETQLSSQTAESLRKFDQDQLKKVIMKLREGPVMTDTNCNEFDFAPYKGATIPRLMPLQSSSSSRSKPNKYNNSFSSDIYTNSDSNNVGLGFYSRNRALTPPAAQFRTYKNKTNNNNNNSNNRHVNPSLLPNSNNNANINNNRVSSRQKCDTNNADMVVVVVDSDDLKLNSVQSKSLECDNLVHENIIDNSIL
Sbjct:    1 MNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGRQIINQSSSGWVNPVTSQDNIDSNSVKSQGITSKIVSDKSQWNSKLTTNKPFFLIGQEFPSLQSDSGPENSQDVSKEKSKDTEIKSKIDELRNRDANISVSTLNRIDALSISKSSKGDIAATGWAAEDEEPNFDEKIVFSDEDSSNEVHNWHSDNEEGTKSERIEKRESIDVPPIISDVWHDQNTMRYSQYQQMPIPVNVQGQFINPQFPTNIISRNPPCTLGNIGDEQSAFMNSVAEQRNARNMEYYYAIERARQKKLATQSSRGSCGINEDHNQIDPSLMRSRHTSMTSDTNESMNTPIEMGPPGGPPMMHHLHKPHLQPQISPMIHPHNISVISPSIPPSSMYRITSHPFNIMPMSTVPMEQVDTKLMEKFVEFLKLQSTSEGNPESPMNSSVAGEQAQNIRFHESDMKTISDSNTQQQQDIERPQSHVSSLGSHVQVDKDNVNIDKFTGPSIKDNSESFEKDFQRKQKFNYSQEEDNQKYDQSKKGLKNKNFKEYRPNKTGYKGDYSSNVGGSGNIVERDYYPENNDVTAYEDYNTYKQHYSRDYKVSRGYNRNPSFNYYSDQYSSQSRDNYNNDYHYKSNSLKTKSSTSKSKDSKPSGSNTDHIQSDRETSSSKKYDNQEAWPHENDMIDGSDKRNKDQKKNPKTAKSIPYQPKKIDNRHYKEKPSESTQEYSMGFAVNPKDNRKNYYSSNYTRRYYTTDYNYYNSSSKYNEYDNDNSYYQDNYYPQEYYGYDKDYSSSKYPNKRNPKTSNIGDQWRQIKDEKSNNPRNTETTNSNPSQSKNVNRNNRKSDKRQFSNNSTLVIKYRSSGQFTYASKDNENDQEEWETASEGGSVRSNSAPREMHKLHNRQNNSQLNSTENKVISNSNSENRKVVMNKNGSNYSCNGGNSFNDNNGNQDGSGGASGSSGGTRFRSSASQNKSVDSSQNKNIDKTSNENRNSDSTSKNCSNNNNSNKDNLFNCIESRQTDSSQRSSDNAHISSQINLDKYGDFIDDEDMLFENAQFQEVLSKATKKSRKLEEQKRLKEEFRLEQKRLEALKNKNKSDNNQIRKPSSRREQPPRTNKSETNAGHKFENKAAVNIRDKETSNNALKKWEINKVAMQIGSWDNSLADEISSERKAPPKPIGTPASIPAWNKKAKVPFETNPSNVCQNSLSGEPIKMPTDIETISQTFSSENSEVNFNPTSYNSYNNSIYNQPVRTSEESKIETSIESQSAEITIHENINFEYDVKNINCDKTHRNLLSTDRNLQNNDQKLLNDKINSVKTIWDNLPVSNITPESKATIASPINPDVDIHTGPVSINQDVTNTRNIDNNLSSSPVPIPNVCKVKPQLQQDFKKDHNEIILSSQAIQIRNSPAAFLSQNQGGFLPYHRFTEFLPESLHHQEAYTSMISNNQQGMHINYNLPNTHLIDSSLLRQNTQEQILSNKMNFINQSQSSFYPQQTTTPKLMSNTPGQLPINMDIGSAHAPAHHMQQLLLTRQNSLTSSMMQPNPMTIPFIQSGQQPIQAQTPLFPTTPILGATNFSSQINPFSQGHLQPHYPHGNFPSLHHTPQFQPNHQHMLLNQHQHQQQQQLIQGQLSHDRVISSGQSGVFNSVIGPSDISANTGLPDFNGQPKPLNHNNIMHGMSGSAFVLPHNLNILMKPSMFATNSQYNTFTTPIQSNLLNLKNGYDHNTNIKSLDLDHYRHDNPMNDRNIYCGDNAQLQKSNDEYYQDVPEFDNCDINYENWMPNLRYSKVDIYTANNLMPTFDFHSQKSPMQFSPMEPGGDAATYRNFITPFRDNHTSLAAAGLPTNANLQYIISPRLKSQYNQDQSAMIGRQHSKCYENQNYISSNNFNSKNESIDNKILIKCTPSCGGGSNSINEIKDNSKDISNTEKSITESKKNSKQRTSYSDNFDDKNQSWSLIEDDRSVPPEDNKSSIKSSNTENSSHSPNKHFSNSSRPNNFDNQCQYGYDETQLSSQTAESLRKFDQDQLKKVIMKLREGPVMTDTNCNEFDFAPYKGATIPRLMPLQSSSSSRSKPNKYNNSFSSDIYTNSDSNNVGLGFYSRNRALTPPAAQFRTYKNKTNNNNNNSNNRHVNPSLLPNSNNNANINNNRVSSRQKCDTNNADMVVVVVDSDDLKLNSVQSKSLECDNLVHENIIDNSIL 2217          
BLAST of BAT2_N domain-containing protein vs. Planmine SMEST
Match: SMESG000038978.1 (SMESG000038978.1)

HSP 1 Score: 3656.3 bits (9480), Expect = 0.000e+0
Identity = 2199/2217 (99.19%), Postives = 2199/2217 (99.19%), Query Frame = 3
Query:   78 MNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGRQIINQSSSGWVNPVTSQDNIDSNSVKSQGITSKIVSDKSQWNSKLTTNKPFFLIGQEFPSLQSDSGPENSQDVSKEKSKDTEIKSKIDELRNRDANISVSTLNRIDALSISKSSKGDIAATGWAAEDEEPNFDEKIVFSDEDSSNEVHNWHSDNEEGTKSERIEKRESIDVPPIISDVWHDQNTMRYSQYQQMPIPVNVQGQFINPQFPTNIISRNPPCTLGNIGDEQSAFMNSVAEQRNARNMEYYYAIERARQKKLATQSSRGSCGINEDHNQIDPSLMRSRHTSMTSDTNESMNTPIEXXXXXXXXXXXXXXXXXXXXXISPMXXXXXXXXXXXXXXXXXMYRITSHPFNIMPMSTVPMEQVDTKLMEKFVEFLKLQSTSEGNPESPMNSSVAGEQAQNIRFHESDMKTISDSNTQQQQDIERPQSHVSSLGSHVQVDKDNVNIDKFTGPSIKDNSESFEKDFQRKQKFNYSQEEDNQKYDQSKKGLKNKNFKEYRPNKTGYKGDYSSNVGGSGNIVERDYYPENNDVTAYEDYNTYKQHYSRDYKVSRGYNRNPSFXXXXXXXXXXXXXXXNNDYHYXXXXXXXXXXXXXXXXXXXXXXNTDHIQSDRETSSSKKYDNQEAWPHENDMIDGSDKRNKDQKKNPKTAKSIPYQPKKIDNRHYKEKPSESTQEYSMGFAVNPKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNKRNPKTSNIGDQWRQIKDEKSNNPRNTETTNSNPSQSKNVNRNNRKSDKRQFSNNSTLVIKYRSSGQFTYASKDNENDQEEWETASEGGSVRSNSAPREMHKLHNRQNNSQLNSTENKVISNSNSENRKVVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNKSVDSSQNKNIDKTSNENRXXXXXXXXXXXXXXXXXXXLFNCIEXXXXXXXXXXXXNAHISSQINLDKYGDFIDDEDMLFENAQFQEVLSKATXXXXXXXXXXXXXXXXXXXQKRLEALKNKNKSDNNQIRKPSSRREQPPRTNKSETNAGHKFENKAAVNIRDKETSNNALKKWEINKVAMQIGSWDNSLADEISSERKAPPKPIGTPASIPAWNKKAKVPFETNPSNVCQNSLSGEPIKMPTDIETISQTFSSENSEVXXXXXXXXXXXXXXXXQPVRXXXXXXXXXXXXXQSAEITIHENINFEYDVKNINCDKTHRNLLSTDRXXXXXXXXXXXXXINSVKTIWDNLPVSNITPESKATIASPINPDVDIHTGPVSINQDVTNTRNIDNNLSSSPVPIPNVCKVKPQLQQDFKKDHNEIILSSQAIQIRNSPAAFLSQNQGGFLPYHRFTEFLPESLHHQEAYTSMISNNQQGMHINYNLPNTHLIDSSLLRQNTQEQILSNKMNFINQSQSSFYPQQTTTPKLMSNTPGQLPINMDIGSAHAPAHHMQQLLLTRQNSLTSSMMQPNPMTIPFIQSGQQPIQAQTPLFPTTPILGATNFSSQINPFSQGHLQPHYPHGNFPSLHHTPQFQPNXXXXXXXXXXXXXXXXXXXXXXSHDRVISSGQSGVFNSVIGPSDISANTGLPDFNGQPKPLNHNNIMHGMSGSAFVLPHNLNILMKPSMFATNSQYNTFTTPIQSNLLNLKNGYDHNTNIKSLDLDHYRHDNPMNDRNIYCGDNAQLQKSNDEYYQDVPEFDNCDINYENWMPNLRYSKVDIYTANNLMPTFDFHSQKSPMQFSPMEPGGDAATYRNFITPFRDNHTSLAAAGLPTNANLQYIISPRLKSQYNQDQSAMIGRQHSKCYENQNYISSNNFNSKNESIDNKILIKCTPSCGGGSNSINEIKDNSKDISNTEKSITESKKNSKQRTSYSDNFDDKNQSWSLIEDDRSVPPEDXXXXXXXXXXXXXXXXXXKHFSNSSRPNNFDNQCQYGYDETQLSSQTAESLRKFDQDQLKKVIMKLREGPVMTDTNCNEFDFAPYKGATIPRLMPLQXXXXXXXKPNKYNNSFSSDIYTNSDSNNVGLGFYSRNRALTPPAAQFRTYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVSSRQKCDTNNAXXXXXXXXXXXLKLNSVQSKSLECDNLVHENIIDNSIL 6728
            MNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGRQIINQSSSGWVNPVTSQDNIDSNSVKSQGITSKIVSDKSQWNSKLTTNKPFFLIGQEFPSLQSDSGPENSQDVSKEKSKDTEIKSKIDELRNRDANISVSTLNRIDALSISKSSKGDIAATGWAAEDEEPNFDEKIVFSDEDSSNEVHNWHSDNEEGTKSERIEKRESIDVPPIISDVWHDQNTMRYSQYQQMPIPVNVQGQFINPQFPTNIISRNPPCTLGNIGDEQSAFMNSVAEQRNARNMEYYYAIERARQKKLATQSSRGSCGINEDHNQIDPSLMRSRHTSMTSDTNESMNTPIEMGPPGGPPMMHHLHKPHLQPQISPMIHPHNISVISPSIPPSSMYRITSHPFNIMPMSTVPMEQVDTKLMEKFVEFLKLQSTSEGNPESPMNSSVAGEQAQNIRFHESDMKTISDSNTQQQQDIERPQSHVSSLGSHVQVDKDNVNIDKFTGPSIKDNSESFEKDFQRKQKFNYSQEEDNQKYDQSKKGLKNKNFKEYRPNKTGYKGDYSSNVGGSGNIVERDYYPENNDVTAYEDYNTYKQHYSRDYKVSRGYNRNPSFNYYSDQYSSQSRDNYNNDYHYKSNSLKTKSSTSKSKDSKPSGSNTDHIQSDRETSSSKKYDNQEAWPHENDMIDGSDKRNKDQKKNPKTAKSIPYQPKKIDNRHYKEKPSESTQEYSMGFAVNPKDNRKNYYSSNYTRRYYTTDYNYYNSSSKYNEYDNDNSYYQDNYYPQEYYGYDKDYSSSKYPNKRNPKTSNIGDQWRQIKDEKSNNPRNTETTNSNPSQSKNVNRNNRKSDKRQFS                  SKDNENDQEEWETASEGGSVRSNSAPREMHKLHNRQNNSQLNSTENKVISNSNSENRKVVMNKNGSNYSCNGGNSFNDNNGNQDGSGGASGSSGGTRFRSSASQNKSVDSSQNKNIDKTSNENRNSDSTSKNCSNNNNSNKDNLFNCIESRQTDSSQRSSDNAHISSQINLDKYGDFIDDEDMLFENAQFQEVLSKATKKSRKLEEQKRLKEEFRLEQKRLEALKNKNKSDNNQIRKPSSRREQPPRTNKSETNAGHKFENKAAVNIRDKETSNNALKKWEINKVAMQIGSWDNSLADEISSERKAPPKPIGTPASIPAWNKKAKVPFETNPSNVCQNSLSGEPIKMPTDIETISQTFSSENSEVNFNPTSYNSYNNSIYNQPVRTSEESKIETSIESQSAEITIHENINFEYDVKNINCDKTHRNLLSTDRNLQNNDQKLLNDKINSVKTIWDNLPVSNITPESKATIASPINPDVDIHTGPVSINQDVTNTRNIDNNLSSSPVPIPNVCKVKPQLQQDFKKDHNEIILSSQAIQIRNSPAAFLSQNQGGFLPYHRFTEFLPESLHHQEAYTSMISNNQQGMHINYNLPNTHLIDSSLLRQNTQEQILSNKMNFINQSQSSFYPQQTTTPKLMSNTPGQLPINMDIGSAHAPAHHMQQLLLTRQNSLTSSMMQPNPMTIPFIQSGQQPIQAQTPLFPTTPILGATNFSSQINPFSQGHLQPHYPHGNFPSLHHTPQFQPNHQHMLLNQHQHQQQQQLIQGQLSHDRVISSGQSGVFNSVIGPSDISANTGLPDFNGQPKPLNHNNIMHGMSGSAFVLPHNLNILMKPSMFATNSQYNTFTTPIQSNLLNLKNGYDHNTNIKSLDLDHYRHDNPMNDRNIYCGDNAQLQKSNDEYYQDVPEFDNCDINYENWMPNLRYSKVDIYTANNLMPTFDFHSQKSPMQFSPMEPGGDAATYRNFITPFRDNHTSLAAAGLPTNANLQYIISPRLKSQYNQDQSAMIGRQHSKCYENQNYISSNNFNSKNESIDNKILIKCTPSCGGGSNSINEIKDNSKDISNTEKSITESKKNSKQRTSYSDNFDDKNQSWSLIEDDRSVPPEDNKSSIKSSNTENSSHSPNKHFSNSSRPNNFDNQCQYGYDETQLSSQTAESLRKFDQDQLKKVIMKLREGPVMTDTNCNEFDFAPYKGATIPRLMPLQSSSSSRSKPNKYNNSFSSDIYTNSDSNNVGLGFYSRNRALTPPAAQFRTYKNKTNNNNNNSNNRHVNPSLLPNSNNNANINNNRVSSRQKCDTNNADMVVVVVDSDDLKLNSVQSKSLECDNLVHENIIDNSIL
Sbjct:    1 MNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVPPPKWVPSLKAETGVSDGRQIINQSSSGWVNPVTSQDNIDSNSVKSQGITSKIVSDKSQWNSKLTTNKPFFLIGQEFPSLQSDSGPENSQDVSKEKSKDTEIKSKIDELRNRDANISVSTLNRIDALSISKSSKGDIAATGWAAEDEEPNFDEKIVFSDEDSSNEVHNWHSDNEEGTKSERIEKRESIDVPPIISDVWHDQNTMRYSQYQQMPIPVNVQGQFINPQFPTNIISRNPPCTLGNIGDEQSAFMNSVAEQRNARNMEYYYAIERARQKKLATQSSRGSCGINEDHNQIDPSLMRSRHTSMTSDTNESMNTPIEMGPPGGPPMMHHLHKPHLQPQISPMIHPHNISVISPSIPPSSMYRITSHPFNIMPMSTVPMEQVDTKLMEKFVEFLKLQSTSEGNPESPMNSSVAGEQAQNIRFHESDMKTISDSNTQQQQDIERPQSHVSSLGSHVQVDKDNVNIDKFTGPSIKDNSESFEKDFQRKQKFNYSQEEDNQKYDQSKKGLKNKNFKEYRPNKTGYKGDYSSNVGGSGNIVERDYYPENNDVTAYEDYNTYKQHYSRDYKVSRGYNRNPSFNYYSDQYSSQSRDNYNNDYHYKSNSLKTKSSTSKSKDSKPSGSNTDHIQSDRETSSSKKYDNQEAWPHENDMIDGSDKRNKDQKKNPKTAKSIPYQPKKIDNRHYKEKPSESTQEYSMGFAVNPKDNRKNYYSSNYTRRYYTTDYNYYNSSSKYNEYDNDNSYYQDNYYPQEYYGYDKDYSSSKYPNKRNPKTSNIGDQWRQIKDEKSNNPRNTETTNSNPSQSKNVNRNNRKSDKRQFS-----------------TSKDNENDQEEWETASEGGSVRSNSAPREMHKLHNRQNNSQLNSTENKVISNSNSENRKVVMNKNGSNYSCNGGNSFNDNNGNQDGSGGASGSSGGTRFRSSASQNKSVDSSQNKNIDKTSNENRNSDSTSKNCSNNNNSNKDNLFNCIESRQTDSSQRSSDNAHISSQINLDKYGDFIDDEDMLFENAQFQEVLSKATKKSRKLEEQKRLKEEFRLEQKRLEALKNKNKSDNNQIRKPSSRREQPPRTNKSETNAGHKFENKAAVNIRDKETSNNALKKWEINKVAMQIGSWDNSLADEISSERKAPPKPIGTPASIPAWNKKAKVPFETNPSNVCQNSLSGEPIKMPTDIETISQTFSSENSEVNFNPTSYNSYNNSIYNQPVRTSEESKIETSIESQSAEITIHENINFEYDVKNINCDKTHRNLLSTDRNLQNNDQKLLNDKINSVKTIWDNLPVSNITPESKATIASPINPDVDIHTGPVSINQDVTNTRNIDNNLSSSPVPIPNVCKVKPQLQQDFKKDHNEIILSSQAIQIRNSPAAFLSQNQGGFLPYHRFTEFLPESLHHQEAYTSMISNNQQGMHINYNLPNTHLIDSSLLRQNTQEQILSNKMNFINQSQSSFYPQQTTTPKLMSNTPGQLPINMDIGSAHAPAHHMQQLLLTRQNSLTSSMMQPNPMTIPFIQSGQQPIQAQTPLFPTTPILGATNFSSQINPFSQGHLQPHYPHGNFPSLHHTPQFQPNHQHMLLNQHQHQQQQQLIQGQLSHDRVISSGQSGVFNSVIGPSDISANTGLPDFNGQPKPLNHNNIMHGMSGSAFVLPHNLNILMKPSMFATNSQYNTFTTPIQSNLLNLKNGYDHNTNIKSLDLDHYRHDNPMNDRNIYCGDNAQLQKSNDEYYQDVPEFDNCDINYENWMPNLRYSKVDIYTANNLMPTFDFHSQKSPMQFSPMEPGGDAATYRNFITPFRDNHTSLAAAGLPTNANLQYIISPRLKSQYNQDQSAMIGRQHSKCYENQNYISSNNFNSKNESIDNKILIKCTPSCGGGSNSINEIKDNSKDISNTEKSITESKKNSKQRTSYSDNFDDKNQSWSLIEDDRSVPPEDNKSSIKSSNTENSSHSPNKHFSNSSRPNNFDNQCQYGYDETQLSSQTAESLRKFDQDQLKKVIMKLREGPVMTDTNCNEFDFAPYKGATIPRLMPLQSSSSSRSKPNKYNNSFSSDIYTNSDSNNVGLGFYSRNRALTPPAAQFRTYKNKTNNNNNNSNNRHVNPSLLPNSNNNANINNNRVSSRQKCDTNNADMVVVVVDSDDLKLNSVQSKSLECDNLVHENIIDNSIL 2200          
The following BLAST results are available for this feature:
BLAST of BAT2_N domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRRC2A3.518e-734.69proline rich coiled-coil 2A [Source:HGNC Symbol;Ac... [more]
PRRC2A3.518e-734.69proline rich coiled-coil 2A [Source:HGNC Symbol;Ac... [more]
PRRC2B4.687e-734.65proline rich coiled-coil 2B [Source:HGNC Symbol;Ac... [more]
PRRC2C4.978e-741.89proline rich coiled-coil 2C [Source:HGNC Symbol;Ac... [more]
PRRC2B7.586e-734.65proline rich coiled-coil 2B [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of BAT2_N domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BAT2_N domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BAT2_N domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prrc2a1.954e-949.12proline-rich coiled-coil 2A [Source:ZFIN;Acc:ZDB-G... [more]
PRRC2B3.600e-837.11proline-rich coiled-coil 2B [Source:NCBI gene;Acc:... [more]
prrc2c1.218e-741.56proline-rich coiled-coil 2C [Source:ZFIN;Acc:ZDB-G... [more]
prrc2c1.218e-741.56proline-rich coiled-coil 2C [Source:ZFIN;Acc:ZDB-G... [more]
prrc2a1.328e-740.79proline-rich coiled-coil 2A [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of BAT2_N domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prrc2c1.624e-740.00proline rich coiled-coil 2C [Source:HGNC Symbol;Ac... [more]
zswim62.774e-735.42zinc finger SWIM-type containing 6 [Source:Xenbase... [more]
zswim62.814e-735.42zinc finger SWIM-type containing 6 [Source:Xenbase... [more]
zswim62.847e-735.42zinc finger SWIM-type containing 6 [Source:Xenbase... [more]
zswim62.990e-735.42zinc finger SWIM-type containing 6 [Source:Xenbase... [more]
back to top
BLAST of BAT2_N domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prrc2c1.244e-841.89proline-rich coiled-coil 2C [Source:MGI Symbol;Acc... [more]
Prrc2c4.309e-741.89proline-rich coiled-coil 2C [Source:MGI Symbol;Acc... [more]
Prrc2c4.550e-741.89proline-rich coiled-coil 2C [Source:MGI Symbol;Acc... [more]
Prrc2c9.156e-741.89proline-rich coiled-coil 2C [Source:MGI Symbol;Acc... [more]
Prrc2a9.265e-736.26proline-rich coiled-coil 2A [Source:MGI Symbol;Acc... [more]
back to top
BLAST of BAT2_N domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3TLH4|PRC2C_MOUSE3.183e-641.89Protein PRRC2C OS=Mus musculus OX=10090 GN=Prrc2c ... [more]
sp|Q5JSZ5|PRC2B_HUMAN3.643e-634.65Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B P... [more]
sp|P48634|PRC2A_HUMAN5.618e-636.26Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A P... [more]
sp|Q6MG48|PRC2A_RAT5.762e-636.26Protein PRRC2A OS=Rattus norvegicus OX=10116 GN=Pr... [more]
sp|Q5TM26|PRC2A_MACMU5.860e-636.26Protein PRRC2A OS=Macaca mulatta OX=9544 GN=PRRC2A... [more]
back to top
BLAST of BAT2_N domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A094ZC801.660e-1128.66Protein PRRC2C (Fragment) OS=Schistosoma haematobi... [more]
A0A4S2LFT08.235e-1147.44BAT2_N domain-containing protein OS=Opisthorchis f... [more]
A0A4S2LF608.696e-1147.44BAT2_N domain-containing protein OS=Opisthorchis f... [more]
A0A4V3SDV89.389e-1147.44BAT2_N domain-containing protein OS=Opisthorchis f... [more]
A0A4S2LFF09.392e-1147.44BAT2_N domain-containing protein OS=Opisthorchis f... [more]
back to top
BLAST of BAT2_N domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PRRC2B4.860e-837.80proline rich coiled-coil 2B [Source:HGNC Symbol;Ac... [more]
PRRC2B1.062e-737.65proline rich coiled-coil 2B [Source:HGNC Symbol;Ac... [more]
prrc2a1.138e-739.76proline-rich coiled-coil 2A [Source:ZFIN;Acc:ZDB-G... [more]
prrc2c1.540e-741.56proline-rich coiled-coil 2C [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of BAT2_N domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BAT2_N domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BAT2_N domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO442462.298e-936.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BAT2_N domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prrc2c1.798e-832.88proline rich coiled-coil 2C [Source:NCBI gene;Acc:... [more]
prrc2c2.374e-832.88proline rich coiled-coil 2C [Source:NCBI gene;Acc:... [more]
PRRC2B5.908e-836.47proline rich coiled-coil 2B [Source:NCBI gene;Acc:... [more]
prrc2a8.461e-740.28proline rich coiled-coil 2A [Source:NCBI gene;Acc:... [more]
prrc2a8.833e-740.28proline rich coiled-coil 2A [Source:NCBI gene;Acc:... [more]
back to top
BLAST of BAT2_N domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000038978.10.000e+0100.00SMESG000038978.1[more]
SMESG000038978.10.000e+099.19SMESG000038978.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001361 ID=SMED30001361|Name=BAT2_N domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=7009bp
TTTCTCCATTGTATCTAAGATATATATATTTTGATAATTTTACTATAAAA
TAAATTTAAATTTTTTTAAAGCCAGTTATGAACCGAAATGATAAAAATAA
AAAGTTTACACCATTAAATATTAATAATGTTTTTAAAGGCAAATCAGTTG
AACCACAAAGCAAACCTAGTTATAAAGTAGGTGGTATGCAGACTTTAGGT
AAAGTGTCGAGTATGAGGCGTGTACCACCTCCTAAATGGGTCCCCAGTTT
AAAAGCCGAAACTGGTGTTTCTGATGGCCGTCAAATAATCAATCAATCAA
GTTCTGGATGGGTTAATCCAGTAACATCACAAGATAATATTGATTCTAAT
AGTGTCAAATCTCAAGGAATAACTAGTAAAATTGTATCAGATAAAAGTCA
ATGGAATTCTAAGTTAACGACTAATAAACCTTTCTTTTTAATTGGACAAG
AATTTCCATCTTTACAATCAGATTCTGGACCAGAAAATTCTCAAGATGTG
AGTAAGGAAAAAAGCAAAGATACTGAAATTAAGTCTAAAATTGATGAATT
AAGAAATCGCGATGCAAATATAAGTGTTTCAACTTTAAATAGGATCGATG
CACTTAGTATTAGTAAAAGTTCAAAAGGTGATATCGCAGCTACTGGTTGG
GCTGCTGAAGACGAGGAACCAAATTTCGACGAGAAAATTGTCTTTAGCGA
CGAAGATTCATCAAACGAAGTACATAATTGGCATTCGGATAATGAAGAAG
GCACTAAATCAGAAAGAATTGAAAAACGTGAATCCATCGATGTACCACCA
ATAATCAGTGATGTCTGGCATGATCAAAATACTATGCGATATTCTCAATA
CCAACAAATGCCAATACCAGTAAATGTACAAGGACAATTCATTAATCCGC
AATTTCCTACAAATATTATCAGTCGCAATCCACCGTGCACTTTAGGCAAT
ATTGGTGATGAACAGTCTGCATTTATGAATTCAGTTGCTGAACAGCGAAA
CGCAAGAAATATGGAATATTATTACGCAATCGAGCGAGCTAGACAGAAAA
AACTCGCAACTCAATCTAGTCGCGGTTCTTGTGGCATAAATGAAGATCAC
AATCAAATAGATCCATCACTAATGCGCAGTAGACATACGTCAATGACTAG
CGATACTAATGAATCAATGAATACTCCGATCGAAATGGGACCTCCCGGTG
GACCTCCTATGATGCATCATTTGCACAAACCTCATTTACAGCCTCAAATA
TCTCCGATGATTCATCCACACAATATATCAGTCATATCTCCATCAATTCC
TCCATCTTCAATGTACAGAATCACTTCACATCCATTTAATATCATGCCGA
TGTCTACTGTGCCCATGGAACAAGTCGATACGAAATTGATGGAAAAATTT
GTAGAATTTCTCAAATTGCAGTCTACAAGTGAAGGAAATCCTGAAAGCCC
AATGAATTCGAGTGTTGCTGGTGAACAAGCACAAAATATCAGATTTCATG
AATCTGACATGAAAACAATCTCAGATAGCAACACTCAGCAACAGCAAGAC
ATTGAAAGACCTCAATCTCACGTTTCTTCATTGGGTAGTCATGTACAGGT
TGATAAAGACAATGTAAATATCGATAAATTTACCGGGCCTAGCATAAAAG
ACAATTCAGAATCTTTCGAAAAAGATTTTCAACGAAAACAAAAATTCAAT
TATTCCCAAGAGGAAGACAATCAAAAATATGATCAATCGAAGAAAGGTTT
GAAAAATAAAAATTTTAAGGAGTATAGACCTAACAAAACTGGATATAAAG
GAGATTATTCTAGTAATGTTGGCGGTTCTGGGAACATCGTTGAACGGGAT
TATTATCCGGAAAACAATGACGTGACGGCATATGAAGATTATAATACATA
TAAACAGCATTATTCAAGAGATTACAAAGTGTCTCGGGGCTATAATCGAA
ATCCGTCATTTAACTATTATTCAGATCAGTATTCTAGCCAATCTAGAGAT
AACTACAATAACGATTATCATTACAAGTCCAATTCACTTAAAACTAAATC
ATCTACCTCAAAATCCAAGGACTCGAAACCATCAGGTTCAAATACTGATC
ACATCCAGTCGGATCGGGAGACATCAAGCAGCAAAAAGTATGATAATCAA
GAAGCATGGCCACATGAAAATGACATGATTGATGGTTCTGATAAAAGGAA
CAAAGACCAAAAGAAGAATCCGAAAACAGCTAAATCCATTCCATATCAAC
CGAAAAAAATTGATAATCGTCATTATAAAGAAAAGCCGTCTGAATCGACA
CAAGAATACAGCATGGGATTTGCTGTAAATCCAAAAGATAATCGAAAAAA
TTACTATTCTAGCAATTATACTAGAAGATATTATACGACGGATTACAATT
ACTATAACTCATCTTCCAAATACAATGAATACGATAACGACAACAGCTAT
TATCAAGACAATTATTACCCACAAGAATATTATGGATATGATAAAGACTA
TTCATCTAGTAAATATCCAAATAAACGGAATCCTAAAACTTCTAACATTG
GTGATCAGTGGCGACAGATCAAAGATGAAAAATCCAATAATCCAAGAAAC
ACAGAAACTACAAATTCGAACCCCAGTCAATCAAAAAACGTTAATCGCAA
TAACAGAAAATCTGACAAAAGACAGTTTTCCAATAATAGTACACTTGTTA
TAAAATATCGTTCATCCGGTCAGTTTACGTATGCCTCGAAAGACAATGAA
AATGATCAGGAAGAATGGGAAACTGCTTCTGAAGGTGGAAGTGTTCGCAG
TAATAGTGCTCCTAGAGAAATGCATAAATTACACAATCGACAGAATAACT
CTCAGCTTAATTCGACAGAAAATAAAGTGATATCAAATAGCAACAGTGAA
AATCGAAAAGTAGTAATGAATAAGAACGGATCAAACTATTCATGTAACGG
TGGTAATTCATTTAATGATAACAATGGAAATCAGGATGGAAGTGGAGGTG
CGTCAGGTTCCTCAGGAGGTACTAGATTTCGGTCTAGTGCTTCTCAAAAT
AAATCTGTTGATTCTTCACAAAATAAAAACATAGATAAAACATCTAATGA
AAATCGCAATTCTGATTCAACTTCGAAAAACTGTTCAAATAACAATAATA
GCAACAAAGATAATTTATTTAACTGTATTGAATCACGACAAACCGATTCT
TCGCAGCGTTCAAGTGATAATGCACACATTTCCTCACAAATAAATCTCGA
TAAATATGGCGATTTTATCGACGATGAAGATATGCTTTTTGAAAATGCAC
AATTTCAAGAAGTTTTATCGAAAGCAACAAAAAAAAGCAGGAAATTAGAA
GAACAAAAACGACTCAAAGAAGAATTTCGGTTAGAACAAAAGAGATTAGA
AGCTTTGAAAAATAAAAACAAATCTGACAATAATCAAATTAGGAAACCAT
CAAGTCGACGAGAACAACCTCCGAGAACTAATAAATCTGAGACAAATGCT
GGACACAAATTTGAAAATAAAGCAGCAGTAAATATAAGAGATAAAGAAAC
TTCGAATAATGCATTAAAAAAATGGGAGATAAATAAAGTAGCAATGCAGA
TTGGCTCCTGGGACAATAGTTTAGCCGACGAGATTAGCTCAGAAAGGAAA
GCTCCTCCTAAACCCATCGGCACTCCTGCTTCCATTCCAGCTTGGAATAA
AAAAGCTAAAGTTCCATTCGAAACCAATCCTTCAAACGTTTGTCAAAATT
CTTTGTCCGGCGAACCAATAAAGATGCCAACTGATATTGAAACCATTTCA
CAGACATTTTCTTCAGAGAATTCCGAGGTCAATTTTAATCCAACATCATA
CAATTCATATAATAATTCAATTTATAATCAACCAGTTAGAACTAGTGAAG
AAAGTAAAATTGAAACGTCAATTGAAAGTCAATCTGCAGAAATTACTATA
CATGAAAACATAAATTTTGAATATGATGTCAAAAATATAAACTGTGACAA
AACTCATAGAAATTTGCTATCAACAGATCGAAATTTGCAAAATAATGACC
AGAAATTGTTAAACGATAAAATAAATTCAGTTAAAACAATTTGGGATAAT
CTTCCTGTATCAAATATAACACCTGAATCAAAAGCCACAATTGCATCTCC
TATTAATCCGGACGTCGATATTCATACAGGGCCAGTTTCGATCAATCAAG
ATGTTACTAATACAAGGAATATAGACAATAATTTATCAAGTTCACCTGTA
CCAATTCCTAACGTATGTAAAGTTAAACCACAATTACAACAAGATTTCAA
AAAAGATCACAATGAAATAATTTTATCTTCACAGGCTATACAAATTCGAA
ATTCACCCGCAGCATTTCTTTCTCAAAATCAAGGTGGATTTCTACCATAT
CATCGATTCACAGAATTTTTACCGGAATCATTACATCATCAAGAAGCATA
TACTTCCATGATTTCTAATAATCAGCAAGGAATGCATATAAATTATAACC
TACCAAATACACATTTAATTGATTCATCTCTGCTAAGACAAAATACACAA
GAACAAATTTTATCCAATAAAATGAATTTTATCAATCAAAGTCAGTCTTC
ATTTTATCCTCAACAGACAACTACTCCGAAATTAATGTCTAATACTCCCG
GGCAATTACCTATAAATATGGATATAGGTTCAGCTCACGCTCCTGCCCAT
CATATGCAGCAATTATTACTTACGAGACAAAACTCATTGACCAGTAGTAT
GATGCAACCTAATCCTATGACTATTCCTTTTATTCAAAGTGGACAACAGC
CAATACAAGCGCAAACTCCTTTATTTCCAACGACTCCGATATTAGGAGCA
ACTAATTTCTCTTCTCAAATAAATCCATTTTCTCAAGGTCATTTACAACC
TCATTATCCACACGGTAATTTTCCATCTTTGCATCACACTCCCCAGTTTC
AACCTAATCATCAACATATGCTATTAAATCAACACCAACATCAACAACAA
CAACAGCTCATTCAAGGTCAGTTGTCTCATGACCGAGTCATTAGTTCCGG
CCAGTCAGGAGTTTTTAATTCTGTAATCGGTCCATCTGACATTTCTGCTA
ATACAGGTTTGCCAGATTTTAATGGTCAACCGAAACCTTTAAATCACAAT
AACATTATGCATGGAATGAGTGGCTCTGCATTTGTCCTACCTCATAATCT
TAATATTTTAATGAAGCCATCAATGTTCGCTACTAATTCTCAATATAATA
CTTTCACAACTCCTATTCAATCTAATCTACTTAATTTGAAAAATGGATAT
GATCATAACACTAATATAAAATCGTTAGATCTGGATCATTACAGACATGA
TAATCCAATGAACGATCGAAATATTTATTGTGGAGATAATGCACAATTAC
AAAAATCAAATGATGAGTATTATCAGGATGTACCTGAATTTGATAACTGT
GATATAAATTATGAAAATTGGATGCCGAATCTTCGTTATTCCAAAGTTGA
TATTTATACTGCAAATAATTTAATGCCTACTTTTGATTTTCATTCTCAAA
AATCTCCAATGCAATTCTCACCAATGGAACCAGGCGGTGACGCTGCTACA
TATCGCAATTTTATTACTCCATTTCGTGATAATCATACTTCATTGGCTGC
CGCTGGTTTACCAACAAATGCAAATTTACAGTACATTATTTCACCAAGAT
TAAAATCACAATATAATCAAGATCAATCAGCAATGATTGGCCGACAACAT
TCAAAGTGTTATGAAAATCAAAATTACATTTCATCTAATAATTTCAACTC
TAAAAACGAATCCATAGATAACAAAATTTTAATAAAATGCACTCCTTCCT
GTGGCGGTGGTTCAAATTCGATCAACGAGATCAAAGATAATTCGAAAGAT
ATATCGAACACAGAGAAGTCTATTACAGAAAGTAAAAAAAATTCCAAACA
ACGAACATCTTATTCTGATAACTTCGATGATAAAAATCAATCTTGGTCAT
TGATAGAAGATGACAGGAGCGTGCCACCAGAAGATAACAAATCATCGATC
AAGAGCAGTAACACTGAAAATAGTTCACACAGTCCAAACAAACATTTCAG
CAATTCTTCACGGCCAAATAATTTTGACAATCAATGTCAATACGGTTACG
ATGAAACGCAATTGTCATCTCAGACTGCTGAATCACTCAGAAAATTTGAT
CAGGATCAGCTGAAAAAAGTCATAATGAAATTGCGGGAAGGCCCAGTGAT
GACCGATACGAATTGTAATGAGTTTGATTTCGCGCCATATAAAGGAGCAA
CCATTCCCCGATTGATGCCCCTCCAGTCATCATCGTCATCTAGGAGCAAA
CCCAACAAATACAACAACTCATTTTCATCGGATATCTACACCAATAGTGA
TAGTAATAATGTCGGATTGGGATTCTATTCTCGGAATCGGGCTCTTACTC
CTCCTGCTGCTCAATTTCGGACTTACAAAAATAAAACTAATAATAATAAT
AACAACAGCAATAATCGGCATGTAAACCCCTCATTGTTACCGAATAGCAA
CAATAATGCCAATATTAATAATAATCGAGTATCATCTCGGCAGAAATGTG
ATACGAATAATGCAGATATGGTTGTTGTTGTTGTTGACTCTGATGATTTG
AAATTGAACAGTGTGCAGTCAAAATCTTTGGAGTGTGATAATCTTGTGCA
TGAGAACATTATTGATAATTCAATACTTTGATTTTTAGTTTATAGTAAGA
ATTGAACTATTTTATGTGTGTGTGTGCGTCCACGCACGCGCGTAAGCTCA
CACCGCAGTGAATAATAATAATCATCATAATTCGGTTATGGTATGAAATA
ATAATAATATATTTAGTAATTGAATATTAAGCTATTTGTGTTCTTTTCAT
TTTCAGTGACGAAAATGTAGTTATTTGTTTATATGTTATATTTGTTTGCT
GACAGATCCCAGTTGTACATGATTCTAGACTAATGAATATATGTTTCAGT
CTTTGCAGT
back to top

protein sequence of SMED30001361-orf-1

>SMED30001361-orf-1 ID=SMED30001361-orf-1|Name=SMED30001361-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2218bp
MNRNDKNKKFTPLNINNVFKGKSVEPQSKPSYKVGGMQTLGKVSSMRRVP
PPKWVPSLKAETGVSDGRQIINQSSSGWVNPVTSQDNIDSNSVKSQGITS
KIVSDKSQWNSKLTTNKPFFLIGQEFPSLQSDSGPENSQDVSKEKSKDTE
IKSKIDELRNRDANISVSTLNRIDALSISKSSKGDIAATGWAAEDEEPNF
DEKIVFSDEDSSNEVHNWHSDNEEGTKSERIEKRESIDVPPIISDVWHDQ
NTMRYSQYQQMPIPVNVQGQFINPQFPTNIISRNPPCTLGNIGDEQSAFM
NSVAEQRNARNMEYYYAIERARQKKLATQSSRGSCGINEDHNQIDPSLMR
SRHTSMTSDTNESMNTPIEMGPPGGPPMMHHLHKPHLQPQISPMIHPHNI
SVISPSIPPSSMYRITSHPFNIMPMSTVPMEQVDTKLMEKFVEFLKLQST
SEGNPESPMNSSVAGEQAQNIRFHESDMKTISDSNTQQQQDIERPQSHVS
SLGSHVQVDKDNVNIDKFTGPSIKDNSESFEKDFQRKQKFNYSQEEDNQK
YDQSKKGLKNKNFKEYRPNKTGYKGDYSSNVGGSGNIVERDYYPENNDVT
AYEDYNTYKQHYSRDYKVSRGYNRNPSFNYYSDQYSSQSRDNYNNDYHYK
SNSLKTKSSTSKSKDSKPSGSNTDHIQSDRETSSSKKYDNQEAWPHENDM
IDGSDKRNKDQKKNPKTAKSIPYQPKKIDNRHYKEKPSESTQEYSMGFAV
NPKDNRKNYYSSNYTRRYYTTDYNYYNSSSKYNEYDNDNSYYQDNYYPQE
YYGYDKDYSSSKYPNKRNPKTSNIGDQWRQIKDEKSNNPRNTETTNSNPS
QSKNVNRNNRKSDKRQFSNNSTLVIKYRSSGQFTYASKDNENDQEEWETA
SEGGSVRSNSAPREMHKLHNRQNNSQLNSTENKVISNSNSENRKVVMNKN
GSNYSCNGGNSFNDNNGNQDGSGGASGSSGGTRFRSSASQNKSVDSSQNK
NIDKTSNENRNSDSTSKNCSNNNNSNKDNLFNCIESRQTDSSQRSSDNAH
ISSQINLDKYGDFIDDEDMLFENAQFQEVLSKATKKSRKLEEQKRLKEEF
RLEQKRLEALKNKNKSDNNQIRKPSSRREQPPRTNKSETNAGHKFENKAA
VNIRDKETSNNALKKWEINKVAMQIGSWDNSLADEISSERKAPPKPIGTP
ASIPAWNKKAKVPFETNPSNVCQNSLSGEPIKMPTDIETISQTFSSENSE
VNFNPTSYNSYNNSIYNQPVRTSEESKIETSIESQSAEITIHENINFEYD
VKNINCDKTHRNLLSTDRNLQNNDQKLLNDKINSVKTIWDNLPVSNITPE
SKATIASPINPDVDIHTGPVSINQDVTNTRNIDNNLSSSPVPIPNVCKVK
PQLQQDFKKDHNEIILSSQAIQIRNSPAAFLSQNQGGFLPYHRFTEFLPE
SLHHQEAYTSMISNNQQGMHINYNLPNTHLIDSSLLRQNTQEQILSNKMN
FINQSQSSFYPQQTTTPKLMSNTPGQLPINMDIGSAHAPAHHMQQLLLTR
QNSLTSSMMQPNPMTIPFIQSGQQPIQAQTPLFPTTPILGATNFSSQINP
FSQGHLQPHYPHGNFPSLHHTPQFQPNHQHMLLNQHQHQQQQQLIQGQLS
HDRVISSGQSGVFNSVIGPSDISANTGLPDFNGQPKPLNHNNIMHGMSGS
AFVLPHNLNILMKPSMFATNSQYNTFTTPIQSNLLNLKNGYDHNTNIKSL
DLDHYRHDNPMNDRNIYCGDNAQLQKSNDEYYQDVPEFDNCDINYENWMP
NLRYSKVDIYTANNLMPTFDFHSQKSPMQFSPMEPGGDAATYRNFITPFR
DNHTSLAAAGLPTNANLQYIISPRLKSQYNQDQSAMIGRQHSKCYENQNY
ISSNNFNSKNESIDNKILIKCTPSCGGGSNSINEIKDNSKDISNTEKSIT
ESKKNSKQRTSYSDNFDDKNQSWSLIEDDRSVPPEDNKSSIKSSNTENSS
HSPNKHFSNSSRPNNFDNQCQYGYDETQLSSQTAESLRKFDQDQLKKVIM
KLREGPVMTDTNCNEFDFAPYKGATIPRLMPLQSSSSSRSKPNKYNNSFS
SDIYTNSDSNNVGLGFYSRNRALTPPAAQFRTYKNKTNNNNNNSNNRHVN
PSLLPNSNNNANINNNRVSSRQKCDTNNADMVVVVVDSDDLKLNSVQSKS
LECDNLVHENIIDNSIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR033184PRRC2
IPR009738BAT2_N
Vocabulary: biological process
TermDefinition
GO:0002244hematopoietic progenitor cell differentiation
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0008022protein C-terminus binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1073..1120
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 725..739
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 885..943
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 526..571
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 480..578
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 840..856
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 126..153
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 651..747
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 651..678
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 209..229
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 679..716
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 921..943
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 138..153
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1987..2014
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 480..508
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1932..2014
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 809..873
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1971..1986
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1108..1144
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 971..1023
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1939..1964
IPR009738BAT2, N-terminalPFAMPF07001BAT2_Ncoord: 6..103
e-value: 1.7E-18
score: 67.8
IPR033184Protein PRRC2PANTHERPTHR14038BAT2 HLA-B-ASSOCIATED TRANSCRIPT 2coord: 4..137