SMED30001359

Overview
NameSMED30001359
Smed IDSMED30001359
Length (bp)1071
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30001359 (SMED30001359) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30001359 (SMED30001359) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001359 (SMED30001359) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001359 (SMED30001359) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001359

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 Contig16469newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 Contig16469uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_1996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_1996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_1996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_1996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_1996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_1996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 Contig46464uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 Contig46464newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 Contig19571uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 Contig19571newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_1996_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_1996_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30001359SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_1996_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30001359 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005522:21292..23389 +3628
v31.005522:22456..23830 +3048
v31.005522:21058..22335 +2634
v31.005522:20540..22101 +2525
v31.028371:3357..4517 -2423
v31.028371:3995..5293 -1276
v31.005522:20283..21557 +1189
Homology
BLAST of SMED30001359 vs. Ensembl Human
Match: AHNAK (AHNAK nucleoprotein [Source:HGNC Symbol;Acc:HGNC:347])

HSP 1 Score: 70.4774 bits (171), Expect = 2.119e-12
Identity = 112/365 (30.68%), Postives = 170/365 (46.58%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDW--KLPKFE-GKLKKP--KGE----------LDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHL-----SIPEVDIDVDGKKKKHGFGINLP 1071
            +DI++PD  +   EGKLK PK         A  +  PDID+++ G K KG++D+++  P V+ D   PD+DI   +VDI+       +D   PDW  K+PK +  K+  P  KGE           D+D+ GP+VDVD     I G  AK      F  P++ I    I+ PD D+ + G K K  +++ LP M     EG  K P  EVD  +K P +DID  D   H    D  +  P   +        K +   +D+NLP                + D+D++ P++D D                 D+++  P+    ++G K K   D+HL     S+PEVD+++ G K K    ++LP
Sbjct: 3840 VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSL--PKVEGDMQVPDLDIKGPKVDINAPD----VDVRGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLPKADLDVSGPKVDVDVPDVNIEGPDAKLK-GPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKM-----EGDLKAP--EVD--IKGPKVDIDAPDVDVH--GPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLP----------------KADIDVSGPKVDIDTP---------------DIDIHGPEGK--LKGPKFKMP-DLHLKAPKISMPEVDLNLKGPKMKGDVDVSLP 4152          

HSP 2 Score: 67.781 bits (164), Expect = 1.464e-11
Identity = 111/360 (30.83%), Postives = 179/360 (49.72%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDID-----IDGKKHRISG------DLSVDKPXXXXX-XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDAS-----IDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +DI++PD  +   + KLK PK     ++++AP I   D D+H K PK + D++V  P V+ D   P++DI   +VDID      HG D++L  P  K+PKF     K +G        + DI+I GP+VD+D     I G  AK      F  P++ I    I+ PD+D  + G K K  +++ LP     K EG  K P  E+D  +K PS+DID     I+G + ++ G      ++++  P   +   D+ +   K K  +D++LP                +V+ D+  PE+D +G   K K          DV+ + P  S     ++++G K KGD+D+  S+P+++ D+ G K
Sbjct: 4224 VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVTLPKADIEISGPKVDIDAPDVSIEGPDAKLK-GPKFKMPEMNIKAPKISMPDIDFNLKGPKVKGDVDVSLP-----KVEGDLKGP--EID--IKGPSLDIDTPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLP----------------KVESDLKGPEVDIEGPEGKLKGPKFKMP---DVHFKSPQISMSDIDLNLKGPKIKGDMDI--SVPKLEGDLKGPK 4552          

HSP 3 Score: 67.3958 bits (163), Expect = 1.880e-11
Identity = 100/362 (27.62%), Postives = 165/362 (45.58%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDW-------KLPKFEGKLKKPKG--------ELDIDIRGPEVDVDIHGNRAKGNV----DVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DI+ PD  +   EGK K PK         A  +  PDID+++ G K KG++D+++  P ++ D   P++DI   +VDI+       +D   PDW       K+PKF     K +G        + D+D+ GP+VD+D+     +G         F  P++ I    I+ PD+D+ + G K K  +++ LP     K EG  + P    DL +K P +DI+      R   D  +  P   +        K +   +D+NLP                + DLD++ P++D D                 DVN+E PDA   ++G K K  ++++    +S+P+ D+ + G K K    ++LP
Sbjct: 3712 VDIDTPDINIEGSEGKFKGPKFKIPEMHLKAPKISMPDIDLNLKGPKVKGDVDVSL--PKMEGDLKGPEVDIKGPKVDINAPD----VDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLP-----KVEGDMQVP----DLDIKGPKVDINAPDVDVR-GPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLP----------------KADLDVSGPKVDVDVP---------------DVNIEGPDAK--LKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLP 4024          

HSP 4 Score: 66.6254 bits (161), Expect = 3.481e-11
Identity = 110/370 (29.73%), Postives = 169/370 (45.68%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP---------------------------DWKLPKFEGKLKKPKGELDIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            LDI+ PD  +   EGKLK PK     ++++AP I   D D+H K PK + D++V  P V+ D   P++DIE   +GK K  G  F +P                           D  +PK EG LK PK    +D++GP+V     D+DIHG   K      F  PDL +    I+ P++D+ + G K K  ++I LP     K EG  K P  EVD  ++ P +DID+     +   D  +  P   +        K +   +D+NLP                + D+D++ P++D D                 DVN+E PDA   ++G K K  ++ +    +S+P++D+++ G K K    + LP
Sbjct: 4426 LDIDTPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVESDLKGPEVDIE-GPEGKLK--GPKFKMPDVHFKSPQISMSDIDLNLKGPKIKGDMDISVPKLEGDLKGPK----VDVKGPKVGIDTPDIDIHGPEGKLK-GPKFKMPDLHLKAPKISMPEVDLNLKGPKVKGDMDISLP-----KVEGDLKGP--EVD--IRDPKVDIDVPDVDVQ-GPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLP----------------KADIDVSGPKVDVDVP---------------DVNIEGPDAK--LKGPKFKMPEMSIKAPKISMPDIDLNLKGPKVKGDVDVTLP 4744          

HSP 5 Score: 66.2402 bits (160), Expect = 3.944e-11
Identity = 113/394 (28.68%), Postives = 177/394 (44.92%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPD---------WKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKK-HGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV---DIHGNRAKGNV-DVTFNKPDLEIDITK---PDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDVH---LSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNL K +IDV   K                 +D+  PD         WK PKF   E   K PK    +  PDID+++ G K KG++D  V  P V+ D   P++D++   VDID       G D++L  P  K+PKF     K +G        + D+D+ GP+VDV   D++    +G +    F  P++ I   K   PD D+ + G K K  ++I LP     K EG  K P  EVD  ++ P +DID+     +   D  +  P   +        K +   +D+NLP                + DLD++ P++D D                 DVN+E P+  +  +G K K  ++++    +S+P++D+++ G K K    ++LP
Sbjct: 2787 DVNLPKADIDVSGPK-----------------VDVECPDVNIEGPEGKWKSPKFKMPEMHFKTPK----ISMPDIDLNLTGPKIKGDVD--VTGPKVEGDLKGPEVDLKGPKVDIDVPDVNVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDVSGPKVDVEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKIPMPDFDLHLKGPKVKGDVDISLP-----KVEGDLKGP--EVD--IRGPQVDIDVPDVGVQ-GPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLP----------------KADLDVSGPKVDIDVP---------------DVNIEGPEGKL--KGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLP 3114          

HSP 6 Score: 65.0846 bits (157), Expect = 1.190e-10
Identity = 97/326 (29.75%), Postives = 153/326 (46.93%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKP----KGA-LDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL------DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVD 1020
            D  +PK EG++K P    +G  +D++APD+DV   D H K PK ++          + P VD++  K D    VD+ G K    +D  +PD  L   EGKLK PK ++         I  P+VD ++ G + KG+VDV+   P LE ++  P++D+      K   ++  +P +      GK K PK ++ D+  K P I   D+D+  K  +  G++ VD P         +    K   +D++ P                  D+DI  PE    G   K  D +         N+ +PD  ++++G K KGD+DV  S+PEV+
Sbjct: 2203 DVSVPKVEGEMKVPDVDIRGPKVDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKGEGPEVDVNLPKAD----VDVSGPK----VDVEVPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDFNLKGPKIKGDVDVS--APKLEGELKGPELDV------KGPKLDADMPEVAVEGPNGKWKTPKFKMPDMHFKAPKISMPDLDLHLKSPKAKGEVDVDVPK--------LEGDLKGPHVDVSGP------------------DIDIEGPEGKLKGPKFKMPDMHFKAP-----NISMPDVDLNLKGPKIKGDVDV--SVPEVE 2479          

HSP 7 Score: 64.6994 bits (156), Expect = 1.372e-10
Identity = 103/359 (28.69%), Postives = 170/359 (47.35%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDVDIHGNRAKGNV----DVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI---DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINL 1068
            +D+  PD  +   EGKLK PK     ++++AP I   D D+H K PK + D+++  P V+ D   P++DI   +VDID       G D++L  P  K+PKF     K +G        + D+D+ GP+VD+D+     +G         F  P++ I    I+ PD+D+ + G K K  +++ LP     K EG  K P    D+ +K P +DI   D+D     + G D  +  P   +        K +   +D+NLP                + DLD++ P++D D                 DVN+E PDA   ++G K K  ++++    +S+P++D+++ G K K    ++L
Sbjct: 2930 VDVEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKIPMPDFDLHLKGPKVKGDVDISLPKVEGDLKGPEVDIRGPQVDIDVPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLP-----KVEGDMKVP----DVDIKGPKVDINAPDVD-----VQGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLP----------------KADLDVSGPKVDVDVP---------------DVNIEGPDAK--LKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSL 3241          

HSP 8 Score: 64.6994 bits (156), Expect = 1.486e-10
Identity = 76/218 (34.86%), Postives = 115/218 (52.75%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKF----------EGKLKKPKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDID 660
            +DI  PD  +   EGKLK PK     ++++AP I   D D+H K PK + D++V  P V+ D   P++DI   +VDI+       G D++L  P  K+PKF          +G +K PK ++D     +DI GP+V+++    + KG     F  P++ I    I+ PD+D+ + G K K  +++ LP     K EG  K P  EVD  +K P +DID
Sbjct: 2546 VDIEGPDVNIEGPEGKLKGPKLKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDINAPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDGDVKLPKADIDVSGPKVDIEGPDVNIEGPEGKLKGP---KFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLP-----KVEGDLKGP--EVD--IKGPKVDID 2751          

HSP 9 Score: 64.6994 bits (156), Expect = 1.527e-10
Identity = 112/358 (31.28%), Postives = 175/358 (48.88%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKP----KGA-LDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEV---DVDIH--GNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP--SMKGLKF---EGKGKKPK---SEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGID--INLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD----IDVH-----LSIPEVDIDVDGKKKKHGFGINLP 1071
            D  +PK EG++K P    KG  +D++APD+DV   D H K PK ++          + P VD++  K D    V + G K    +D  +PD  L   EGKLK PK ++ ++  + P++   DVD+H  G + KG+VDV+   P LE D+T P +D+E+        + +  P   +KG KF   E   K PK    +V+L +K P +  D+D    ++ G++ V   D         +     HG D  + +P  K PKFS    K +G  ++D+N P+ D D +  K             V+VEVPD S++    K KG      ++H     +S+P+VD ++ G K K    ++ P
Sbjct: 2008 DVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKAD----VVVSGPK----VDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSL--PKLEGDLTGPSVDVEV------PDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVNLNLKGPKVKGDMDVSVPKVEGEMKVPDVDIRGPKVDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKGEGP-EVDVNLPKADVDVSGPK-------------VDVEVPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDFNLKGPKIKGDVDVSAP 2335          

HSP 10 Score: 64.3142 bits (155), Expect = 2.121e-10
Identity = 107/360 (29.72%), Postives = 172/360 (47.78%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKF-------EG---KLKKPKGELDID-----IRGPEVDVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DIN PD ++   +GK+K  K     L + +P +   DV+++ K PK + DL++  PN++ DF  P +DI   EV+++      HG D+NL  P  K+PKF       EG    +  PKG+++I+     I GP+++V+      KG     F  PD+ I    I+ PD+D+ + G K K  ++I LP     K EG  K P  EVD  +K P +DI+  D   H    D  +  P   +        K +   +D+ LP                + D+DI+ P +D D                 DVN+E PDA   ++G K K  ++++    +S+P+ D+++ G K K    ++LP
Sbjct: 3385 VDINAPDVEV---QGKVKGSKFKMPFLSISSPKVSMPDVELNLKSPKVKGDLDIAGPNLEGDFKGPKVDIKAPEVNLNAPDVDVHGPDWNLKMPKMKMPKFSVSGLKAEGPDVAVDLPKGDINIEGPSMNIEGPDLNVEGPEGGLKGP---KFKMPDMNIKAPKISMPDIDLNLKGPKVKGDVDISLP-----KLEGDLKGP--EVD--IKGPKVDINAPDVDVH--GPDWHLKMPKVKMPKFSMPGFKGEGPEVDVTLP----------------KADIDISGPNVDVDVP---------------DVNIEGPDAK--LKGPKFKMPEMNIKAPKISMPDFDLNLKGPKMKGDVVVSLP 3694          

HSP 11 Score: 63.5438 bits (153), Expect = 3.307e-10
Identity = 74/226 (32.74%), Postives = 117/226 (51.77%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGP-----EVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE---IDGKK---KKHGI--NIGLPSMKGLKFEG---KGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKP 711
            D  +PK EG LK PK  +DV APD+++   D + K PK ++       L  + P  D++  K ++DI            +D N PD  L   EGKLK PK ++ ++  R P     +VD+D+ G + KGNVD++   P +E ++  PD+DI    +D K    +  G+  ++ +P MK  KF     KG+ P+ +V+L    P  D+ + G K  I   D+S++ P
Sbjct:  965 DMTVPKLEGDLKGPK--VDVSAPDVEMQGPDWNLKMPKIKMPKFSMPSLKGEGPEFDVNLSKANVDISA--------PKVDTNAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPKMKGNVDIS--APKIEGEMQVPDVDIRGPKVDIKAPDVEGQGLDWSLKIPKMKMPKFSMPSLKGEGPEVDVNL----PKADVVVSGPKVDIEAPDVSLEGP 1174          

HSP 12 Score: 62.3882 bits (150), Expect = 7.819e-10
Identity = 109/387 (28.17%), Postives = 172/387 (44.44%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKP----KGA-LDVEAPDIDV---DIHGKKPKGEI-------------DLNVKNPNVDIDFHKPDIDIEV---DIDGKKKK-HGLDFNLPDW---------------------------KLPKFEGKLKKPKGELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI---DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            D  LPK EG LK P    KG  +D+ APD+DV   D H K PK ++             +++V  P  DID   P++D++V   +I+G   K  G  F +P+                             LPK EG LK P    ++DI+GP+VD+D     I G+  K      F  P++ +    I+ PD+D+ + G K K  +++ LP M     EG  K P  EVD  +K P +DI   D+D     + G D  +  P   +        K +   +D+NLP                + DLD++ P++D D                 DVN+E P+    ++G K K  ++++    +S+P++D+++ G K K    ++LP
Sbjct: 3562 DISLPKLEGDLKGPEVDIKGPKVDINAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVTLPKADIDISGPNVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLNLKGPKMKGDVVVSLPKVEGDLKGP----EVDIKGPKVDIDTPDINIEGSEGKFK-GPKFKIPEMHLKAPKISMPDIDLNLKGPKVKGDVDVSLPKM-----EGDLKGP--EVD--IKGPKVDINAPDVD-----VQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLP----------------KADLDVSGPKVDIDVP---------------DVNIEGPEGK--LKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLP 3896          

HSP 13 Score: 62.003 bits (149), Expect = 9.172e-10
Identity = 96/357 (26.89%), Postives = 151/357 (42.30%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEV-DIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTF-----NKPDLEID----------------------ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI---DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLD----------INTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVD 1020
            + +PD  +   EGKLK PK         A  +  PD+D+ + G K KGE D+ V  P ++ D   P +D+   D++      G D+NL  P  K+PKF   +   KGE      GPE DV    N +K NVD++      N PDL ++                      ++ PD+D+++ G K K  ++I  P     K EG+ + P    D+ ++ P +DI   D++G+      D S+  P   +      S K +   +D+NLP         K       V L+             PE+ F                     + +PD  + ++G K KGD+DV  S+P+V+
Sbjct:  915 VEVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDMTV--PKLEGDLKGPKVDVSAPDVE----MQGPDWNLKMPKIKMPKFS--MPSLKGE------GPEFDV----NLSKANVDISAPKVDTNAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPKMKGNVDISAP-----KIEGEMQVP----DVDIRGPKVDIKAPDVEGQGL----DWSLKIPKMKMPKFSMPSLKGEGPEVDVNLPKADVVVSGPKVDIEAPDVSLEGPEGKLKGPKFKMPEMHFKTP-----------------KISMPDVDLHLKGPKVKGDVDV--SVPKVE 1221          

HSP 14 Score: 62.003 bits (149), Expect = 9.172e-10
Identity = 80/236 (33.90%), Postives = 120/236 (50.85%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDW--KLPKFE-GKLKKP--KGE----------LDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPS----MKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG 690
            +DI++PD  +   EGKLK PK         A  +  PDID+++ G K KG++D+++  P V+ D   PD+DI   +VDI+       +D   PDW  K+PK +  K+  P  KGE           D+D+ GP+VDVD     I G  AK      F  P++ I    I+ PD+D+ + G K K  +++ L +    +KG   + KG  PK +VD      + DIDI G   ++ G
Sbjct: 3058 VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSL--PKVEGDMKVPDVDIKGPKVDINAPD----VDVQGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLPKADLDVSGPKVDVDVPDVNIEGPDAKLK-GPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSLANVEGDLKGPALDIKG--PKIDVD------APDIDIHGPDAKLKG 3278          

HSP 15 Score: 62.003 bits (149), Expect = 1.115e-9
Identity = 101/360 (28.06%), Postives = 165/360 (45.83%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKGE--------LDIDIRGPEVDVDIHGNRAKGNV----DVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI---DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DI  PD  L   EGKLK PK     +  + P I   DVD+H K PK + D++V  P V+ +   PD++I   ++DID    +  G D++L  P  K+PKF     K +G          DID+ GP+VDV++     +G         F  P++      I+ PD+D+ + G K K  +++ LP +     EG+ K P    D+ +K P +DI   D+D     + G D  +  P   +        K +   +D+ LP                + D+D++ P++D +                 DVN+E PDA   ++G K K  ++ +    +SIP+V + + G K K  + + +P
Sbjct: 1162 VDIEAPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDVDVSVPKVEGEMKVPDVEIKGPKMDIDAPDVEVQGPDWHLKMPKMKMPKFSMPGFKGEGREVDVNLPKADIDVSGPKVDVEVPDVSLEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLNLKGPKLKGDVDVSLPEV-----EGEMKVP----DVDIKGPKVDISAPDVD-----VHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVKLP----------------KADVDVSGPKMDAEVP---------------DVNIEGPDAK--LKGPKFKMPEMSIKPQKISIPDVGLHLKGPKMKGDYDVTVP 1474          

HSP 16 Score: 61.2326 bits (147), Expect = 1.830e-9
Identity = 92/332 (27.71%), Postives = 154/332 (46.39%), Query Frame = 1
Query:  103 INLPDWKLPKFEGK-----LKKPKGALDVEAPDIDVDI---HGKKPKGEI-DLNVKNPNVDIDFHKPDI-DIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV-----DIHGNRAKGNVDVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            + +P + +P F+G+     +  PK  L V  P +D+D+   + + P+G++     K P+++I  HK  + D+ +++   K K  +D +LP     K EG LK P    +ID++ P++DV     DI G   K      F  P++      I+ PD+D+ + G K K  +++ +P     K EG+ K P    D+ +K P +DID  D + H    D  +  P   +        K +   +D+NLP                  DLDI  PE    G+  K    N          V +PD  ++++G K KG+ID   S+PE++ D+ G +
Sbjct: 1513 VKMPKFSMPGFKGEGPEVDMNLPKADLGVSGPKVDIDVPDVNLEAPEGKLKGPKFKMPSMNIQTHKISMPDVGLNLKAPKLKTDVDVSLP-----KVEGDLKGP----EIDVKAPKMDVNVGDIDIEGPEGKLK-GPKFKMPEMHFKAPKISMPDVDLHLKGPKVKGDMDVSVP-----KVEGEMKVP----DVDIKGPKVDIDAPDVEVH--DPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPSVDTD--APDLDIEGPEGKLKGSKFKMPKLNIKAP-----KVSMPDVDLNLKGPKLKGEIDA--SVPELEGDLRGPQ 1814          

HSP 17 Score: 60.4622 bits (145), Expect = 3.339e-9
Identity = 108/355 (30.42%), Postives = 168/355 (47.32%), Query Frame = 1
Query:   97 LDINLPDWKL--PKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEV---DVDIH--GNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP--SMKGLKF---EGKGKKPK---SEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGID--INLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD----IDVH-----LSIPEVDIDVDGKKKKHGFGINLP 1071
            +D+  PD KL  PKF   E   K PK ++       DVD+H K PK + D +V  P ++ D   P + +EV               PD +L   + KLK PK ++ D+  + P++   DVD+H  G + KG+VDV+   P LE D+T P + +E+        + +  P   +KG KF   E   K PK    +VDL +K P +  D+D    ++ G++ V   D         +     HG D  + +P  K PKFS    K++G  ++D+N P+ D   +  K             V+VEVPD S++    K KG      ++H     +S+P+VD+ + G K K    ++LP
Sbjct: 1829 VDLECPDAKLKGPKFKMPEMHFKAPKISMP------DVDLHLKGPKVKGDADVSVPKLEGDLTGPSVGVEV---------------PDVELECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDVDVSV--PKLEGDLTGPSVGVEV------PDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKAEGP-EVDVNLPKADVVVSGPK-------------VDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSLP 2140          

HSP 18 Score: 60.077 bits (144), Expect = 4.353e-9
Identity = 70/215 (32.56%), Postives = 109/215 (50.70%), Query Frame = 1
Query:  118 WKLPKFEGK---LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKK-HGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKS-EVDLGVKTPSIDIDIDGKKHRISG-DLSVDKP 711
            WK PKF+      K PK    +  PD+D+ +   K KGE+D++V  P ++ D   P +D+   ++DI+G + K  G  F +PD          K P      +I  P+VD+++ G + KG+VDV+   P++E  +  PDM+I   G K        +    ++ +P MK  KF   G K +  EVD  V  P  D+DI G K  I G D++++ P
Sbjct: 2369 WKTPKFKMPDMHFKAPK----ISMPDLDLHLKSPKAKGEVDVDV--PKLEGDLKGPHVDVSGPDIDIEGPEGKLKGPKFKMPDMHF-------KAP------NISMPDVDLNLKGPKIKGDVDVSV--PEVEGKLEVPDMNIR--GPKVDVNAPDVQAPDWHLKMPKMKMPKFSMPGFKAEGPEVD--VNLPKADVDISGPKVDIEGPDVNIEGP 2558          

HSP 19 Score: 59.6918 bits (143), Expect = 4.882e-9
Identity = 67/192 (34.90%), Postives = 100/192 (52.08%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEV-----DVDIHG--NRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKG 582
            +D+N+ D  +   EGKLK PK     +  +AP I   DVD+H K PK + D++V  P V+ +   PD+DI   +VDID    + H  D++L  P  K+PKF     K +G        + DID+ GP V     D+DI G   + KG+    F  P L I    ++ PD+D+ + G K K  I+  +P ++G
Sbjct: 1620 MDVNVGDIDIEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKVDIDAPDVEVHDPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPSVDTDAPDLDIEGPEGKLKGS---KFKMPKLNIKAPKVSMPDVDLNLKGPKLKGEIDASVPELEG 1808          

HSP 20 Score: 58.151 bits (139), Expect = 1.679e-8
Identity = 97/367 (26.43%), Postives = 154/367 (41.96%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD--------VEAPDIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV---DIHGNRAKGNV-DVTFNKPDLEIDITK---PDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKG------DIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            +++  PD  L    GKLK P   L         +  PD+D+ + G K KGE D+ V       K P VDID   PD+D+          HG D++L  P  K+PKF     K +G        + D+DI GP++DV   D+     +G +    F  P++ I + K   PD+D+ + G   K   ++ +P     K E + K P  E+       S  +DID     + G D  +  P   +        K +   +D+NLP                + D+DI+ P+                      V VEVPD +I+    K KG      ++++    +S+P+VD+ + G K K  + + +P
Sbjct:  664 VNVEAPDVNLEGLGGKLKGPDVKLPDMSVKTPKISMPDVDLHVKGTKVKGEYDVTVPKLEGELKGPKVDID--APDVDV----------HGPDWHLKMPKMKMPKFSVPGFKAEGPEVDVNLPKADVDISGPKIDVTAPDVSIEEPEGKLKGPKFKMPEMNIKVPKISMPDVDLHLKGPNVKGEYDVTMP-----KVESEIKVPDVELK------SAKMDIDVPDVEVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLP----------------KADVDISGPK----------------------VGVEVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDMTVP 969          

HSP 21 Score: 58.151 bits (139), Expect = 1.950e-8
Identity = 101/364 (27.75%), Postives = 167/364 (45.88%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDW--KLPKFEGKLKKPKGEL-DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK-KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG--------DLSVDKPXXXXXXXXXVSNKKKKHGI-------DINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDVH---LSIPEVDIDVDGKKKKHGFGINLP 1071
            +D++ PD  +   EGKLK PK         A ++  PD+D+++ G K KG++D++V  P V+     PD++I    VD++        D   PDW  K+PK    +K PK  +      GPEVDV    N  K +VD++  K    +DI  PD++IE     + G K K   +NI  P +    F+   K PK + D+ V  P ++ D+ G +  I G        D+ V  PD  + +      K    G        D+ LP                + D+D++ P++D +G                DVN+E P+  +  +G K K  ++++    +S+P++D+++ G K K    ++LP
Sbjct: 2420 VDVSGPDIDIEGPEGKLKGPKFKMPDMHFKAPNISMPDVDLNLKGPKIKGDVDVSV--PEVEGKLEVPDMNIRGPKVDVNAP------DVQAPDWHLKMPK----MKMPKFSMPGFKAEGPEVDV----NLPKADVDISGPK----VDIEGPDVNIEGPEGKLKGPKLKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDINAPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDGDVKLP----------------KADIDVSGPKVDIEGP---------------DVNIEGPEGKL--KGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLP 2730          

HSP 22 Score: 58.151 bits (139), Expect = 1.967e-8
Identity = 86/260 (33.08%), Postives = 126/260 (48.46%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG 690
            DVNL K +IDV   K                 +D+++PD  +   + KLK PK         A  +  PDID+++ G K KG++D+ +  P V+ D   P+ DI   +VDI+      HG D++L  P  K+PKF     K +G        + DID+ GP+VDVD     I G  AK      F  P++ I    I+ PD+D+++ G K K   ++ +P     K EG  K P  EVDL  K P   +D +G   ++SG
Sbjct: 4673 DVNLPKADIDVSGPK-----------------VDVDVPDVNIEGPDAKLKGPKFKMPEMSIKAPKISMPDIDLNLKGPKVKGDVDVTL--PKVEGDLKGPEADIKGPKVDINTPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVSLPKADIDVSGPKVDVDIPDVNIEGPDAKLK-GPKFKMPEINIKAPKISIPDVDLDLKGPKVKGDFDVSVP-----KVEGTLKGP--EVDL--KGPR--LDFEGPDAKLSG 4901          

HSP 23 Score: 57.3806 bits (137), Expect = 2.898e-8
Identity = 81/267 (30.34%), Postives = 125/267 (46.82%), Query Frame = 1
Query:   97 LDINLPDWKL--PKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKF----------------------------------------EGKLKKPKGEL-DIDIRGPEV---DVDIH--GNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP--SMKGLKF---EGKGKKPK---SEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +++  PD KL  PKF   E   K PK ++       DVD+H K PK + D++V  P V+ +   PD+DI   ++DID      HG D++L  P  K+PKF                                        EGKLK PK ++ ++  + P++   DVD+H  G + KG+VDV+   P LE D+T P +D+E+        + +  P   +KG KF   E   K PK    +V+L +K P +  D+D    ++ G++ V
Sbjct: 1963 VELECPDAKLKGPKFKMPEMHFKTPKISMP------DVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVVVSGPKVDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSL--PKLEGDLTGPSVDVEV------PDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVNLNLKGPKVKGDMDVSVPKVEGEMKV 2215          

HSP 24 Score: 56.225 bits (134), Expect = 6.984e-8
Identity = 101/367 (27.52%), Postives = 173/367 (47.14%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVDI----------HGKKPKGEI------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGP-----EVDVDIHGNRAKGNVDVTFNK-------PDLEI-----DITKPDMDIE-IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV-----DLGVKTPSIDID-----IDGKKHRISG------DLSVDKPXXXXXXX-XXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDVHL---SIPEVDIDVDGKKKK 1047
            D  LPK EG LK P+  +D+  P +D+D+          H K PK ++          + P+VD++  K D+D+     G K    +D ++PD  +   EGKLK PK ++ +++I+ P     ++D+++ G + KG++DV+  K       PD++I     DI  PD+D++  D   K   I +   SM G K EG    P+ +V     DL V  P +D+D     I+G   ++ G      ++++  P   +    +++   K K  +D++L N +                LDI  P+ID D                 D+++  PDA +  +G K K  D+ V++   S+PE+D+++ G K K
Sbjct: 2982 DISLPKVEGDLKGPE--VDIRGPQVDIDVPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVS----GPK----VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMKVPDVDIKGPKVDINAPDVDVQGPDWHLKMPKIKMPKISMPGFKGEG----PEVDVNLPKADLDVSGPKVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSLANVEGDLKGPA---------LDIKGPKIDVDAP---------------DIDIHGPDAKL--KGPKLKMPDMHVNMPKISMPEIDLNLKGSKLK 3308          

HSP 25 Score: 56.225 bits (134), Expect = 7.898e-8
Identity = 92/367 (25.07%), Postives = 152/367 (41.42%), Query Frame = 1
Query:  103 INLPDWKLPKFEGK-----LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDID---FHKPDIDI--------EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKK--KKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEID----------------------------FXXXXXXXXXXXXXXXXXIDVNVEVPDAS--IDIQGKKHKGDIDVHLSIPEVDIDVDGKKKK 1047
            + +P + +P F+G+     +  PK  +DV  P +DVDI         D+N++ P+  +    F  P+I+I        +VD+D K  K   DF   D  +PK EG LK P    ++D++GP +D +    +  G    +   P LEI    +T PD+D+ +   K    I    P ++G + + KG K        V+ PS+D+ +D     I G D+ + K           S K   K   +D+ +P                + +L++ TPEI                             FD N    +     K   +DVN+  PDA+  +D++  K K  +   +  P+V+ D+   K K
Sbjct: 4783 VKMPKFSMPGFKGEGPDVDVSLPKADIDVSGPKVDVDIP--------DVNIEGPDAKLKGPKFKMPEINIKAPKISIPDVDLDLKGPKVKGDF---DVSVPKVEGTLKGP----EVDLKGPRLDFEGPDAKLSGP---SLKMPSLEISAPKVTAPDVDLHLKAPK----IGFSGPKLEGGEVDLKGPK--------VEAPSLDVHMDSPDINIEGPDVKIPKFKKPKFGFGAKSPKADIKSPSLDVTVP----------------EAELNLETPEISVGGKGKKSKFKMPKIHMSGPKIKAKKQGFDLNVPGGEIDASLKAPDVDVNIAGPDAALKVDVKSPKTKKTMFGKMYFPDVEFDIKSPKFK 5103          

HSP 26 Score: 54.299 bits (129), Expect = 3.187e-7
Identity = 96/365 (26.30%), Postives = 165/365 (45.21%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALD---VEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKL--PKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNK-------PDLEI-----DITKPDMDIEIDGKKKKHG--INIGLPSMKGLKFEGKGKKPKS--------EVDLGVKTPSIDIDI-----DGKKHRISG------DLSVDKPXXXXX-XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEV-------DIDVDGKK 1041
            + +PD +L   + KLK PK  +     +AP I   DVD+H K PK + D++V  P ++ D   P + +EV          ++   PD KL  PKF   E   K PK      I  P+VD+ + G + KG++DV+  K       PD++I     DI  PD+D+        HG   ++ +P MK  KF   G K +         + D+ V  P +D+++     +G + ++ G      ++    P   +  +D+ +   K K  +D++LP  +              VD+++   E++      K       +       + +PD +++++G K KGD+DV  S+P+V       D+D+ G K
Sbjct: 1891 VEVPDVELECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDVDVSVPKLEGDLTGPSVGVEV--------PDVELECPDAKLKGPKFKMPEMHFKTPK------ISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDV--------HGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVVVSGPKVDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSLPKLEGDLTGP-------SVDVEVPDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVNLNLKGPKVKGDMDV--SVPKVEGEMKVPDVDIRGPK 2224          

HSP 27 Score: 52.373 bits (124), Expect = 1.316e-6
Identity = 48/173 (27.75%), Postives = 87/173 (50.29%), Query Frame = 1
Query:  214 PKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGL--DFNLP----DWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDL---EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI---DIDIDGKKHRISGDL 696
            P GEID ++K P+VD++   PD  ++VD+   K K  +      P    D K PKF+ +   P  +L+ +++ P++++ +     +G +D+    P +   ++DI+ P   IE D K  K   N+G P +     + K K P      G+  P +   D++++ K  +I GD+
Sbjct: 5047 PGGEIDASLKAPDVDVNIAGPDAALKVDVKSPKTKKTMFGKMYFPDVEFDIKSPKFKAEAPLPSPKLEGELQAPDLELSLPAIHVEG-LDIKAKAPKVKMPDVDISVP--KIEGDLKGPKVQANLGAPDINIEGLDAKVKTP----SFGISAPQVSIPDVNVNLKGPKIKGDV 5212          

HSP 28 Score: 51.2174 bits (121), Expect = 2.940e-6
Identity = 69/227 (30.40%), Postives = 115/227 (50.66%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV---DIHGNRAKGNV-DVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKG-LKF-EGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG 690
            +D  +PD  +   + KLK PK     + ++   I   DV +H K PK + D +V  P V+ +   PD+DI   +VDI+    + HG D++L  P  K+PKF     K +G        + D+ + GP+VD+   D++    +G +    F  P + I    I+ PD+ + +   K K  +++ LP ++G LK  E   K PK +V++G      DIDI+G + ++ G
Sbjct: 1418 MDAEVPDVNIEGPDAKLKGPKFKMPEMSIKPQKISIPDVGLHLKGPKMKGDYDVTVPKVEGEIKAPDVDIKGPKVDINAPDVEVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDMNLPKADLGVSGPKVDIDVPDVNLEAPEGKLKGPKFKMPSMNIQTHKISMPDVGLNLKAPKLKTDVDVSLPKVEGDLKGPEIDVKAPKMDVNVG------DIDIEGPEGKLKG 1638          

HSP 29 Score: 50.8322 bits (120), Expect = 3.440e-6
Identity = 102/371 (27.49%), Postives = 166/371 (44.74%), Query Frame = 1
Query:   97 LDINLPDW-------KLPKFEGKLKKPKGA-LDVEAPDIDVDIHGKKPKGEI-DLNVKNPNVDID---FHKPDIDI--------EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----VDIHG---NRAKGNVDVT-FNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRIS-GDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGK--KHKGD----IDVH-----LSIPEVDIDVDGKKKKHGFGINLP 1071
            +D++ PDW       K+PKF     K +G  +DV+ P  DVD+ G K   E+ D+N++ P+  +    F  P++ I        +V +  K  K   D+   D  +PK EG++K P    D+DI+GP+VD     V++HG   +     V +  F+ P       E+D+  P  D+ + G K    ++I +P +     EGK K PK       K PS++I    + H+IS  D+ ++           +   K K  +D++LP                +V+ D+  PEID                  +DVNV      IDI+G   K KG      ++H     +S+P+VD+ + G K K    +++P
Sbjct: 1371 VDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVKLPKADVDVSGPKMDAEVPDVNIEGPDAKLKGPKFKMPEMSIKPQKISIPDVGLHLKGPKMKGDY---DVTVPKVEGEIKAP----DVDIKGPKVDINAPDVEVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDMNLPKADLGVSGPK----VDIDVPDVNLEAPEGKLKGPK------FKMPSMNI----QTHKISMPDVGLN-----------LKAPKLKTDVDVSLP----------------KVEGDLKGPEIDVKAPK-------------MDVNV----GDIDIEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLHLKGPKVKGDMDVSVP 1676          

HSP 30 Score: 50.8322 bits (120), Expect = 3.688e-6
Identity = 57/209 (27.27%), Postives = 91/209 (43.54%), Query Frame = 1
Query:  103 INLPDWKLPKF------EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGP--EVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEI-DGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            I  P  K+PKF      EG+   PK  L V AP++ V   G KP     L ++ P                         L+ ++P   +   EGKLK P+      I GP  E D+ + G + +G++ V  + P +   IT P ++++  D   +  G  + +P MK  KF   G K   E  + V  P+ ++ + G    +SGD+S+
Sbjct:  304 IKFPTMKVPKFGVSTGREGQT--PKAGLRVSAPEVSVGHKGGKP----GLTIQAPQ------------------------LEVSVPSANIEGLEGKLKGPQ------ITGPSLEGDLGLKGAKPQGHIGVDASAPQIGGSITGPSVEVQAPDIDVQGPGSKLNVPKMKVPKFSVSGAK-GEETGIDVTLPTGEVTVPG----VSGDVSL 471          

HSP 31 Score: 50.0618 bits (118), Expect = 5.856e-6
Identity = 112/424 (26.42%), Postives = 176/424 (41.51%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKP----KGA-LDVEAPDIDV---DIHGKKPK---------------GEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKK-HGLDFNLPDWKL-------PKFEGKLKKPKGELDIDI---------RGPEVDV-------------------------------DIHGNRAKG-NVDVTFNKPDLE-----IDITKPDMDIE-----IDGKK-KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG---------------DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            D  LPK EG LK P    KG  +D++APD+DV   D H K PK                E+D+N+  P  DID   P +DI+   +DI G + K  G  F +PD  L       P+ +  LK PK + D+D+         +GPEVD+                                + G + +G +VDV   K DL+     +DI  PD++IE     + G K K   +NI  P +    F+   K PK + D+ V  P ++ D+ G +  I G               D  +  P   +        K +   +D+ LP                + D++I+ P++D D                 DV++E PDA   ++G K K  ++++    +S+P++D ++ G K K    ++LP
Sbjct: 4020 DVSLPKMEGDLKAPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNL--PKADIDVSGPKVDIDTPDIDIHGPEGKLKGPKFKMPDLHLKAPKISMPEVDLNLKGPKMKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDVPDVDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVTLP----------------KADIEISGPKVDIDAP---------------DVSIEGPDAK--LKGPKFKMPEMNIKAPKISMPDIDFNLKGPKVKGDVDVSLP 4408          
BLAST of SMED30001359 vs. Ensembl Human
Match: AHNAK2 (AHNAK nucleoprotein 2 [Source:HGNC Symbol;Acc:HGNC:20125])

HSP 1 Score: 67.0106 bits (162), Expect = 2.391e-11
Identity = 62/245 (25.31%), Postives = 114/245 (46.53%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDI------------EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNV---DVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKH-----RISGDLSV 702
            + +P +K+PK +  LK P+  +D++ P +D+ +    PK E+   D+ V  P+V++D   P   +            E D+  K  K    F +P +K+P F         E  +D+  P+V+ D+  +  +G++   D++   P  ++++    +D+E+           K H   + +PS+K  K + KG            K PK+EV   D+ V  PS+++D+   K      R+ GDLS+
Sbjct: 3394 VEMPSFKMPKVD--LKSPQ--VDIKGPKLDLKV----PKAEVTVPDVEVSLPSVEVDVQAPRAKLDGARLEGDLSLAEKDVTAKDSK----FKMPKFKMPSFGVSAPGRSIEASLDVSAPKVEADVSLSSMQGDLKATDLSIQPPSADLEVQAVQVDVELLEGPVPEGAGLKGHLPKVEMPSLKTPKVDLKGPQIDVKGPKLDLKGPKAEVRVPDVEVSLPSVEVDVQAPKAKLDAGRLEGDLSL 3626          

HSP 2 Score: 58.9214 bits (141), Expect = 1.080e-8
Identity = 61/245 (24.90%), Postives = 111/245 (45.31%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEV------------DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEI-DGK------KKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKHR-----ISGDLSV 702
            + +P  K PK +  LK P+  +DV+ P +D+    K PK E+   D+ V  P+V++D   P   ++             D+  K  K    F +P +K+P F         E  +D+  P+V+ D+     +G     D++   P  ++ +    MD+++ +G+       K+H   + +PS+K  K + KG            K  K+EV   D+ V  PS+++D+   + +     + GDLS+
Sbjct: 3559 VEMPSLKTPKVD--LKGPQ--IDVKGPKLDL----KGPKAEVRVPDVEVSLPSVEVDVQAPKAKLDAGRLEGDLSLADKDVTAKDSK----FKMPKFKMPSFRVSAPGKSMEASVDVSAPKVEADVSLPSMQGDLKTTDLSIQPPSADLKVQAGQMDVKLPEGQVPEGAGLKEHLPKVEMPSLKMPKVDLKGPQVDIKGPKLDLKVSKAEVTAPDVEVSLPSVEVDVQAPRAKLDSAQLEGDLSL 3791          

HSP 3 Score: 58.5362 bits (140), Expect = 1.179e-8
Identity = 63/245 (25.71%), Postives = 108/245 (44.08%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEV------------DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVT-----FNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKK-----HRISGDLSV 702
            + +P  K+PK    LK P+  +DV+ P +D+    K PK E+   D+ V  P+V++D   P   ++             D+  K  K    F +P +K+P F         E  +D+  P+V+ ++     +G++  T         DL     ++D+  P+  +      K H   + +PS K  K + KG            K PK+EV   D+ V  PS+++D+  +K      R+ GDLS+
Sbjct: 1744 VQMPSLKMPKV--ALKGPQ--MDVKGPKLDL----KGPKAEVMAPDVEVSLPSVEVDVEAPGAKLDSVRLEGDLSLADKDVTAKDSK----FKMPKFKMPSFGVSAPGKSIEASVDVSAPKVEAEVSLPSMQGDLKTTDLCIPLPSADLVVQAGQVDMKLPEGQVPEGAGLKGHLPKVDMPSFKMPKVDLKGPQTDVKGAKLDLKGPKAEVTAPDVEVSLPSMEVDVQAQKAKLDGARLEGDLSL 1976          

HSP 4 Score: 58.151 bits (139), Expect = 1.693e-8
Identity = 83/345 (24.06%), Postives = 154/345 (44.64%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLD------------FNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDID--GKK---HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHL 1002
            + +P +K+PK +  LK P+  +DV+ P +D+    K PK E+   D+ V  P+V++D   P       +DG + +  L             F +P +K+P F         E+ +D+  P+V+ ++     +G     D++   P  ++++    +D+++           K H   + +PS K  K + KG            K PK++V   D+ V  P +++D++  G K    R+ GDLS+         D DV+ K  K      +P +K P F   +     +V +D++ P+++    A  S    +      D+++E P A +++Q     G +DV L
Sbjct: 2899 VQMPSFKMPKVD--LKGPQ--IDVKGPKLDL----KGPKAEVTAPDVEVSLPSVEVDVEAP----RAKLDGARLEGDLSLADKDVTAKDSKFKMPKFKMPSFGVSAPGKSIEVSVDVSAPKVEAEVSLPSMQGDLKTTDISIEPPSAQLEVQAGQVDLKLPEGHVPEGAGLKGHLPKLQMPSFKMPKVDRKGPQIDVKGPKLDLKGPKTDVTAPDVEVSQPGMEVDVEAPGAKLDGARLEGDLSL--------ADKDVTAKDSK----FKMPKFKMPSFGVSAPGKSIEVLVDVSAPKVE----ADLSLPSMQGDLKNTDISIEPPSAQLEVQA----GQVDVKL 3211          

HSP 5 Score: 57.7658 bits (138), Expect = 2.494e-8
Identity = 55/215 (25.58%), Postives = 110/215 (51.16%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKL--KKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL---DIDIRGPEVDVDIHGNRAKGNV-DVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP--SMKGLKFEGKGKKPKSEV-DLGVKTP--SIDIDIDGKKHRISGDLSVD 705
              +P +K+P +      K  + ++DV AP  + D+     +G++   DL+++ P+VD++     +D+++      +  GL  +LP  ++P F    K PK +L    +DI+GP++D+ +   +A+  V DV  + P +E+D+  P    ++DG + +  +++     + K  KF    K PK ++   GV  P  SI+  +D    ++  D+S+ 
Sbjct: 3308 FKMPKFKMPSYRASAPGKSIQASVDVSAPKAEADVSLPSMQGDLKTTDLSIQLPSVDLEVQAGQVDVKLPEGHVPEGAGLKGHLPKVEMPSF----KMPKVDLKSPQVDIKGPKLDLKV--PKAEVTVPDVEVSLPSVEVDVQAP--RAKLDGARLEGDLSLAEKDVTAKDSKF----KMPKFKMPSFGVSAPGRSIEASLDVSAPKVEADVSLS 3510          

HSP 6 Score: 57.3806 bits (137), Expect = 3.277e-8
Identity = 58/245 (23.67%), Postives = 109/245 (44.49%), Query Frame = 1
Query:  103 INLPDWKLPKFEGK------------LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEV---DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKK-----HRISGDLSV 702
            + +P +K+PK + K            LK PK  +DV APD++V     +P  E+D  V+ P   +D  + + D+ +   D+  K  K    F +P +K+P +         +  +D+  P+ + D+     +G     D++   P +++++    +D+++           K H   + +PS K  K + K             K PK+EV   D+ V  PS+++D+   +      R+ GDLS+
Sbjct: 3229 LQMPSFKMPKVDRKGPQIDIKGPKLDLKGPK--MDVTAPDVEVS----QPSMEVD--VEAPGAKLDGARLEGDLSLADKDVTAKDSK----FKMPKFKMPSYRASAPGKSIQASVDVSAPKAEADVSLPSMQGDLKTTDLSIQLPSVDLEVQAGQVDVKLPEGHVPEGAGLKGHLPKVEMPSFKMPKVDLKSPQVDIKGPKLDLKVPKAEVTVPDVEVSLPSVEVDVQAPRAKLDGARLEGDLSL 3461          

HSP 7 Score: 53.9138 bits (128), Expect = 3.299e-7
Identity = 54/236 (22.88%), Postives = 104/236 (44.07%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEV------------DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKHRISG 690
            + +P +K+PK    LK P+  +DV+ P +D+    K PK E+   D+ V  P+V++D   P   ++             D+  K  +    F +P +K+P F         E  +D+  P+V+ D+     +G     D++   P  ++++    +D+++           K H   + +PS+K  K + KG            K  K+EV   ++ V  PS+++D+     ++ G
Sbjct: 1084 VEMPSFKMPKV--ALKGPQ--VDVKGPKLDL----KSPKAEVTAPDVEVSLPSVEVDVEAPGAKLDSARLEGELSLADKDVTAKDSR----FKMPKFKMPSFGASAPGKSIEASVDVSAPKVEADVSLPSMQGDLKTTDLSIQPPSADLEVHAGQVDVKLLEGHVPEGAGFKGHLPKVQMPSLKMPKVDLKGPQVEVRGPKLDLKGHKAEVTAHEVAVSLPSVEVDMQAPGAKLDG 1307          

HSP 8 Score: 53.5286 bits (127), Expect = 5.388e-7
Identity = 60/251 (23.90%), Postives = 108/251 (43.03%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEV---DIDGKKKKHGLD------------FNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK----------------KKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKH-----RISGDLSV 702
            + +P +K+PK +  LK P+  +DV+ P +D+    K PK    + V  P+V +     ++D++     +DG + +  L             F +P +K+P F         E  +D+  P+V+ D+     +G++  T      ++ I  P  D+E+   +                K H   + +PS+K  K   KG            K PK+EV   D+ V  PS+++D++         R+ GDLS+
Sbjct: 1579 VQMPSFKMPKVD--LKGPQ--IDVKGPKLDL----KGPK----VEVTAPDVKMSLSSMEVDVQAPRAKLDGAQLEGDLSLADKAVTAKDSKFKMPKFKMPSFGVSAPGKSIEASVDVSEPKVEADVSLPSMQGDLKTT------DLSIQSPSADLEVQAGQVNVKLPEGPLPEGAGFKGHLPKVQMPSLKMPKVALKGPQMDVKGPKLDLKGPKAEVMAPDVEVSLPSVEVDVEAPGAKLDSVRLEGDLSL 1811          

HSP 9 Score: 53.5286 bits (127), Expect = 5.388e-7
Identity = 82/348 (23.56%), Postives = 152/348 (43.68%), Query Frame = 1
Query:   94 GLDINLPDWKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEI------------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKK-----HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHL 1002
            GL  +LP  ++P F   E  LK P+  +DV+ P++D+    K PK E+            +++V+ P   +D  + + D+ +   G   K    F +P +K+P F         E  +D+   +V+ D      +G     D+    P  ++++    +D+++           K H   + +PS K  K + KG            K PK+EV   D+ V  PS+++D++  +      R+ GDLS+         D DV+ K  K      +P +K P F   +     +V +D++ P+++    A+ S    +      D+++E P A +++Q     G +D+ L
Sbjct: 2726 GLKGHLPKLQMPSFKMPEVDLKGPQ--IDVKGPNVDL----KGPKAEVTAPDVKMSLSSMEVDVQAPRAKLDGARLEGDLSLADKGMTAKDS-KFKMPKFKMPSFGVSAPGKSIEASVDVSELKVEADGSFPSMQGDLKTTDIRIQPPSAQLEVQAGQVDVKLPEGHVPEGAGLKGHLPKVQMPSFKMPKVDLKGPQIDVKGPKLDLKGPKAEVTAPDVEVSLPSVEVDVEAPRAKLDGARLEGDLSL--------ADKDVTAKDSK----FKMPKFKMPSFGVSAPGKSIEVSVDVSAPKVE----AEVSLPSMQGDLKTTDISIEPPSAQLEVQA----GQVDLKL 3046          

HSP 10 Score: 52.7582 bits (125), Expect = 7.920e-7
Identity = 42/148 (28.38%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKG---ALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV-----DIHGNRAKGNV-DVTFNKPDLEIDITKP 510
              +P +K+P F G L   K    ++DV AP ++ D+     +G++   DL ++ P+ D++     +D+++      +  GL  +LP  ++P F    K PK    +D++GP+VDV     D+ G +A+    DV  + P +E D+  P
Sbjct: 4463 FKMPKFKMPSF-GMLSPGKSIEVSVDVSAPKMEADMSIPSMQGDLKTTDLRIQAPSADLEVQAGQVDLKLPEGHMPEVAGLKGHLPKVEMPSF----KMPK----VDLKGPQVDVKGPKLDLKGPKAEVMAPDVEVSLPSVETDVQAP 4601          

HSP 11 Score: 52.7582 bits (125), Expect = 8.347e-7
Identity = 57/245 (23.27%), Postives = 111/245 (45.31%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLD------------FNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNV---DVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKHR-----ISGDLSV 702
            + +P +K+PK +  LK P+  +D++ P +D+    K PK E+   D+ V  P+V++D   P       +DG + +  L             F +P +K+P F         E  +D+  P+V+ D+     +G++   D++   P  ++++    +D+++           K H   + +PS K  K + KG            K PK+EV   D+ +   S+++D+   + +     + GDLS+
Sbjct: 3889 VQMPSFKMPKVD--LKGPE--IDIKGPKLDL----KDPKVEVTAPDVEVSLPSVEVDVEAPG----AKLDGARLEGDLSLADKDMTAKDSKFKMPKFKMPSFGVSAPGKSMEASVDVTAPKVEADVSLPSMQGDLKATDLSVQPPSADLEVQAGQVDVKLPEGPVPEGASLKGHLPKVQMPSFKMPKVDLKGPQIDVKGPKLDLKGPKAEVTAPDVKMSLSSMEVDVQAPRAKLDGVQLEGDLSL 4121          

HSP 12 Score: 51.9878 bits (123), Expect = 1.594e-6
Identity = 39/158 (24.68%), Postives = 80/158 (50.63%), Query Frame = 1
Query:  103 INLPDWKLPKF--EGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV-----DIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKK 546
              +P +K+P F      K  + ++DV AP ++ D+     +G++   DL+++ P+ D++     +D+++      +  G   +LP  ++P F    K PK    +D++GP++DV     D+ G +A+         PD E+ +  P M++++  +K K
Sbjct:  833 FKMPKFKMPSFGVSAPGKSMEDSVDVSAPKVEADVSLSSMQGDLKATDLSIQPPSADLEVQAGQVDVKLPEGPVPEGAGPKVHLPKVEMPSF----KMPK----VDLKGPQIDVKGPKLDLKGPKAE------VTAPDGEVSL--PSMEVDVQAQKAK 974          

HSP 13 Score: 51.6026 bits (122), Expect = 2.054e-6
Identity = 59/245 (24.08%), Postives = 114/245 (46.53%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDI---------DIEV---DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNV---DVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPS-------MKGLKFEGKGKK-----PKSEV---DLGVKTPSIDIDIDGKK-----HRISGDLSV 702
            + +P +K+PK +  LK P+  +DV+ P +D+    K PK ++   D+ V  P+V++D   P           D+ V   D+  K  +    F +P +K+P F         E  +D+  P+V+ D   +  +G++   D++   P  ++++    +D+++           K H   + +PS       +KG + + KG K     PK+EV   D+ +   S+++D+   +      R+ GDLS+
Sbjct: 2404 LQMPSFKMPKVD--LKGPQ--IDVKGPKLDL----KGPKTDVMAPDVEVSQPSVEVDVEAPGAKLDGAWLEGDLSVADKDVTTKDSR----FKIPKFKMPSFGVSAPGKSIEASVDVSAPKVEADGSLSSMQGDLKATDLSIQPPSADLEVQAGQVDVKLPEGPVPEGAGLKGHLPKVQMPSFKMPEMDLKGPQLDVKGPKLDLKGPKAEVTAPDVEMSLSSMEVDVQAPRAKLDGARLEGDLSL 2636          

HSP 14 Score: 50.8322 bits (120), Expect = 3.498e-6
Identity = 56/236 (23.73%), Postives = 104/236 (44.07%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKP---------DIDIEV---DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKHRISG 690
            + +P  K+PK +  LK P+  ++V  P +D+  H    K E+   ++ V  P+V++D   P         D D+ +   D+  K  K    F +P +K+P F         E  +D+  P+V+ D+     +G     D++   P  ++++    +D+++           K H   + +PS K  K + KG            K PK EV   D+ V  PS+++D++    ++ G
Sbjct: 1249 VQMPSLKMPKVD--LKGPQ--VEVRGPKLDLKGH----KAEVTAHEVAVSLPSVEVDMQAPGAKLDGAQLDGDLSLADKDVTAKDSK----FKMPKFKMPSFGVSAPGKSIEASVDLSAPKVEADMSLPSMQGDLKTTDLSIQPPSTDLELQAGQLDVKLPEGPVPEGAGLKGHLPKLQMPSFKVPKVDLKGPEIDIKGPKLDLKDPKVEVTAPDVEVSLPSVEVDVEAPGAKLDG 1472          

HSP 15 Score: 50.8322 bits (120), Expect = 3.529e-6
Identity = 52/212 (24.53%), Postives = 106/212 (50.00%), Query Frame = 1
Query:  103 INLPDWKLPKF--EGKLKKPKGALDVEAPDIDVDIHGKKPKGEID---LNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG-NVDVTFNKPDLEIDITKPDMDIEIDGKK---KKHGINIGLPSMKGLKFEGKGKKPKSEV-DLGVKTP--SIDIDIDGKKHRISGDLSV 702
              +P +K+P F      K  + +LDV A  ++ D+     +G++    L+++ P+ D++      D+++      +  GL  +LP  ++P F    K PK    +D++GP++DV++     KG  V+VT   P+L++ +   ++DI+  G K    +   ++ L        + K K PK ++   G+ +P  SI++ +D    ++  D+S+
Sbjct: 4298 FKMPKFKMPSFGVSAPGKSIEASLDVSALKVEADVSLPSMQGDLKTTHLSIQPPSADLEVQAGQEDVKLPEGPVHEGAGLKGHLPKLQMPSF----KVPK----VDLKGPQIDVNVPKLDLKGPKVEVT--SPNLDVSLPSMEVDIQAPGAKLDSTRLEGDLSLADKDVTAKDSKFKMPKFKMPSFGMLSPGKSIEVSVDVSAPKMEADMSI 4499          

HSP 16 Score: 50.447 bits (119), Expect = 4.790e-6
Identity = 57/243 (23.46%), Postives = 107/243 (44.03%), Query Frame = 1
Query:  103 INLPDWKLPKFEGK------------LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI-EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDL-------EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKHR-----ISGDLSV 702
            +++P +K+PK + K            LK PK   +V APD++V +    P  E+D+  +   +D    + D+ + + D+  K  K    F +P +K+P F         E  +D+  P+V+ D+     +G     D++   P         ++D+  P+  +      K H   + +PS+K  K + KG            K PK E+   D+ V  PS+++D+   + +     + GDL++
Sbjct: 1909 VDMPSFKMPKVDLKGPQTDVKGAKLDLKGPKA--EVTAPDVEVSL----PSMEVDVQAQKAKLDGARLEGDLSLADKDMTAKDSK----FKMPKFKMPSFGVSAPGRSIEASVDVPAPKVEADVSLPSMQGDLKTTDLSIQPPSADLKVQTGQVDVKLPEGHVPEGAGLKGHLPKVEMPSLKMPKVDLKGPQVDIKGPKLDLKDPKVEMRVPDVEVSLPSMEVDVQAPRAKLDSAHLQGDLTL 2141          

HSP 17 Score: 49.6766 bits (117), Expect = 8.442e-6
Identity = 61/245 (24.90%), Postives = 107/245 (43.67%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEV------------DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVT-----FNKPDLEIDITKPDMD-----IEIDGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDID--GKK---HRISGDLSV 702
            + +P  K+PK +  LK P+  +D++ P +D+ +     K E+   D+ V  P+V++D   P   ++             D+  K  K    F +P +K+P F         E  + +  P+V+ D+     +G++  T      +  DL +   + DM      +  +   K H   + +PS K  K + KG            K PK EV   D+ V  PS+++D++  G K    R+ GDLS+
Sbjct: 3724 VEMPSLKMPKVD--LKGPQ--VDIKGPKLDLKVS----KAEVTAPDVEVSLPSVEVDVQAPRAKLDSAQLEGDLSLADKDVTAKDSK----FKMPKFKMPSFGVSAPGKSIEASVHVSAPKVEADVSLPSMQGDLKTTDLSIQPHSADLTVQARQVDMKLLEGHVPEEAGLKGHLPKVQMPSFKMPKVDLKGPEIDIKGPKLDLKDPKVEVTAPDVEVSLPSVEVDVEAPGAKLDGARLEGDLSL 3956          
BLAST of SMED30001359 vs. Ensembl Zebrafish
Match: ahnak (AHNAK nucleoprotein [Source:ZFIN;Acc:ZDB-GENE-030131-8719])

HSP 1 Score: 75.8702 bits (185), Expect = 2.314e-14
Identity = 105/344 (30.52%), Postives = 169/344 (49.13%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE---IDGKKKKHGI-NIGLP--SMKGLKFEGKG---KKPKSEV-----DLGVKTPSIDID-----IDGKKHRISGDLSVDKPXXXXX-XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            LDI  P+  +   EGK+K PK  +       +  PD+D ++ G K KG+ D++V  P V+ DF  PD+D+   +VD++G + K    F  P +++P F G           +I  P+VD +I G + KG+VDV+   P ++ DI  P +++E   I+G +    + NI +P    KG K EG     K PKS+      DL +K+P IDI+     + G K +I    S   P   +  +D ++   K K  +D+++P  +                LD+  P++D +G+  K K    S       N  +P+   +++G K KGD+DV  SIP+V+  V   K
Sbjct: 3618 LDIKSPEIDIEGPEGKVKGPKLKMPSFPVPKISMPDVDFNLKGPKLKGDFDVSV--PKVEGDFKAPDVDVKTPKVDMEGPEGK----FKGPKFQMPSFSGP----------NISMPDVDFNIKGPKLKGDVDVSV--PKVQGDIKAPKIELEGPDIEGPEGGFKMPNIKMPKFGFKGPKVEGPDMDVKIPKSDFEVKSPDLDIKSPEIDIEGPEGKVKGPKFKIP---SFTGPKISMPDVDFNLKGPKLKGDVDVSVPKVEGDIKLP---------GLDVEAPKVDMEGSEGKLKGPKFSMPSISGPNFSLPNVDFNLKGPKLKGDVDV--SIPKVEGGVKAPK 3929          

HSP 2 Score: 70.8626 bits (172), Expect = 9.531e-13
Identity = 96/342 (28.07%), Postives = 149/342 (43.57%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDID---------------VDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKK-HGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKKKK-HGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQV----------DLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            D  +PK EG +K PK  +++E PDI+                   G K +G  +++VK P  D +   PD+DI   E+DI+G + K  G  F +P   LPK               I  P+VD ++ G + KG+VDV+   P +E DI  P +D+E      +G + K  G    +PS+ G  F          VD  +K P +  D+D    ++ G   V  P  +++     S +      +I +P + F     +      ++          DLDI +PEID +G   K K             + +PD   +++G K KGD+DV +   E DI V G
Sbjct: 4448 DVSVPKVEGGIKAPK--VEIEGPDIEGREGGFKMPNIKMPKFGFKGSKVEGP-EMDVKIPEADFEVKSPDLDIKSPEIDIEGPEGKVKGPKFQMPSVSLPK---------------ISMPDVDFNLKGPKLKGDVDVSV--PKVEGDIKLPSLDVEAPKIDFEGSEGKLKGPKFSMPSISGPNFS------LPNVDFNLKGPKLKGDVDVSVPKVEG--GVKAPKVELEGPDIESPEGGFKMPNIKMPKFGFKGPKVEGPDMDVKIPKADFEVKSPDLDIKSPEIDIEGPDGKVKGPTLKMPSLSGPKISMPDVDFNLKGPKVKGDVDVSVPKVEGDIKVPG 4761          

HSP 3 Score: 69.707 bits (169), Expect = 1.918e-12
Identity = 104/382 (27.23%), Postives = 171/382 (44.76%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKK-----PKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID--------------------ITKPDMDIEIDGKKKKHGINIGLPSMKG------LKFEG----------------------KGKKPKS--------EVDLGVKTPSID-----IDIDGKKHRISGD---LSVDKPXXXXX-XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            LDI  P+  +   EGK+K      P     +  PD+D ++ G K KG++D++V  P V+ D   P + +E  +I+G +      F +P  K+PKF  K  K +G   ID++ P+ D+DI G       DV    P+L+I+                    I+ PD+D  + G K K  +N+ +P ++G      L+ EG                      KG K +S        + D  VK+P +D     +DI+G + ++ G    +    P   +  +D ++   K K  +D+++P  K               ++DI TP+ID +G   K K    S       N+ +PDA   ++G K KGD+DV  S+P+V+ D+
Sbjct: 2796 LDIKSPEIDIEGPEGKVKGSKFKIPFSGPKISMPDVDFNLKGPKLKGDVDVSV--PKVEGDITAPKVQLEGPEIEGPEG----GFKMPTIKMPKFGFKGPKVEGP-GIDVKSPKTDIDIKG------CDVDIKAPELDIEAPEGNIKDPKLKMPSLTRPTISMPDVDFNLKGPKLKGDVNVSVPKVEGDIKAPKLELEGPEIEGPESGFKMPKFKMPHIGFKGPKLESPDLDVKIPKADFEVKSPDLDLKTPELDIEGPEGKVKGSKFKMPFSGPKISMPDVDFNLKGPKLKGEVDVSVPKVKGDIK---------ATEVDIKTPQIDIEGPEGKPKGSKFSIPSISGPNISMPDADFSLKGPKLKGDVDV--SVPKVEGDI 3153          

HSP 4 Score: 69.3218 bits (168), Expect = 2.745e-12
Identity = 64/203 (31.53%), Postives = 101/203 (49.75%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKK-HGLDFNLP-------------------------DWKLPKFEGKLKKPKGELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKG 582
            GLDI  P   +   EGKLK PK         ++  P +D ++ G K +G++D++V  P V  D   PD+DI   E+DI+G + K  G  F +P                         D+ +PK EG +K P    D+ I+GPEVDV+     I G++ KG    +F+ P++ +    PD+D  + G K K G+++ +P ++G
Sbjct: 4761 GLDIKAPKVDIEGPEGKLKGPKINIPSISGPNISLPTVDFNLKGPKLRGDVDVSV--PKVKGDVKAPDLDIKTPEIDIEGAEGKIKGPKFRIPSVSMPKISMPEVDFNLKGPKLKGDVDFSVPKVEGDVKAP----DVHIKGPEVDVETPEGKITGSKFKGP---SFSGPNISL----PDVDFNLKGPKLKGGVDVSVPKVQG 4950          

HSP 5 Score: 68.9366 bits (167), Expect = 3.558e-12
Identity = 99/338 (29.29%), Postives = 160/338 (47.34%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-IDGKKKKHGINIGLPSMKGLK-------FEGKGKKPKSEVDL-------GVKTPSIDI---DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            GLD+  P   +   EGKLK PK ++      +   P++D ++ G K KG++D+++  P V+     P ++IE  DI+  +      F +P+ K+PKF    K PK E+ D+D++ P+ D ++               PDL  DI  P++D+E  +GK K  G  + +PS  G K       F  KG K KS+VD+       G+K P ++I   DI+G++           P+  +        K +   +D+ +P   F              DLDI +PEID +G   K K             + +PD   +++G K KGD+DV  S+P+V+ D+
Sbjct: 3864 GLDVEAPKVDMEGSEGKLKGPKFSMPSISGPNFSLPNVDFNLKGPKLKGDVDVSI--PKVEGGVKAPKVEIEGPDIESSEG----GFKMPNIKMPKF--GFKGPKVEVPDMDVKIPKADFEVK-------------SPDL--DIKSPEIDMEGPEGKVK--GPTLKMPSFSGPKISMPDVDFNLKGPKLKSDVDVSVPKVEGGIKAPKVEIEGPDIEGREGGFK------MPNIKMPKFGFKGPKVEGPDMDVKIPKSDFEIK---------SPDLDIKSPEIDIEGPEGKVKGPKFKIPSFSGPKISMPDVDFNLKGPKLKGDVDV--SVPKVEGDI 4159          

HSP 6 Score: 68.9366 bits (167), Expect = 3.655e-12
Identity = 96/341 (28.15%), Postives = 152/341 (44.57%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKFEGK----------LKKPKGELDI-----DIRGPEVDVDIHGNRAKGN-VDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDL--------GVKTPSIDIDIDG-KKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +DI  P+ K+     K K P     +  PD+D ++ G K KG++D++V  P V+ D   P +++E  +IDG +      F +P  K+PKF  K          +K PK ++DI     DI+GPE+D++    + KG+   + F+ P     I+ PD+D  + G K K  +++ +P     K EG  K PK E++         G K P+I +   G K  ++ G                +  K  K  IDI  P                  D+DI  PE+D +      KD            + +PD   +++G K KGD+DV  S+P+V  D+   K
Sbjct: 1988 IDIEGPEGKVKG--SKFKIPFSGPTISMPDVDFNLKGPKLKGDVDVSV--PKVEGDIKAPKVELEGPEIDGPEG----GFKMPTIKMPKFGFKGPKVEGPDVDVKIPKTDIDIKAPDVDIKGPEIDIEGPEGKVKGSKFKIPFSGPT----ISMPDVDFNLKGPKLKGDVDVSVP-----KVEGDIKAPKVEIEGPEIEGPEGGFKMPTIKMPKFGFKGPKVEG--------------PGMEVKIPKTDIDIKGP------------------DVDIKAPELDIEAPEGNIKDPKLKMPSLSRPTISMPDVDFNLKGPKLKGDVDV--SVPKVQGDIKASK 2277          

HSP 7 Score: 66.6254 bits (161), Expect = 2.068e-11
Identity = 98/345 (28.41%), Postives = 162/345 (46.96%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVDIHG-KKPKGEI-------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKS--------EVDLGVKTPSID-----IDIDGKKHRISG------DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            D  +PK EG +K PK  +++E P+I+    G K PK ++             D++VK P  +ID  +PD+DI   E+DI+G + K       P WK+P F     +P       +  P+VD ++ G + KG+VDV+   P +E  +  P +++E    +   G    +P  +  KF  KG K +         + D  VK+P +D     IDI+G + ++ G         V K  +  D+D ++   K K   D+++P  +    +          D+D+ TP++D +G   K K            N+ +PD   +I+G K KGD+DV  S+P+V  D+   K
Sbjct: 3434 DVSVPKVEGDIKAPK--VELEGPEIEGPESGFKMPKFKMPHIGFKGPKVEGPDVDVKIPKTEIDIKEPDLDIKGPELDIEGPEGK----VKGPKWKMPSFS----RPT------VSVPDVDFNLKGPKLKGDVDVSL--PKVEGGVKAPKVELEGPDIEGPEG-GFKMPKFRLPKFGFKGPKVERPDMDMKIPKADFEVKSPDLDIKSPEIDIEGPEGKVKGPKLKMPSFPVPK-ISMPDVDFNLKGPKLKGDFDVSVPKVEGDFKAP---------DVDVKTPKVDMEGPEGKFKGPKFQMPSFSGPNISMPDVDFNIKGPKLKGDVDV--SVPKVQGDIKAPK 3747          

HSP 8 Score: 66.2402 bits (160), Expect = 2.679e-11
Identity = 96/341 (28.15%), Postives = 156/341 (45.75%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKFEGK----------LKKPKGELDI-----DIRGPEVDVDIHGNRAKGN-VDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDL---GVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +DI  P+  +   EG +K PK  +       +  PD+D ++ G+K KG++D++V  P +  +   P +++E  DI G +      F +P  KLP+F  K          +K PK E+DI     DI+GPE+D++    + KG+   + F+ P     I+ PD+D  + G K K  +++ +P ++G     KG     E+++   G K P+I +   G K        V+KP        D+  K  K  IDI  P                  D+DI  P +D +G   K K             + +PD   +++G K KGD+DV  S+P+V  D+   K
Sbjct: 1515 VDIKAPELDIEAPEGNIKDPKLKMPSLSRPTISMPDVDFNLKGQKLKGDVDVSV--PKMQGEIKAPKVELEGQDIAGPEG----GFKMPKIKLPQFGFKGPKVEGPDVDVKIPKTEIDIKAPDVDIKGPEIDIEAPEGKVKGSKFKIPFSGP----TISMPDVDFNLKGPKLKGDVDVSVPKVEGDIKAPKGDLEGPEIEVPEGGFKMPTIKMPKFGSKGP-----KVEKP--------DIDVKIPKTDIDIKAP------------------DVDIKAPVLDIEGPEGKVKGSKFKMPFS-GPTISMPDVDFNLKGPKLKGDVDV--SVPKVKGDIKAPK 1811          

HSP 9 Score: 66.2402 bits (160), Expect = 3.062e-11
Identity = 104/346 (30.06%), Postives = 162/346 (46.82%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVDIHG-------------KKPKGEI-DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE---IDGKKKKHGI-NIGLP--SMKGLKFEGKG---KKPKSEV-----DLGVKTPSIDID-----IDGKKHRISGDLSVDKPXXXXXXX-XXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            D  +PK EG +K PK  +++E PDI+    G             K PK E+ D++VK P  D +   PD+DI   E+D++G + K       P  K+P F G    PK      I  P+VD ++ G + K +VDV+   P +E  I  P ++IE   I+G++    + NI +P    KG K EG     K PKS+      DL +K+P IDI+     + G K +I    S   P   +     ++   K K  +D+++P  +                LD+  P++D +G+  K K    S       N  +P+   +++G K KGD+DV  S+P+V+  V   K
Sbjct: 3915 DVSIPKVEGGVKAPK--VEIEGPDIESSEGGFKMPNIKMPKFGFKGPKVEVPDMDVKIPKADFEVKSPDLDIKSPEIDMEGPEGK----VKGPTLKMPSFSG----PK------ISMPDVDFNLKGPKLKSDVDVSV--PKVEGGIKAPKVEIEGPDIEGREGGFKMPNIKMPKFGFKGPKVEGPDMDVKIPKSDFEIKSPDLDIKSPEIDIEGPEGKVKGPKFKIP---SFSGPKISMPDVDFNLKGPKLKGDVDVSVPKVEGDIKLP---------GLDVKAPKVDMEGSEGKFKGPKFSMPSISGPNFSLPNVDFNLKGPKLKGDVDV--SVPKVEGGVKAPK 4228          

HSP 10 Score: 65.855 bits (159), Expect = 3.469e-11
Identity = 90/337 (26.71%), Postives = 155/337 (45.99%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKF-------EG---KLKKPKGEL-----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEI-DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI---DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            LDI  P+  +   EGK+K P   +       +  PD+D ++ G K K ++D++V  P V+     P ++IE  DI+G++      F +P+ K+PKF       EG   ++K PK +      D DI+ PE+D++    + KG     F  P +    ++ PD+D  + G K K  +++ +P ++G                G+K P ++I   DI+G++           P+  +       +K +   +D+ +P   F              DLDI +PEID +G   K K             + +PD   +++G K KGD+DV  S+P+V+ D+
Sbjct: 4281 LDIKSPEIDIEGPEGKVKGPTLKMPSFSGPKISMPDVDFNLKGPKLKSDVDVSV--PKVEGGIKAPKVEIEGPDIEGREG----GFKMPNIKMPKFGFKGPKVEGPDMEVKIPKADFEVKSPDFDIKSPEIDIEGPEGKVKGP---KFQMPSVSRPKMSMPDVDFNLKGPKLKGDVDVSVPKVEG----------------GIKAPKVEIEGPDIEGREGGFK------MPNIKMPKFGFKGSKVEGPEMDVKIPEADFEVK---------SPDLDIKSPEIDIEGPEGKVKGPKFQMPSVSLPKISMPDVDFNLKGPKLKGDVDV--SVPKVEGDI 4575          

HSP 11 Score: 65.855 bits (159), Expect = 4.036e-11
Identity = 71/221 (32.13%), Postives = 112/221 (50.68%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGK-----LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEG-KLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSE-VDLGVKTPSIDIDIDGKKHRI-SGDLSVDKP 711
            +DI  P+ ++   EGK     LK P     +  PD+D ++ G K KG++D +   P V  D   P++DI   EVDI+G  +K    F  P +++P   G  +  P    D+D   P+VDV++ G + KG+VDV+   P +E  I  P +DIE     +DG +    +   +P +  L  +G    P  E  ++GVK P  +ID+      I S DL+++ P
Sbjct: 5406 VDIKSPELEIEGPEGKVKGHKLKMPFSGPTISMPDVDFNLKGLKLKGDVDASA--PKVKGDIKIPNVDIKGPEVDIEGPGRK----FKGPKFQMPSVSGPNISMP----DVDFTMPDVDVNLKGPKLKGDVDVSV--PKVEGHIKAPKVDIEGPDFDVDGPE----VGFKMPKLPSLGLKG----PNVEGPEIGVKIPKTNIDVKAPGVDIESPDLNIEGP 5606          

HSP 12 Score: 65.855 bits (159), Expect = 4.220e-11
Identity = 109/362 (30.11%), Postives = 165/362 (45.58%), Query Frame = 1
Query:   97 LDINLPDW--KLPKF-----EGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKK-HGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSE-VDLGVKTPSIDIDIDGKKHRI-SGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLP----NWXXXXXXXXXXXXXGQV-------DLDINTPEID-------FXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDV-------HLSIPEVDI-----DVDG 1035
            +DIN PD   K P+      EGK+K PK          +  PD+D ++ G+K KG++D++V  P +  D   P +DI   +VDI+G + K  G  F++P    PK               I  P VD ++ G + KG+VDVT   P +E D+  P +++E    +   G    +P +K  K   KG  PK E  D+ V+ P  DIDI+     I S +L ++ P+  +        K    G  I++P    N K  K       S  +V       ++DI  PE+D       F G   +    +       DV+  +PD  ++++G K KGD+DV       H+  P+VDI     DVDG
Sbjct: 5217 IDINAPDVDIKAPELDIDGPEGKIKGPKLTKPSLSGPTISMPDVDFNLKGRKMKGDVDVSV--PKLQGDIKVPGMDIKGPQVDIEGPEGKIKGSKFSMPSISGPK---------------ISMPNVDFNLKGPKLKGDVDVTV--PKVEGDMKAPKVELEGPDIEGPEG-GFKMPKVKMPKIGFKG--PKVEGPDVNVQIPKTDIDINAPDVDIKSPELEIEGPEGKVKGHKL---KMPFSGPTISMPDVDFNLKGLKLKGDVDASAPKVKGDIKIPNVDIKGPEVDIEGPGRKFKGPKFQMPSVSGPNISMPDVDFTMPDVDVNLKGPKLKGDVDVSVPKVEGHIKAPKVDIEGPDFDVDG 5553          

HSP 13 Score: 65.0846 bits (157), Expect = 6.645e-11
Identity = 96/335 (28.66%), Postives = 152/335 (45.37%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVDIHG-------------KKPKGE-IDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI-----EIDGKKKKH-GINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQV----------DLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVD 1020
            D  +PK EG +K PK  +++E PDI+    G             K PK E  D++VK P  D +   PD+DI   E+DI+G + K       P +K+P F G    PK      I  P+VD ++ G + KG+VDV+   P +E DI  P +D+     +++G + K  G    +PS+ G  F          VD  +K P +  D+D    ++ G   V  P  +++     S +      +I +P + F     +      ++          DLDI +PEID +G   K K             + +PD   +++G K K D+DV  S+P+V+
Sbjct: 4032 DVSVPKVEGGIKAPK--VEIEGPDIEGREGGFKMPNIKMPKFGFKGPKVEGPDMDVKIPKSDFEIKSPDLDIKSPEIDIEGPEGK----VKGPKFKIPSFSG----PK------ISMPDVDFNLKGPKLKGDVDVSV--PKVEGDIKLPGLDVKAPKVDMEGSEGKFKGPKFSMPSISGPNFS------LPNVDFNLKGPKLKGDVDVSVPKVEG--GVKAPKVELEGPDIESPEGGFKMPNIKMPKFGFKGPKVEGPDMDVKIPKADFEVKSPDLDIKSPEIDIEGPEGKVKGPTLKMPSFSGPKISMPDVDFNLKGPKLKSDVDV--SVPKVE 4338          

HSP 14 Score: 65.0846 bits (157), Expect = 7.263e-11
Identity = 120/445 (26.97%), Postives = 188/445 (42.25%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKK-----------HGLDFNLP---------------DWKLPKFEGKLKKPKGELD-IDIRGPEVDVDI----------HGNRAKG-NVDVTFNKPDLEI-----DITKPDMDIE-IDGKKKKHGINIGLPSMKGLK-------FEGKGKKPKSEVDLGV-------KTPSIDI-----DIDGKKHRISGD----LSVDKPXXXXXXX-XXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDID--------------VHL-----------------------------SIPEVDIDVDGKKKKHGFGINLP 1071
            LDI  P+  +   EGK+K PK  +       +  PD+D ++ G K KG++D++V  P V+ D   P +D+E   +D +G + K            G +F+LP               D  +PK EG +K PK EL+  DI  PE    +           G + +G ++DV   K D E+     DI  P++DIE  DGK K  G  + +PS+ G K       F  KG K K +VD+ V       K P +DI     DI+G + ++ G      S+  P+  +     ++   K +  +D+++P  K    +          DLDI TPEID +G   K K             + +P+   +++G K KGD+D              VH+                             S+P+VD ++ G K K G  +++P
Sbjct: 4515 LDIKSPEIDIEGPEGKVKGPKFQMPSVSLPKISMPDVDFNLKGPKLKGDVDVSV--PKVEGDIKLPSLDVEAPKIDFEGSEGKLKGPKFSMPSISGPNFSLPNVDFNLKGPKLKGDVDVSVPKVEGGVKAPKVELEGPDIESPEGGFKMPNIKMPKFGFKGPKVEGPDMDVKIPKADFEVKSPDLDIKSPEIDIEGPDGKVK--GPTLKMPSLSGPKISMPDVDFNLKGPKVKGDVDVSVPKVEGDIKVPGLDIKAPKVDIEGPEGKLKGPKINIPSISGPNISLPTVDFNLKGPKLRGDVDVSVPKVKGDVKAP---------DLDIKTPEIDIEGAEGKIKGPKFRIPSVSMPKISMPEVDFNLKGPKLKGDVDFSVPKVEGDVKAPDVHIKGPEVDVETPEGKITGSKFKGPSFSGPNISLPDVDFNLKGPKLKGGVDVSVP 4946          

HSP 15 Score: 64.6994 bits (156), Expect = 8.154e-11
Identity = 108/378 (28.57%), Postives = 168/378 (44.44%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKK-----------HGLDFNLP---------------DWKLPKFEGKLKKPKGELD-IDIRGPEVDVDI----------HGNRAKG-NVDVTFNKPDLEI-----DITKPDMDIE-IDGKKKKHGINIGLPSMKGLK-------FEGKGKKPKSEVDL-------GVKTPSIDI---DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVD 1020
            LDI  P+  +   EGK+K PK          +  PD+D ++ G K KG++D++V  P V+ D   P +D+   +VD++G + K            G +F+LP               D  +PK EG +K PK EL+  DI  PE    +           G + +G ++DV   K D E+     DI  P++DIE  +GK K  G  + +PS  G K       F  KG K KS+VD+       G+K P ++I   DI+G++           P+  +        K +   +++ +P   F              D DI +PEID +G   K K             + +PD   +++G K KGD+DV  S+P+V+
Sbjct: 4099 LDIKSPEIDIEGPEGKVKGPKFKIPSFSGPKISMPDVDFNLKGPKLKGDVDVSV--PKVEGDIKLPGLDVKAPKVDMEGSEGKFKGPKFSMPSISGPNFSLPNVDFNLKGPKLKGDVDVSVPKVEGGVKAPKVELEGPDIESPEGGFKMPNIKMPKFGFKGPKVEGPDMDVKIPKADFEVKSPDLDIKSPEIDIEGPEGKVK--GPTLKMPSFSGPKISMPDVDFNLKGPKLKSDVDVSVPKVEGGIKAPKVEIEGPDIEGREGGFK------MPNIKMPKFGFKGPKVEGPDMEVKIPKADFEVK---------SPDFDIKSPEIDIEGPEGKVKGPKFQMPSVSRPKMSMPDVDFNLKGPKLKGDVDV--SVPKVE 4455          

HSP 16 Score: 63.929 bits (154), Expect = 1.767e-10
Identity = 103/344 (29.94%), Postives = 157/344 (45.64%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKK-----PKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV---DIHGNRAKGNV-DVTFNKPDLEI-DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV--------DLGVKTPSIDI-DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            LDI  P+  +   EGK+K      P     +  PD+D ++ G K KG++D++V  P V+ D   P +++E  +I+G   + GL   +P  K+PKF  K  K +G        + DIDI+GP+VD+   ++     KGN+ D     P L    I+ PD+D  + G K K  +++ +P     K +G  K PK E+        + G K P I +  I  K  ++ G D+ V  P               K  IDI  P                  DLDI +PEID +G   K K             + +PD   +++G K KGD+DV  S+P+V+ D+   K
Sbjct: 2563 LDIKSPEIDIEGPEGKVKGSKFKIPFSGPKISMPDVDFNLKGPKLKGDVDVSV--PKVEGDITAPKVELEGPEIEG--PEGGL--KMPTIKMPKFGFKGPKVEGPGMDVKSPKTDIDIKGPDVDIKAPELDIEAPKGNIKDPKLKMPSLSRPTISMPDVDFNLKGPKLKGDVDVSVP-----KVQGDIKAPKVELEGSDIAGPEGGFKMPKIKMPQIGFKGPKVEGPDVDVKIP---------------KTDIDIKAP------------------DLDIKSPEIDIEGPEGKVKGSKFKIPFS-GPKISMPDVDFNLKGPKLKGDVDV--SVPKVEGDITAPK 2859          

HSP 17 Score: 62.7734 bits (151), Expect = 3.927e-10
Identity = 105/358 (29.33%), Postives = 164/358 (45.81%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKFEGK----------LKKPKGELDI-----DIRGPEVDVDIHGNRAKGN-VDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKG-LKF---------------EGKGKKPKSEVDLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGID--INLPNWXXXXXXXXXXXXXG---------------QVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHL 1002
            +DI  P+      EGK+K  K  +    P I   DVD + K PK + D++V  P V+ D   P +++E  +I+G +      F +P+ K+PKF  K          +K PK ++DI     DI+GPE+D++    + KG+   + F+ P     I+ PD+D  + G K K  +++ +P +KG +K                EGK K PK  +   +  P+I   D+D + K  ++ GD+SV K + DI          +  G +    +P +K P    K  K +G               + DLDI  PE+D +G   K K             V VPD   +++G K KGD+DV L
Sbjct: 3208 VDIKSPELDFEGPEGKVKGSKFKMPFSGPTISMPDVDFNLKSPKLKGDVSV--PKVEGDIKAPKVELEGPEIEGPEG----GFKMPNIKMPKFGFKGPKVEGPDVDIKIPKTDIDIKAPDVDIKGPEIDIEGPEGKVKGSKFKIPFSGPT----ISMPDVDFNLKGPKLKGDVDVSVPKVKGEIKAPDVVVKTPKVDIEGPEGKLKGPKFNIP-SISGPNISMPDVDFNLKGPKLKGDVSVPKVEGDIKAPKVELEGPEIEGPESGFKMPKFKMPHIGFKGPKVEGPDVDVKIPKTEIDIKEPDLDIKGPELDIEGPEGKVKGPKWKMPSFSRPTVSVPDVDFNLKGPKLKGDVDVSL 3554          

HSP 18 Score: 62.3882 bits (150), Expect = 4.407e-10
Identity = 100/348 (28.74%), Postives = 157/348 (45.11%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPK--FEGK--------LKKPKGELDI-----DIRGPEVDVDIHGNRAKGN-VDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV--------DLGVKTPSIDIDIDG-KKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +DI  P   +   EG +K PK  +       +  PD+D ++ G K KG++D++V  P V  D   P +++E  DI G +      F +P  K+P+  F+G         +K PK ++DI     DI+GPE+D++    + KG+   + F+ P     I+ PD+D  + G K K  +++ +P     K EG  K PK E+        + G K P+I +   G K  ++ G D+ V  P               K  IDI  P                  D+DI  PEID +G   K K             + +PD   +++G K KGD+DV  S+P+V+ D+   K
Sbjct: 1864 VDIKAPKLDIEAPEGNIKDPKLIIPSLSRPTISMPDVDFNLKGPKLKGDVDVSV--PKVQGDIKAPKVELEGSDIAGPEG----GFKMPKIKMPQIGFKGPKVEGPDVDVKIPKTDIDIKAPDVDIKGPEIDIEGPEGKVKGSKFKIPFSGP----TISMPDVDFNLKGPKLKGDVDVSVP-----KVEGDIKAPKVELEGPEIDGPEGGFKMPTIKMPKFGFKGPKVEGPDVDVKIP---------------KTDIDIKAP------------------DVDIKGPEIDIEGPEGKVKGSKFKIPFS-GPTISMPDVDFNLKGPKLKGDVDV--SVPKVEGDIKAPK 2160          

HSP 19 Score: 62.3882 bits (150), Expect = 4.773e-10
Identity = 98/339 (28.91%), Postives = 155/339 (45.72%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV---DIHGNRAKGNV-DVTFNKPDLEI-DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV--------DLGVKTPSIDI-DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +DI  P+ K+     K K P    ++  PD+D ++ G K KG++D++V  P V+ +   P +++E  +I+G +      F +P  K+PKF  K  K +G        + DIDI+GP+VD+   ++     +GN+ D     P L    I+ PD+D  + G K K  +++ +P     K +G  K PK E+        + G K P I +  I  K  ++ G D+ V  P               K  IDI  P                  DLDI +PEID +G   K K             + +PD   +++G K KGD+DV  S+P+V+ D+   K
Sbjct: 2337 IDIGGPEGKVKG--SKFKIPFSGPNISMPDVDFNLKGPKLKGDVDVSV--PKVEGNIKTPKVELEGPEIEGPEG----GFKMPTIKMPKFGFKGPKVEGPGMDVKIPKTDIDIKGPDVDIKALELDIEAPEGNIKDPKLKMPSLSRPTISMPDVDFNLKGPKLKGDVDVSVP-----KVQGDIKAPKVELEGSDIAGPEGGFKMPKIKMPQIGFKGPKVEGPDVDVKIP---------------KTDIDIKAP------------------DLDIKSPEIDIEGPEGKVKGSKFKIPFS-GPKISMPDVDFNLKGPKLKGDVDV--SVPKVEGDITAPK 2626          

HSP 20 Score: 60.8474 bits (146), Expect = 1.444e-9
Identity = 99/348 (28.45%), Postives = 153/348 (43.97%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKFEGK----------LKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV--------DLGVKTPSIDI-DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            G++I  P   +   EGK+K  K ++      +V  PD+D ++ G K KG  D+NV  P ++ D   P +++E  DI+G +      F +P+ K+PKF  K          +K PK ++DI     DI+ PE+D++    + KG+    F  P     I+ PD+D  + G K K  +++ +P     K E   K PK E+        + G K P I +  I  K  ++ G D+ V  P               K  IDI  P                  D+DI  PEID +G   K K            N+ +PD   +++G K KGD+    S+P+V  D+   K
Sbjct: 1167 GVEIKGPRVDIEGPEGKIKGSKFSMPSISVPNVSMPDVDFNLKGSKLKG--DVNVSVPKMEGDVKAPKVELEGPDIEGPEG----GFKMPNIKMPKFGSKGPKVEKPDIDVKIPKTDIDIKAPDVDIKAPELDIEGPEGKVKGS---KFKMPFSGPTISMPDVDFNLKGPKLKGDVDVSVP-----KVEADIKAPKVELEGPEIEGPEGGFKMPKIKMPQIGFKGPKVEGPDVDVKIP---------------KTNIDIKAP------------------DVDIKGPEIDIEGPEGKVKGSKFKIPFS-GPNISMPDVDFNLKGPKLKGDV----SVPKVKGDIKAPK 1462          

HSP 21 Score: 60.077 bits (144), Expect = 2.704e-9
Identity = 89/341 (26.10%), Postives = 140/341 (41.06%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKK-HGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EID---GKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            LDI  P+  +   +GK+K P   +       +  PD+D ++ G K KG++D++V  P V+ D   P +DI   +VDI+G + K  G   N+P    P               +I  P VD ++ G + +G+VDV+   P ++ D+  PD+DI   EID    + K  G    +PS+   K          EVD  +K P +  D+D    ++ GD+                                               D+ I  PE+D +    K              N+ +PD   +++G K KG +DV  S+P+V  D+    K   F INLP
Sbjct: 4697 LDIKSPEIDIEGPDGKVKGPTLKMPSLSGPKISMPDVDFNLKGPKVKGDVDVSV--PKVEGDIKVPGLDIKAPKVDIEGPEGKLKGPKINIPSISGP---------------NISLPTVDFNLKGPKLRGDVDVSV--PKVKGDVKAPDLDIKTPEIDIEGAEGKIKGPKFRIPSVSMPKIS------MPEVDFNLKGPKLKGDVDFSVPKVEGDVKAP--------------------------------------------DVHIKGPEVDVETPEGKITGSKFKGPSFSGPNISLPDVDFNLKGPKLKGGVDV--SVPKVQGDI----KATDFNINLP 4962          

HSP 22 Score: 59.6918 bits (143), Expect = 3.556e-9
Identity = 88/340 (25.88%), Postives = 150/340 (44.12%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPK--FEGK--------LKKPKGELDI-----DIRGPEVDVDIHGNRAKGN-VDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV--------DLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            LDI  P+ K+     K K P     +  PD+D ++ G K KG++D++V  P V+ D   P +++E  +I+G +      F +P  K+P+  F+G         +K PK  +DI     DI+GPE+D++    + KG+   + F+ P    +I+ PD+D  + G K K  +++        K +G  K PK E+        + G K P+I +   G K                        K +  G+D+ +P                  D+DI  PE+D +      KD            + +PD   +++G+K KGD+DV  S+P++  ++   K
Sbjct: 1292 LDIEGPEGKVKG--SKFKMPFSGPTISMPDVDFNLKGPKLKGDVDVSV--PKVEADIKAPKVELEGPEIEGPEG----GFKMPKIKMPQIGFKGPKVEGPDVDVKIPKTNIDIKAPDVDIKGPEIDIEGPEGKVKGSKFKIPFSGP----NISMPDVDFNLKGPKLKGDVSV-------PKVKGDIKAPKVELEGPEIEGPEGGFKMPTIKMPKFGFK----------------------GPKVEGPGMDVKIPKTDIDIKGP---------DVDIKAPELDIEAPEGNIKDPKLKMPSLSRPTISMPDVDFNLKGQKLKGDVDV--SVPKMQGEIKAPK 1579          

HSP 23 Score: 58.9214 bits (141), Expect = 5.881e-9
Identity = 65/221 (29.41%), Postives = 105/221 (47.51%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGK-----LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKK--------PKSEVDLGVKTPSIDI-----DIDGKKHRISGD 693
            LD+  P+  +   EGK      K P     +  PD+D ++ G K KGE+D++V  P V  D    ++DI   ++DI+G + K  G  F++P    P               +I  P+ D  + G + KG+VDV+   P +E DI  P+++IE    K   G    +P +K  +F  KG K        PK+++D  +K P +DI     D +G + ++ G 
Sbjct: 3029 LDLKTPELDIEGPEGKVKGSKFKMPFSGPKISMPDVDFNLKGPKLKGEVDVSV--PKVKGDIKATEVDIKTPQIDIEGPEGKPKGSKFSIPSISGP---------------NISMPDADFSLKGPKLKGDVDVSV--PKVEGDIKAPNVEIEGPDIKGPEG-GFKMPKIKMPRFGFKGPKVEGPDVEVPKTDID--IKAPDVDIKSPELDFEGPEGKVKGS 3227          

HSP 24 Score: 56.6102 bits (135), Expect = 3.672e-8
Identity = 90/340 (26.47%), Postives = 146/340 (42.94%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI---DIEVDIDGKKKKHGLDFNLPDWKLPKFEGK----------LKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKG------LKFEGKGKKPKSE-VDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +DI  P+ K+     K K P     +  PD+D ++ G K KG++D++V     DI   K D+   +IEV   G        F +P  K+PKF  K          +K PK ++DI     DI+ P +D++    + KG+    F  P     I+ PD+D  + G K K  +++ +P +KG      ++ EG    P+ E  + G K P+I +   G K       +V+ P                 G+D+ +P                  D+DI  P++D +      KD            + +PD   +++G K KGD+DV  S+P+V  D+   K
Sbjct: 1639 IDIEAPEGKVKG--SKFKIPFSGPTISMPDVDFNLKGPKLKGDVDVSVPKVEGDIKAPKGDLEGPEIEVPEGG--------FKMPTIKMPKFGSKGPKVEKPDIDVKIPKTDIDIKAPDVDIKAPVLDIEGPEGKVKGS---KFKMPFSGPTISMPDVDFNLKGPKLKGDVDVSVPKVKGDIKAPKVELEG----PEIEGPEGGFKMPTIKMPKFGFKGP-----NVEGP-----------------GLDVKIPKTDIDIKGP---------DVDIKAPKLDIEAPEGNIKDPKLIIPSLSRPTISMPDVDFNLKGPKLKGDVDV--SVPKVQGDIKAPK 1928          

HSP 25 Score: 56.225 bits (134), Expect = 4.655e-8
Identity = 104/370 (28.11%), Postives = 155/370 (41.89%), Query Frame = 1
Query:  112 PDWKLPKFEGKLKKPKGALDVEAPDIDV-------------DIHGKKPKGE-IDLNVKNPNVDIDFHKPDID---IEVDIDGKKKK-HGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMD-----IEIDGKKKK-----------HGINIGLPSMKGLKFEGKGKKPKSEVDLGV-------KTPSID---IDIDG-----------------KKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            P  K+P   G    P+G+++V  P+ +V                 K PK E  D++VK P  DI F  PD+D    E++I+G K K     F++P    PK               +  P+VD+++   + KG+VDV+   P +E +I+ PD+D     +E +G + K            G NI +P    + F  KG K KS+VD+ V       KTP I+    DI+G                 K  ++ G D+ V  P               K  IDIN P                  D+DI  PE+D DG   K K    +K       + +PD   +++G+K KGD+DV +   + DI V G
Sbjct: 4976 PKLKMPSLSG----PEGSIEVNLPETNVKKPKFKMPKFKFPSFGHKGPKVEGPDVDVKIPKADIKFKSPDLDNESPELNIEGPKGKIKASKFSMPTISGPK---------------VSMPDVDLNLKRPKLKGDVDVSV--PKVEGNISVPDVDLKSPEVEFEGPEGKIKGPKGKIPLLSGPNISMPH---VDFNLKGPKLKSDVDVSVLKVEGDIKTPKIEHEGPDIEGPEGGFKMPKLKIPQFGFKGPKVEGPDMDVKIP---------------KTDIDINAP------------------DVDIKAPELDIDGPEGKIKGPKLTKPSLSGPTISMPDVDFNLKGRKMKGDVDVSVPKLQGDIKVPG 5288          

HSP 26 Score: 55.8398 bits (133), Expect = 6.387e-8
Identity = 98/364 (26.92%), Postives = 157/364 (43.13%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKG-ALDVEAPDIDVDIHG-----KKPKGEIDL---NVKNPNVDI-DFHKPDI---DIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELD-IDIRGPE----------VDVDIHGNRAKG-NVDVTFNKPDLEI-----DITKPDMDIE-IDGKKKKHGINIGLP----SMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG------DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            + +P  K+PKF  K  K +G  +DV++P  D+DI G     K P+ +I+    N+K+P + +    +P I   D++ ++ G K K  +D ++P     K +G +K PK EL+  DI GPE            +   G + +G +VDV   K D++I     DI  P++DIE  +GK K     I       SM  + F  KG K K +VD+ V  P ++ DI   K ++ G      +     P   +        K +  GID+  P                  D+DI  PE+D                      +E P+ +I     K        +S+P+VD ++ G K K    +++P
Sbjct: 2641 LKMPTIKMPKFGFKGPKVEGPGMDVKSPKTDIDIKGPDVDIKAPELDIEAPKGNIKDPKLKMPSLSRPTISMPDVDFNLKGPKLKGDVDVSVP-----KVQGDIKAPKVELEGSDIAGPEGGFKMPKIKMPQIGFKGPKVEGPDVDVKIPKTDIDIKAPDLDIKSPEIDIEGPEGKVKGSKFKIPFSGPKISMPDVDFNLKGPKLKGDVDVSV--PKVEGDITAPKVQLEGPEIEGPEGGFKMPTIKMPKFGFKGPKVEGPGIDVKSPKTDIDIK---------GCDVDIKAPELD----------------------IEAPEGNIKDPKLKMPSLTRPTISMPDVDFNLKGPKLKGDVNVSVP 2966          

HSP 27 Score: 55.0694 bits (131), Expect = 1.110e-7
Identity = 87/356 (24.44%), Postives = 153/356 (42.98%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPK--FEGK--------LKKPKGELDI-----DIRGPEVDVDIHGNRAKGN-VDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDL--------GVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DI  P+  +   EG +K PK  +       +  PD+D ++ G K KG++D++V  P V  D     +++E  DI G +      F +P  K+P+  F+G         +K PK ++DI     DI+GPE+D+     + KG+   + F+ P+    I+ PD+D  + G K K  +++ +P     K EG  K PK E++         G K P+I +   G K                        K +  G+D+ +P                + D+DI  P++D                  +++++E P+ +I     K        +S+P+VD ++ G K K    +++P
Sbjct: 2213 VDIKAPELDIEAPEGNIKDPKLKMPSLSRPTISMPDVDFNLKGPKLKGDVDVSV--PKVQGDIKASKVELEGPDIAGPEG----GFKMPKIKMPQIGFKGPKVEGPDVDVKIPKTDIDIKAPDVDIKGPEIDIGGPEGKVKGSKFKIPFSGPN----ISMPDVDFNLKGPKLKGDVDVSVP-----KVEGNIKTPKVELEGPEIEGPEGGFKMPTIKMPKFGFK----------------------GPKVEGPGMDVKIP----------------KTDIDIKGPDVDIKA---------------LELDIEAPEGNIKDPKLKMPSLSRPTISMPDVDFNLKGPKLKGDVDVSVP 2500          

HSP 28 Score: 54.299 bits (129), Expect = 1.830e-7
Identity = 85/335 (25.37%), Postives = 145/335 (43.28%), Query Frame = 1
Query:  136 EGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGL-DFNLP--DWKLPKFEGK---LKKPKGELDI-----DIRGPEVDVDIHGNRAKGNV--DVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI---DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            EGKLK PK         ++  PD+D ++ G K KG++ +    P V+ D   P +++E  +I+G +    +  F +P   +K PK EG    +K PK E+DI     DI+GPE+D++    + KG      +F++P + +    PD+D  + G K K  +++ LP ++G                GVK P +++   DI+G +           P   +        K ++  +D+ +P   F              DLDI +PEID                      +E P+  +     K        +S+P+VD ++ G K K  F +++P
Sbjct: 3399 EGKLKGPKFNIPSISGPNISMPDVDFNLKGPKLKGDVSV----PKVEGDIKAPKVELEGPEIEGPESGFKMPKFKMPHIGFKGPKVEGPDVDVKIPKTEIDIKEPDLDIKGPELDIEGPEGKVKGPKWKMPSFSRPTVSV----PDVDFNLKGPKLKGDVDVSLPKVEG----------------GVKAPKVELEGPDIEGPEGGFK------MPKFRLPKFGFKGPKVERPDMDMKIPKADFEVK---------SPDLDIKSPEID----------------------IEGPEGKVKGPKLKMPSFPVPKISMPDVDFNLKGPKLKGDFDVSVP 3672          

HSP 29 Score: 52.7582 bits (125), Expect = 4.923e-7
Identity = 100/392 (25.51%), Postives = 178/392 (45.41%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPK-------------GEI---DLNVKNPNVDI---------------------------DFH------KPDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDI----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE---IDGKKKKHGINIGLPSMKGLKFEGKG---KKPKSEVDLGVKTPSIDI-----DIDGKKHRISGD---LSVDKPXXXXX-XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            + +D   P   + + EGKLK P+  +      ++  PD+D++++G K K             G+I   D+++K P VDI                           DF+      K D+D+ V  + G  K  G++   P++++   +GK+K  K  +      +I  P+VD ++  ++ KG+VDV+   P +E DI  P ++ E   ++G  K   INI     KG K EG     K PK+++D  +K P +D+     DI+G + ++ G    +    P   +  +D ++  +K K  +D+++P  +                ++I  P +D +G   K K    S       NV +PD   +++G K KGD++V  S+P+++ DV   K
Sbjct:  856 YDMDYKAPKHNIDRPEGKLKSPEFNMPSVSGPNISMPDVDLNLNGSKLKADVDVDVSVSKVKGDIKVPDVDIKPPKVDIKVPEVEIKGPKFNMPSISDSNNSMPNVDFNLKGQKMKSDVDVSVLKVKGDLKDPGVNIKAPNFEIEGSDGKIKDSKLSMSSISGPNISMPDVDFNLKESKLKGDVDVSV--PKVEGDIKAPKIEHEGPDLEGGFKMPKINIPKFGSKGPKMEGPDMDVKFPKTDID--IKAPDVDVKAAQLDIEGPEGKVKGSKFKMPFSGPTISMPDVDFNLKGRKMKGDVDVSIPKVEGDVKVP---------GVEIKGPRVDIEGPEGKIKGSKFSMPSISVPNVSMPDVDFNLKGSKLKGDVNV--SVPKMEGDVKAPK 1232          

HSP 30 Score: 50.447 bits (119), Expect = 2.900e-6
Identity = 54/177 (30.51%), Postives = 85/177 (48.02%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKK------HGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKG 582
            LDI  P+  +   EGK+K PK  +       +  P++D ++ G K KG++D +V  P V+ D   PD+ I   EVD++  + K       G  F+ P+  LP  +  LK PK +  +D+  P+V  DI         D   N P+++ DI         +GK K  G  + +PS+ G
Sbjct: 4827 LDIKTPEIDIEGAEGKIKGPKFRIPSVSMPKISMPEVDFNLKGPKLKGDVDFSV--PKVEGDVKAPDVHIKGPEVDVETPEGKITGSKFKGPSFSGPNISLPDVDFNLKGPKLKGGVDVSVPKVQGDIKAT------DFNINLPNIDGDIP--------EGKVK--GPKLKMPSLSG 4985          

HSP 31 Score: 49.6766 bits (117), Expect = 4.851e-6
Identity = 86/333 (25.83%), Postives = 149/333 (44.74%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG------DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDID-VHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DI  P+ K+     K K P     +  PD+D ++ G K KG++D++V  P V+ D   P ++IE  +I+G +      F +P  K+PKF  K  K +G   ++++ P+ D+DI G       DV    P  E+DI  P+ +I+ D K K   ++    SM  + F  KG K K +VD+ V  P +  DI   K  + G      +     P   +        K +   +D+ +P                + D+DI  P++D  G                ++++  P+  +  +G K K      ++S+P+VD ++ G K K    +++P
Sbjct: 2104 IDIEGPEGKVKG--SKFKIPFSGPTISMPDVDFNLKGPKLKGDVDVSV--PKVEGDIKAPKVEIEGPEIEGPEG----GFKMPTIKMPKFGFKGPKVEGP-GMEVKIPKTDIDIKGP------DVDIKAP--ELDIEAPEGNIK-DPKLKMPSLSRPTISMPDVDFNLKGPKLKGDVDVSV--PKVQGDIKASKVELEGPDIAGPEGGFKMPKIKMPQIGFKGPKVEGPDVDVKIP----------------KTDIDIKAPDVDIKGP---------------EIDIGGPEGKV--KGSKFKIPFSGPNISMPDVDFNLKGPKLKGDVDVSVP 2383          

HSP 32 Score: 49.6766 bits (117), Expect = 5.067e-6
Identity = 92/350 (26.29%), Postives = 149/350 (42.57%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV---DIHGNRAKGNV-DVTFNKPDLEI-DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDL--------GVKTPSIDIDIDG-KKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDID-VHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DI  P+ K+     K K P    ++  PD+D ++ G K KG++ +    P V  D   P +++E  +I+G +      F +P  K+PKF  K  K +G        + DIDI+GP+VD+   ++     +GN+ D     P L    I+ PD+D  + G+K K  +++ +P M     +G+ K PK E++         G K P I +   G K  ++ G D+ V  P               K  IDI  P                  D+DI  PEID                      +E P+  +  +G K K       +S+P+VD ++ G K K    +++P
Sbjct: 1408 IDIEGPEGKVKG--SKFKIPFSGPNISMPDVDFNLKGPKLKGDVSV----PKVKGDIKAPKVELEGPEIEGPEG----GFKMPTIKMPKFGFKGPKVEGPGMDVKIPKTDIDIKGPDVDIKAPELDIEAPEGNIKDPKLKMPSLSRPTISMPDVDFNLKGQKLKGDVDVSVPKM-----QGEIKAPKVELEGQDIAGPEGGFKMPKIKLPQFGFKGPKVEGPDVDVKIP---------------KTEIDIKAP------------------DVDIKGPEID----------------------IEAPEGKV--KGSKFKIPFSGPTISMPDVDFNLKGPKLKGDVDVSVP 1685          
BLAST of SMED30001359 vs. Ensembl Zebrafish
Match: si:ch211-125o16.4 (si:ch211-125o16.4 [Source:ZFIN;Acc:ZDB-GENE-131120-100])

HSP 1 Score: 64.3142 bits (155), Expect = 9.288e-11
Identity = 116/404 (28.71%), Postives = 164/404 (40.59%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDID-----FHKPDIDIEVDIDGKKKKHGLDFNLPDWKL--PKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEI-----DITKPDMDIEIDGKK-KKHGINIGLPSMKGLKFEGKG--KKPKSEV---DLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDA----------SIDIQGKKHKG--DID-----------------VHLSIPEVDIDVDGKKKKHGFGINLP 1071
            D+NL  PN+D+      +                I  P  KLPKF     K KG  D++APD+DV    K P    DLN+  PN+D+         PDIDIE      KK H   FNLP   L  PK +GK          D+  P +DV+          D+  + P+L+I     D+  PD+DIE    K KK  + +   ++ G K +G      P  +V   DL +  P++D+   G  H    D+ ++ P          +  KK H    NLP    P    K K      +LD+N PE++        K      +   D+++E P A           I++ G K KG  D+D                 V +  PE+DI+    K K  F INLP
Sbjct:  646 DLNLSAPNLDIQTPGAHVQAPDIDIEAPSAK---IKKPHVKLPKFNLSGPKIKGNADLDAPDLDV----KAP----DLNLSAPNLDVQTPGAHVEVPDIDIEAPSAKVKKPH---FNLPKMNLSGPKIKGK---------PDLDAPNLDVNAP--------DLNLSAPNLDIKTPGVDVQAPDIDIEAPSAKIKKPHVKLPKFNLSGPKIKGNADLDAPDLDVKTPDLNLSAPNLDVQTPG-AHVEVPDIDIEAPS---------AKVKKPH---FNLPKINLPGPKIKGKPDLDAPNLDVNAPELNLSAPNLDIKTPGVDVQAP-DIDIETPSAMVYKPHVNLPKINLSGPKVKGKPDLDAPTLDVNAPDLNLSAPGVDVQAPEIDIEAPSAKIKKPF-INLP 1003          

HSP 2 Score: 57.3806 bits (137), Expect = 1.796e-8
Identity = 100/374 (26.74%), Postives = 165/374 (44.12%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKP---------KGA------------LDVEAPDIDV---DIHGKKPKGEI-DLNVKNPNVDIDFHKPDIDI-EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG------NVDVTFNKPDLEIDITKPDMDIEI-DGKKKKHGINIG----LPSMKGLKFEGKGKKPKSEV---DLGVKTPSIDIDIDGKKHRISG------DLSVDK---PXXXXXXXXXVSNKK-----KKHGIDINLPNWXXXXXXXXXXXXXGQVDL---DINTPEIDFXX----XXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD 1032
            G+D+  P+  +     K+KKP         KGA             D++ PDID+   +++   PK  + D N+K+PNVD++    D+++ EVDID    K      +P +K+PKF     + K E    +  P+VD++I     KG      + D++ + P ++ DI+ P +++ + D   K    NIG     P++   K       PK+E    D  +K P +DI+    K ++        +LS  K   P+ D + D+ +S  K     K   +D+NLP         K++ S   VD+   D+ +P +          K      K +   ID+N E PD ++        G  D  LS+P   +DVD
Sbjct:  978 GVDVQAPEIDIEAPSAKIKKPFINLPKVNLKGAKMKGPDIDLNTQADLQGPDIDLKAPNLNLSAPKVNLPDANIKSPNVDLETPGIDLNVPEVDIDAPSGK----VKIPHYKMPKFGLSGPRVKTE---KVEVPDVDLNIPKAELKGLNAGVKSPDLSLSTPKIKGDISAPSLNVGLPDADLKAPTANIGGSLESPNLNISKPNVDLNLPKAEFQGPDANLKVPDVDINAPSAKPKMPHFKLPKLNLSAQKMKGPELDANTDLSLSAPKLEGELKTPAVDLNLPKADVNATLPKAEVSVPNVDIKSPDLESPSVKLKQLKIKKPKADLSVPKVQTSGIDINAEAPDLNL---SAPKIGTPDADLSLPNAGVDVD 1341          

HSP 3 Score: 56.6102 bits (135), Expect = 3.418e-8
Identity = 93/343 (27.11%), Postives = 140/343 (40.82%), Query Frame = 1
Query:  112 PDWKLPKFEGKLKKPKGALDVEAPDIDV---DIHGKKPKGEI---DLNVKNPNVDID-----FHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID-----ITKPDMDIEI-DGKKKKHGINIGLPSMKGLKFEGKGKK--PKSEV---DLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-DGKKKKHGFGINLP 1071
            P  K+PK+     K KG  D++ PD+DV   D++   P  ++   DLN+  PN+DI+        PDIDIE      KK H         K+PK      K KG  D+D   P++DV           D+    P+L +      +  PD+DIE    K KK  +N+   ++ G K +GK     P  +V   DL +  P++DI   G  H  + D+ ++ P          +  KK H   + LP +       K        DLD+  P                      D+N+  P+  +   G         H+ +P++DI+    K KK  F  NLP
Sbjct:  471 PHVKMPKWSLSGPKMKGKADLDVPDLDVKAPDLNLTTPNLDVKAPDLNLSAPNLDIETPGAHVQAPDIDIEAPSAKIKKPH--------VKMPKLNLSGPKIKGNADLD--APDLDVKAP--------DLNLTAPNLNVQTPGAHVEVPDIDIEAPSAKLKKPTVNMPKINLSGPKIKGKPDLDVPNLDVKSPDLNLSAPNLDIQTPG-AHVQAPDIDIEAPS---------AKIKKPH---VKLPKFNLSGPKIKGNADLDAPDLDVKAP----------------------DLNLSAPNLDVQTPG--------AHVEVPDIDIEAPSAKVKKPHF--NLP 750          

HSP 4 Score: 55.8398 bits (133), Expect = 5.081e-8
Identity = 101/379 (26.65%), Postives = 147/379 (38.79%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDW--------------KLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDID-----FHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEI-DGKKKKHGINIGLPSMKGLKFEGKGK--KPKSEV---DLGVKTPSID-----IDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKK 1047
            D+NL  PN+D+                    G+D+  PD               KLPKF     K KG  D++APD+DV    K P    DLN+  PN+D+         PDIDIE      KK H   FNLP   LP  + K K      ++D+  PE+      N +  N+D+        +D+  PD+DIE       K  +N+   ++ G K +GK     P  +V   DL +  P +D     IDI+    +I       KP  ++        K K   ID+N                      D+  P+ID             +     D N++ P+  ++  G        + L++PEVDID    K K
Sbjct:  776 DLNLSAPNLDIKTP-----------------GVDVQAPDIDIEAPSAKIKKPHVKLPKFNLSGPKIKGNADLDAPDLDV----KTP----DLNLSAPNLDVQTPGAHVEVPDIDIEAPSAKVKKPH---FNLPKINLPGPKIKGKPDLDAPNLDVNAPEL------NLSAPNLDIKTPG----VDVQAPDIDIETPSAMVYKPHVNLPKINLSGPKVKGKPDLDAPTLDVNAPDLNLSAPGVDVQAPEIDIEAPSAKIK------KPFINLPKVNLKGAKMKGPDIDLN-------------------TQADLQGPDIDLKAPNLNLSAPKVNLP---DANIKSPNVDLETPG--------IDLNVPEVDIDAPSGKVK 1080          

HSP 5 Score: 49.6766 bits (117), Expect = 4.650e-6
Identity = 101/392 (25.77%), Postives = 158/392 (40.31%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXH----GLDINLPDWK-------LPKFEGKLKKPKGALDVEAPDIDV---DIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID-----ITKPDMDIEIDGKK-KKHGINIGLPSMKGLKFEGKG--KKPKSEV---DLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASI----------DIQGKKHKGDI------------DVHLSIPEVDIDVDG 1035
            D+NL  PN+DV     ++            H     +DI  P  K       +PK      K KG  D++APD+DV   D++   P    +LNV+ P   ++   PDIDIE      KK        P   +PK      K KG+ D+D+  P +DV         + D+  + P+L+I      +  PD+DIE    K KK  + +   ++ G K +G      P  +V   DL +  P++D+   G  H    D+ ++ P          +  KK H    NLP         K K      +LD+N P+++        K      +   D+++E P A I          ++ G K KG+             D++LS P +D+   G
Sbjct:  502 DLNLTTPNLDVKAPDLNLSAPNLDIETPGAHVQAPDIDIEAPSAKIKKPHVKMPKLNLSGPKIKGNADLDAPDLDVKAPDLNLTAP----NLNVQTPGAHVEV--PDIDIEAPSAKLKK--------PTVNMPKINLSGPKIKGKPDLDV--PNLDVK--------SPDLNLSAPNLDIQTPGAHVQAPDIDIEAPSAKIKKPHVKLPKFNLSGPKIKGNADLDAPDLDVKAPDLNLSAPNLDVQTPG-AHVEVPDIDIEAPS---------AKVKKPH---FNLPKMNLSGPKIKGKPDLDAPNLDVNAPDLNLSAPNLDIKTPGVDVQAP-DIDIEAPSAKIKKPHVKLPKFNLSGPKIKGNADLDAPDLDVKTPDLNLSAPNLDVQTPG 855          
BLAST of SMED30001359 vs. Ensembl Zebrafish
Match: BX005403.1 (si:ch211-125o16.4 [Source:NCBI gene;Acc:566639])

HSP 1 Score: 63.5438 bits (153), Expect = 1.642e-10
Identity = 114/404 (28.22%), Postives = 163/404 (40.35%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDID-----FHKPDIDIEVDIDGKKKKHGLDFNLPDWKL--PKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEI-----DITKPDMDIEIDGKK-KKHGINIGLPSMKGLKFEGKG--KKPKSEV---DLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDA----------SIDIQGKKHKG--DID-----------------VHLSIPEVDIDVDGKKKKHGFGINLP 1071
            D+NL  PN+D+      +                I  P  KLPKF     K KG  D++APD+DV    K P    DLN+  PN+D+         PDIDIE      KK H   FNLP   +  PK +GK          D+  P +DV+          D+  + P+L+I     D+  PD+DIE    K KK  + +   ++ G K +G      P  +V   DL +  P++D+   G  H    D+ ++ P          +  KK H    NLP         K K      +LD+N PE++        K      +   D+++E P A           I++ G K KG  D+D                 V +  PE+DI+    K K  F INLP
Sbjct:  646 DLNLSAPNLDIQTPGAHVQAPDIDIEAPSAK---IKKPHVKLPKFNLSGPKIKGNADLDAPDLDV----KAP----DLNLSAPNLDVQTPGAHVEVPDIDIEAPSAKVKKPH---FNLPKMNISGPKIKGK---------PDLDAPNLDVNAP--------DLNLSAPNLDIKTPGVDVQAPDIDIEAPSAKIKKPHVKLPKFNLSGPKIKGNADLDAPDLDVKTPDLNLSAPNLDVQTPG-AHVEVPDIDIEAPS---------AKVKKPH---FNLPKINLSGPKIKGKPDLDAPNLDVNAPELNLSAPNLDIKTPGVDVQAP-DIDIETPSAMVYKPHVNLPKINLSGPKVKGKPDLDAPTLDVNAPDLNLSAPGVDVQAPEIDIEAPSAKIKKPF-INLP 1003          

HSP 2 Score: 57.3806 bits (137), Expect = 1.546e-8
Identity = 100/373 (26.81%), Postives = 166/373 (44.50%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKP---------KGA------------LDVEAPDIDV---DIHGKKPKGEI-DLNVKNPNVDIDFHKPDIDI-EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG------NVDVTFNKPDLEIDITKPDMDIEI-DGKKKKHGINIG----LPSMKGLKFEGKGKKPKSEV---DLGVKTPSIDIDIDGKKHRISG------DLSVDK---PXXXXXXXXXVSNKK----KKHGIDINLPNWXXXXXXXXXXXXXGQVDL---DINTPEIDFXX----XXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD 1032
            G+D+  P+  +     K+KKP         KGA             D++ PDID+   +++   PK  + D N+K+PNVD++    D+++ EVDID    K      +P +K+PKF     + K E    +  P+VD++I     KG      + D++ + P ++ DI+ P +++ + D   K    NIG     P++   K       PK+E    D  +K P +DI+    K ++        +LS  K   P+ D + D+++S  K    K   +D+NLP         K++ S   VD+   D+ +P +          K      K +   ID+N E PD ++        G  D  LS+P   +DVD
Sbjct:  978 GVDVQAPEIDIEAPSAKIKKPFINLPKVNLKGAKMKGPDIDLNTQADLQGPDIDLKAPNLNLSAPKVNLPDANIKSPNVDLETPGIDLNVPEVDIDAPSGK----VKIPHYKMPKFGLSGPRVKTE---KVEVPDVDLNIPKAELKGLNAGVKSPDLSLSTPKIKGDISAPSLNVGLPDADLKAPTANIGGSLESPNLNISKPNVDLNLPKAEFQGPDANLKVPDVDINAPSAKPKMPHFKLPKLNLSAQKMKGPELDANTDLNLSAPKLGELKTPAVDLNLPKADVNATLPKAEVSVPNVDIKSPDLESPSVKLKQLKIKKPKADLSVPKVQTSGIDINAEAPDLNL---SAPKIGTPDADLSLPNAGVDVD 1340          

HSP 3 Score: 57.3806 bits (137), Expect = 1.844e-8
Identity = 89/326 (27.30%), Postives = 138/326 (42.33%), Query Frame = 1
Query:  112 PDWKLPKFEGKLKKPKGALDVEAPDIDV---DIHGKKPKGEI---DLNVKNPNVDID-----FHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID-----ITKPDMDIEI-DGKKKKHGINIGLPSMKGLKFEGKGKK--PKSEV---DLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            P  K+PK+     K KG  D++ PD+DV   D++   P  ++   DLN+  PN+DI+        PDIDIE      KK H         K+PK      K KG  D+D   P++DV           D+    P+L +      +  PD+DIE    K KK  +N+   ++ G K +GK     P  +V   DL +  P++DI   G  H  + D+ ++ P          +  KK H   + LP +       K        DLD+  P+++        +            +VEVPD  I+    K K     H ++P+++I
Sbjct:  471 PHVKMPKWSLSGPKMKGKADLDVPDLDVKAPDLNLTTPNLDVKAPDLNLSAPNLDIETPGAHVQAPDIDIEAPSAKIKKPH--------VKMPKLNLSGPKIKGNADLD--APDLDVKAP--------DLNLTAPNLNVQTPGAHVEVPDIDIEAPSAKLKKPTVNMPKINLSGPKIKGKPDLDVPNLDVKSPDLNLSAPNLDIQTPG-AHVQAPDIDIEAPS---------AKIKKPH---VKLPKFNLSGPKIKGNADLDAPDLDVKAPDLNLSAPNLDVQTPG--------AHVEVPDIDIEAPSAKVKKP---HFNLPKMNI 754          

HSP 4 Score: 55.8398 bits (133), Expect = 5.170e-8
Identity = 104/383 (27.15%), Postives = 150/383 (39.16%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDW--------------KLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDID-----FHKPDIDIEVDIDGKKKKHGLDFNLPDWKL--PKFEGK--LKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEI-DGKKKKHGINIGLPSMKGLKFEGKGK--KPKSEV---DLGVKTPSID-----IDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKK 1047
            D+NL  PN+D+                    G+D+  PD               KLPKF     K KG  D++APD+DV    K P    DLN+  PN+D+         PDIDIE      KK H   FNLP   L  PK +GK  L  P    ++D+  PE+      N +  N+D+        +D+  PD+DIE       K  +N+   ++ G K +GK     P  +V   DL +  P +D     IDI+    +I       KP  ++        K K   ID+N                      D+  P+ID             +     D N++ P+  ++  G        + L++PEVDID    K K
Sbjct:  776 DLNLSAPNLDIKTP-----------------GVDVQAPDIDIEAPSAKIKKPHVKLPKFNLSGPKIKGNADLDAPDLDV----KTP----DLNLSAPNLDVQTPGAHVEVPDIDIEAPSAKVKKPH---FNLPKINLSGPKIKGKPDLDAP----NLDVNAPEL------NLSAPNLDIKTPG----VDVQAPDIDIETPSAMVYKPHVNLPKINLSGPKVKGKPDLDAPTLDVNAPDLNLSAPGVDVQAPEIDIEAPSAKIK------KPFINLPKVNLKGAKMKGPDIDLN-------------------TQADLQGPDIDLKAPNLNLSAPKVNLP---DANIKSPNVDLETPG--------IDLNVPEVDIDAPSGKVK 1080          

HSP 5 Score: 54.299 bits (129), Expect = 1.818e-7
Identity = 83/355 (23.38%), Postives = 140/355 (39.44%), Query Frame = 1
Query:  118 WKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDL---NVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKG-NVDV-----TFNKPDLEID-----ITKPDMDIEI-DGKKKKHGINIGLPSMKGLKFEGKG----------------KKPKSEV---DLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
             K P F  K+K P+  LDV A   D+++      G+I +    V  P  D+D   P++DI       K         P  K+PK    + K+K P    D+++  PEV++++   +    N+DV       + P+L+I      +  PD+DIE    K KK  + +   S+ G K +GK                   P  +V   DL +  P++DI+  G  H  + D+ ++ P          +  KK H   + +P         K        DLD+  P+++                   ++NV+ P A               H+ +P++DI+    K K    +N+P
Sbjct:  318 LKKPTFGHKVKAPEAGLDVSASKPDLNLSAPNIDGDISIPNTRVNLPKADVDVKAPNVDIHTSSTKPK--------FPTLKMPKINLHKSKVKTPDLNADLNMSSPEVEMNLPKAKLDAPNLDVKAPNLNLSAPNLDIQTPGAHVQAPDIDIEAPSAKVKKPHVKMPKWSLSGPKMKGKADLDVPDLDVKAPDLNLTTPNLDVKAPDLNLSAPNLDIETPGA-HVQAPDIDIEAPS---------AKIKKPH---VKMPKLNLSGPKIKGNADLDAPDLDVKAPDLNLTAP---------------NLNVQTPGA---------------HVEVPDIDIEAPSAKLKKPT-VNMP 620          

HSP 6 Score: 49.6766 bits (117), Expect = 4.773e-6
Identity = 101/392 (25.77%), Postives = 158/392 (40.31%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXH----GLDINLPDWK-------LPKFEGKLKKPKGALDVEAPDIDV---DIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID-----ITKPDMDIEIDGKK-KKHGINIGLPSMKGLKFEGKG--KKPKSEV---DLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASI----------DIQGKKHKGDI------------DVHLSIPEVDIDVDG 1035
            D+NL  PN+DV     ++            H     +DI  P  K       +PK      K KG  D++APD+DV   D++   P    +LNV+ P   ++   PDIDIE      KK        P   +PK      K KG+ D+D+  P +DV         + D+  + P+L+I      +  PD+DIE    K KK  + +   ++ G K +G      P  +V   DL +  P++D+   G  H    D+ ++ P          +  KK H    NLP         K K      +LD+N P+++        K      +   D+++E P A I          ++ G K KG+             D++LS P +D+   G
Sbjct:  502 DLNLTTPNLDVKAPDLNLSAPNLDIETPGAHVQAPDIDIEAPSAKIKKPHVKMPKLNLSGPKIKGNADLDAPDLDVKAPDLNLTAP----NLNVQTPGAHVEV--PDIDIEAPSAKLKK--------PTVNMPKINLSGPKIKGKPDLDV--PNLDVK--------SPDLNLSAPNLDIQTPGAHVQAPDIDIEAPSAKIKKPHVKLPKFNLSGPKIKGNADLDAPDLDVKAPDLNLSAPNLDVQTPG-AHVEVPDIDIEAPS---------AKVKKPH---FNLPKMNISGPKIKGKPDLDAPNLDVNAPDLNLSAPNLDIKTPGVDVQAP-DIDIEAPSAKIKKPHVKLPKFNLSGPKIKGNADLDAPDLDVKTPDLNLSAPNLDVQTPG 855          
BLAST of SMED30001359 vs. Ensembl Zebrafish
Match: prx (periaxin [Source:ZFIN;Acc:ZDB-GENE-030131-5790])

HSP 1 Score: 51.9878 bits (123), Expect = 8.485e-7
Identity = 66/215 (30.70%), Postives = 100/215 (46.51%), Query Frame = 1
Query:   97 LDINLPDWKLPK-FEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDID-FHKPDIDIE---------VDIDGKKKKHGLDFNLP--DWKLPKFEGKLKKPKGELDIDIRGP----------EVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHG-INIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDG 669
            LDI+LP  K  +  + K    KG    E P++DV +   KP G   +NV+ P++    FH P +DI          VD++G   K G  F +P  D  +PKF     KP G  D++++GP           VD+ + G RA+G+VDV  +          P +D+ +   K   G INI  P ++G KF      P  ++ L       D+D++G
Sbjct: 1415 LDISLPGGKAEEGVDVKAHGGKGG-KFEMPNLDVSLPKFKPSG-AKVNVEGPDIKGGKFHMPSVDISLPRGGAEGDVDVEGHGGKGG-KFEMPKLDVSMPKF-----KPSG-ADVNVKGPDIKGGKFHMPSVDISLPGGRAEGDVDVKGHG-GKGGKFEMPKLDVSLPKLKPSGGEINIEGPDIEGRKFH----MPSVDISLPKGGAGGDVDVEG 1615          
BLAST of SMED30001359 vs. Ensembl Zebrafish
Match: prx (periaxin [Source:ZFIN;Acc:ZDB-GENE-030131-5790])

HSP 1 Score: 51.9878 bits (123), Expect = 8.485e-7
Identity = 66/215 (30.70%), Postives = 100/215 (46.51%), Query Frame = 1
Query:   97 LDINLPDWKLPK-FEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDID-FHKPDIDIE---------VDIDGKKKKHGLDFNLP--DWKLPKFEGKLKKPKGELDIDIRGP----------EVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHG-INIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDG 669
            LDI+LP  K  +  + K    KG    E P++DV +   KP G   +NV+ P++    FH P +DI          VD++G   K G  F +P  D  +PKF     KP G  D++++GP           VD+ + G RA+G+VDV  +          P +D+ +   K   G INI  P ++G KF      P  ++ L       D+D++G
Sbjct: 1415 LDISLPGGKAEEGVDVKAHGGKGG-KFEMPNLDVSLPKFKPSG-AKVNVEGPDIKGGKFHMPSVDISLPRGGAEGDVDVEGHGGKGG-KFEMPKLDVSMPKF-----KPSG-ADVNVKGPDIKGGKFHMPSVDISLPGGRAEGDVDVKGHG-GKGGKFEMPKLDVSLPKLKPSGGEINIEGPDIEGRKFH----MPSVDISLPKGGAGGDVDVEG 1615          
BLAST of SMED30001359 vs. Ensembl Xenopus
Match: ENSXETT00000032614.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:41381047:41392497:-1 gene:ENSXETG00000008286.1 transcript:ENSXETT00000032614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 2.526e-13
Identity = 82/260 (31.54%), Postives = 129/260 (49.62%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-----DFHKPDIDI---EVDIDGKKKKHGL--------DFNLPDWKL----PKFEGKLKKPKGELDIDIRGPEVDVDI------------------------HGNRAKG-NVDVTFNKPDLEI-----DITKPDMDIEIDGKKKKHGINIGLPS---------MKGLKFEGKGKKPK---SEVDLGVKTPSIDID--IDGKKHRI 684
            L+++ P +K+P     +K PK    V  PD+++++ G K KG++D+ V     DI     D H P++D+   EV+IDGK K H          + ++PD+ L    PK EG+LK PK    ID++GPEVDV I                         G++ KG ++D+   + ++++     DI+ P++DIE    K K G N  +PS         +KG K EG  K PK   S  D+ ++ P +DID  + G K ++
Sbjct: 1789 LEVSSPKFKMPSLN--IKSPK----VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPTFGFSGSKVKGKDIDIALPEGEIDVSVPKLDISAPELDIECPEGKVK-GPNFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDISAPDVNLEAPDVDIDGKVKGSKFKM 2037          

HSP 2 Score: 71.633 bits (174), Expect = 7.639e-13
Identity = 109/372 (29.30%), Postives = 165/372 (44.35%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK-----GALDVEAPDIDVD--IHGKKPK------GEIDLNVKNPNVDIDFHKPDIDI----------EVDIDGKKKKHG----------LDFNLPDWKLPKFEGKLKKPKGEL---DIDIRGPEVDVD--IHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK---KKHGINIGLPSMKGLKFEGKGKKPKSEV-------------DLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASID--IQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            LD NL   K PK EG LK PK       +++EAPD+D+D  + G K K       ++D N+K P V+ D   P +DI          +VDIDGK K             LDFNL   K PK EG LK PK E+    +++  P+VDVD  + G + +       + PDL ++I  P M+ E+ G K   K    ++ +P ++    EGK K PK ++             D+ +  P  +IDI G K  IS  +L ++ P+  +              ID NL                 +++ D+  P++D                   DVN+E PD  ID  ++G K K      +S+P++ +++ G K
Sbjct: 1144 LDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKVEGDLKGPKVEIKAPKVNLEAPDVDVDGKVKGPKFEMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEFDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIECPEGKVKGPKFKMPSLHMPDIDFNL--------------KGPKLEGDLKGPKVDIQAP---------------DVNLEAPDVDIDGKVKGPKFKMPSMPKVSMPDLGLNIKGPK 1480          

HSP 3 Score: 68.1662 bits (165), Expect = 9.080e-12
Identity = 111/395 (28.10%), Postives = 181/395 (45.82%), Query Frame = 1
Query:  103 INLPDWKLPKF-----------------EGKLKKPKGALDVEAPDIDVDIHGKKPKG-----------EIDLNVKNPNVD-------IDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELD-----IDIRGPEVDVD---------IHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK---KKHGINIGLPSMKGLKFEGKGKKPK----------SEVD---LGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDI---DVHLSIPEV-----DIDVDGKKKKHGF 1056
            + +P +K+PKF                 EG++      +D+ AP +D++    K KG           +IDLN+K P V+       +D + P+I++E   VDIDGK K  G  F +P   +P  +  LK PK E D     +DI+ P+V+++         + G + K       + PDL ++I  P M+ E+ G K   K   +++ +P ++    EGK K PK          S+VD   + +K P  +ID+ G K  IS  DL+++ P+  +              ID+NL   K    S   K      ++++  P++D DG  K SK K          ++ +PD   +++G K +GD+    V ++ PEV     D+D+DGK K   F
Sbjct:  803 LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDLKGPKVDINAPEINLEAPDVDIDGKVK--GSKFKMPSLHMPDLDFNLKGPKMEGDLKGPKVDIKAPKVNLEAPDVDFDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEVDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDIKLPEGEIDVSGPKVDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKGPKVDIKAPEVNLEAPDVDIDGKVKGSKFKMP--------SLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKF 1187          

HSP 4 Score: 67.3958 bits (163), Expect = 1.609e-11
Identity = 111/374 (29.68%), Postives = 168/374 (44.92%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL-DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELD-----IDIRGPEV-----DVDIHGNRAKGN-----------VDVTFNKPDLE-------IDITKPDM-----DIEIDGKKKKHGINIGLPS---------MKGLKFEGKGKKPKSEV---DLGVKTPSIDID--IDGKKHRISGDLSVDKP-XXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL-DINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-DGKKKKHGF 1056
            +DI+ PD  +   EGK+K PK  +  +  PDID+++ G K +G    + K P VDI    P++++E   VDIDGK K  G  F +P   +P  +  LK PK E D     +DI  PEV     DVDI G + KG+           +D     P +E       +DI  P++     D++IDGK K  G    +PS         +KG K EG  K PK E+    + ++ P +D+D  + G K  +     V  P          +  + K   ID+  P +       + +  +G++ +     P+  F G     K          DV++ +P+  IDI G K      V +S PE+DI+  +GK K   F
Sbjct: 1060 VDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEG----DSKGPKVDI--KAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDG-KVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVEIKAPKVNLEAPDVDVDGKVKGPKFEMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEFDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGK----------DVDISLPEGEIDISGPK------VDISAPELDIECPEGKVKGPKF 1406          

HSP 5 Score: 66.6254 bits (161), Expect = 2.775e-11
Identity = 120/420 (28.57%), Postives = 183/420 (43.57%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK-----GALDVEAPDIDVDIHGKKPKGE-----------IDLNVKNPNVD-------IDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKF-------EGK---LKKPKGELDI-----DIRGPEVDVDIHGNRAKG-----------NVDVTFNKPDLE-------IDITKPDM-----DIEIDGKKKKHGINIGLPSM------------KGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL-----DINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDI---DVHLSIPEV-----DIDVDGKKKKHGF-----GINLP 1071
            LD NL   K PK EG LK PK       +++EAPD+DVD   K PK E           + LN+K P ++       ID   P+ D+   +V+++G + K      +P +K+PKF       +GK   +  P+GE+DI     DI  PE+D++    + KG           ++D     P LE       +DI  PD+     D++IDGK K  G    +PSM            KG K EG+ K P    ++ +K P +D+ I D +     G L +  P   +        K     +DI+LP               G++D+     DI+ PE+D +    + K            ++ +PD   +++G K +GD+    V +  PEV     D+D DGK K   F     G++LP
Sbjct: 1250 LDFNL---KGPKVEGDLKGPKVEIKAPKVNLEAPDVDVDGKVKGPKFEMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEFDVAIPDVELEGPEGK----LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIECPEGKVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKGPKVDIQAPDVNLEAPDVDIDGKVK--GPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGP----NIDMKGPEVDVAIPDVELEGPEGKLKM--PKFKMPKFGFSGLKADGKDVDISLPE--------------GEIDISGPKVDISAPELDIECPEGRVKGPKFKMP-----SLHMPDIDFNLKGPKLEGDLKAPKVDIKAPEVNLEAPDVDFDGKIKGPKFKMPSIGVSLP 1635          

HSP 6 Score: 66.2402 bits (160), Expect = 3.348e-11
Identity = 112/381 (29.40%), Postives = 177/381 (46.46%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL-DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDID-----FHKPDIDIEVDIDGKKKKHG------LDFNLPDWKLPKFEGKLKKPKGELD---IDIRGPEVDVD--IHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK---KKHGINIGLPSMKGLKFEGKGKKPK----------SEVD---LGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINL--PNWXXXXXXXXXXXXXGQVDLD-------------------INTPEIDFXXXXXXXXXXXXXXXXXI---DVNVEVPDASID--IQGKK------HKGDIDVHLSIPEVDIDVDGKK 1041
            +DI+ P   +   EGK+K PK  +  +  PDID+++ G K +G++    K P VDI+        PD+DI+  + G K K        LDFNL   K PK EG LK PK ++    +++  P+VD D  + G + K       + PDL ++I  P M+ E+ G K   K   +++ +P ++    EGK K PK          S+VD   + +K P  +ID+ G K  IS  DL+++ P+  +              ID+NL  P  +      K      +V+L+                   ++ P++DF+    K +   K  K  I   +VN+E PD  ID  ++G K      H  D+D +L  P+V+ D+ G K
Sbjct:  841 VDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDL----KGPKVDINAPEINLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKMEGDLKGPKVDIKAPKVNLEAPDVDFDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEVDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDIKLPEGEIDVSGPKVDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKGPKVDIKAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPK 1214          

HSP 7 Score: 65.855 bits (159), Expect = 4.784e-11
Identity = 87/254 (34.25%), Postives = 123/254 (48.43%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK-----GALDVEAPDIDVD--IHGKKPK------GEIDLNVKNPNVDIDFHKPDIDI----------EVDIDGKKKKHGLDFNLPDWKL---------PKFEGKLKKPK--GEL---DIDIRGPEVDV---DIHGNRAKGNVDVT-FNKPDL----------EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI---DIDIDGKKHRISGDL 696
            +D NL   K PK EG LK PK       +++EAPD+D+D  + G K K       +ID N+K P V+ D   P +DI          +VDIDGK K  G  F +P   +         PK EG LK PK  GEL   +ID++GPE +V   D+     +G + +  F  P            ++DI+ P+ +I+I G K    ++I  P +     EGK K PK       K PS+   DID++ K  ++ GDL
Sbjct:  647 IDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKMEGELKGPNIDMKGPEAEVAIPDVELEGPEGRLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPK----VDISAPKLDIECPEGKVKGPK------FKMPSLHMPDIDLNLKGPKVEGDL 885          

HSP 8 Score: 60.077 bits (144), Expect = 3.618e-9
Identity = 73/254 (28.74%), Postives = 115/254 (45.28%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL-------------------------------DVEAPDIDVDIHGKKPKG-----------EIDLNVKNPNVDIDFHKPDIDIEV--------DIDGKKKKHGLDF------NLPDWKL----PKFEGKLKKPKGELDIDIRGPEVDV---DIHGNRAKGNVDVT-FNKPDLEIDITK-PDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI 663
            +D+ +PD +L   EGKLK PK  +                               D+ AP++D++    K KG           +ID N+K P ++ D   P +DI+         D+DGK K            ++PD  L    PK EG+LK P    +ID++GPEVDV   D+     +G + +  F  P + +++ K PD+D  I   K K G +I  P ++G   + +G      +D+ +K+P IDID+
Sbjct:  167 VDVAIPDVELEGPEGKLKMPKFKMPKFGFSGSKVDGKDIDIKLPEGEIDLSAPKVDISAPELDIECPEGKVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKGPKVDIKAPEVNLEAPDVDGKVKGPKFKMPSVPKVSMPDLGLNVKGPKVEGELKGP----NIDMKGPEVDVAVPDVELEGPEGKLKMPKFKMPSVNVNLPKVPDVDFNIKSPKWKGGADISGPKLEG---DVRG------LDVEIKSPEIDIDV 407          

HSP 9 Score: 55.8398 bits (133), Expect = 8.585e-8
Identity = 89/335 (26.57%), Postives = 146/335 (43.58%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD---VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPD---WKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDI---DVHLSIPEV-----DIDVDGKKKKHGF 1056
            LDI  P+ K+   + +   PK        EAPD+DV +       + +LNV  P V+ID   P +DIE     + K  G  F +P      +P  +  +K PK +   DI GP+++ ++ G       ++    P +E+D   P +DIE    K K    + +P  K  KF   G K + + D+ +  P  ++D+ G K  IS  DL ++ P+  +              +D NL                 +V+ D+  P++D +                 +VN+E PD   +++G K +GD+    V ++ PEV     D+D+DGK K   F
Sbjct:  410 LDIGGPEAKVKNKKSRFHMPKFGFSSSKAEAPDVDVKLP------KTNLNVSGPKVNID--TPTLDIE---GPEAKVKGTKFKMPSIPKMSIPDVDLNIKSPKWK-GTDISGPKIEGELKGP------EIDIKAPKVELD--SPTLDIESPEGKGK----LKMPKFKMPKFGFSGSKVEGK-DVDITLPEGEMDVSGPKVDISAPDLDIECPEGKVKGPKFKMPSLHMPDLDFNL--------------KGPKVEGDLKGPKVDINAP---------------EVNLEAPDIDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKF 690          

HSP 10 Score: 54.6842 bits (130), Expect = 1.781e-7
Identity = 93/353 (26.35%), Postives = 149/353 (42.21%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPK-----GALDVEAPDIDVDIHGKK---------------PKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEVD-VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPS---------MKGLKFEGKGKKPKSEV---DLGVKTPSIDIDIDGKKHRISGDLSVDKP-XXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL--------DINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVP--DASIDIQGKKHKGDI---DVHLSIPEVDIDV 1029
            D KLP+ E  +  PK       ++ EAPD+D  + G K                  ++ LNVK P V+ +   P ID+        K   +D  +PD +L   EGKLK PK ++      G +VD  DI     +G +D++  K    +DI+ P++DIE    K K G    +PS         +KG K EG  K PK ++   ++ ++ P +D  + G K ++     V  P          V  + K   ID+  P         + +  +G++ +        ++N P++                   +D N++ P      DI G K +GD+   DV +  PE+DIDV
Sbjct:   85 DIKLPEVEIDVSGPKVDISAPEVNFEAPDVDGKVKGPKVDIKAPEVNLEAPDVSMPDVGLNVKGPKVEGELKGPKIDM--------KGPEVDVAIPDVELEGPEGKLKMPKFKMPKFGFSGSKVDGKDIDIKLPEGEIDLSAPK----VDISAPELDIECPEGKVK-GPKFKMPSLHMPDIDFNLKGPKLEGDLKGPKVDIKAPEVNLEAPDVDGKVKGPKFKMPSVPKVSMPDLGLNVKGPKVEGELKGPNIDMKGPEVDVAVPDVELEGPEGKLKMPKFKMPSVNVNLPKV-----------------PDVDFNIKSPKWKGGADISGPKLEGDVRGLDVEIKSPEIDIDV 407          

HSP 11 Score: 54.299 bits (129), Expect = 2.443e-7
Identity = 74/243 (30.45%), Postives = 119/243 (48.97%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPK-----GALDVEAPDIDVDIHGKKPK---------GEIDLNVKNPNVD-------IDFHKPDIDI---EVDIDG--------KKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI-----EIDGKKKK-HGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI-----DIDGKKHRISG 690
            H  DI+  + K PK EG LK PK       +++EAPD+D  + G K K          ++ LNVK P V+       ID   P++D+   +V+++G        K K   ++ NLP  K+P  +  +K PK +   DI GP+++ D+ G      +DV    P+++ID+  PD+DI     ++  KK + H    G  S K    +   K PK+  +L V  P ++I     DI+G + ++ G
Sbjct:  248 HMPDIDF-NLKGPKLEGDLKGPKVDIKAPEVNLEAPDVDGKVKGPKFKMPSVPKVSMPDLGLNVKGPKVEGELKGPNIDMKGPEVDVAVPDVELEGPEGKLKMPKFKMPSVNVNLP--KVPDVDFNIKSPKWKGGADISGPKLEGDVRG------LDVEIKSPEIDIDV--PDLDIGGPEAKVKNKKSRFHMPKFGFSSSKAEAPDVDVKLPKT--NLNVSGPKVNIDTPTLDIEGPEAKVKG 477          

HSP 12 Score: 52.373 bits (124), Expect = 9.426e-7
Identity = 84/323 (26.01%), Postives = 141/323 (43.65%), Query Frame = 1
Query:  109 LPDWKLPKFEGKLKKPKGA-LDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKL----PKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +P +K+PKF     K  G  +D++ P++++D+ G  PK +I   ++N + P+VD     P +DI   EV+++        D ++PD  L    PK EG+LK PK    ID++GPEVDV I                           D+E++G + K    + +P  K  KF   G K   + D+ +K P  +ID+   K  IS  +L ++ P+  +              ID NL                 +++ D+  P++D                   +VN+E PD    ++G K K      +S+P++ ++V G K
Sbjct:   64 MPKFKMPKFGFSGSKVDGKDVDIKLPEVEIDVSG--PKVDISAPEVNFEAPDVDGKVKGPKVDIKAPEVNLEAP------DVSMPDVGLNVKGPKVEGELKGPK----IDMKGPEVDVAIP--------------------------DVELEGPEGK----LKMPKFKMPKFGFSGSKVDGK-DIDIKLPEGEIDLSAPKVDISAPELDIECPEGKVKGPKFKMPSLHMPDIDFNL--------------KGPKLEGDLKGPKVDIKAP---------------EVNLEAPDVDGKVKGPKFKMPSVPKVSMPDLGLNVKGPK 314          

HSP 13 Score: 50.447 bits (119), Expect = 3.958e-6
Identity = 103/394 (26.14%), Postives = 167/394 (42.39%), Query Frame = 1
Query:   91 HGLDINLPDWKL--PKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNV----DIDFHKPDIDIEV-------------------------DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNK-----PDLEIDITKPDMD-----IEIDGKKKKHGI--------NIGLP----SMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVD-----LDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDI----------DVHLSIPEVDIDVDGKKKKHGF 1056
             G+ + +PD K+  PKF        KP  +        ++D+ G K KG++DL+V   +     D+    P+ID+E+                         + D K     L+ + P +K+P     +K PK      +  P+V++++ G + KG++DV   K      DL+ DI  P++D     + IDGK K H           + +P    ++KG K EG+ K PK    + +K P +D+ I D +     G L +  P   +       +K K   IDI LP               G++D     LDI+ PE+D +    K K  N         ++ +PD   +++G K +GD+          DV+L  P  D+D+DGK K   F
Sbjct: 1683 SGVSVEVPDSKIKGPKFKLPSWGFSKPSNS------GTEIDMKGPKIKGDVDLSVSKGSSLKGSDLTVSGPNIDLEMPEGKVKKSKFKFPKFNFSSPKAQIPETDVKIANTDLEVSSPKFKMPSLN--IKSPK------VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKM--PKFKMPTFGFSGSKVKGKDIDIALPE--------------GEIDVSVPKLDISAPELDIECPEGKVKGPNFKMP-----SLHMPDIDFNLKGPKVEGDLKGPKVDISAPDVNLEAP--DVDIDGKVKGSKF 2035          
BLAST of SMED30001359 vs. Ensembl Xenopus
Match: ENSXETT00000017745.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:41381047:41388699:-1 gene:ENSXETG00000008286.1 transcript:ENSXETT00000017745.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 2.666e-13
Identity = 82/260 (31.54%), Postives = 129/260 (49.62%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-----DFHKPDIDI---EVDIDGKKKKHGL--------DFNLPDWKL----PKFEGKLKKPKGELDIDIRGPEVDVDI------------------------HGNRAKG-NVDVTFNKPDLEI-----DITKPDMDIEIDGKKKKHGINIGLPS---------MKGLKFEGKGKKPK---SEVDLGVKTPSIDID--IDGKKHRI 684
            L+++ P +K+P     +K PK    V  PD+++++ G K KG++D+ V     DI     D H P++D+   EV+IDGK K H          + ++PD+ L    PK EG+LK PK    ID++GPEVDV I                         G++ KG ++D+   + ++++     DI+ P++DIE    K K G N  +PS         +KG K EG  K PK   S  D+ ++ P +DID  + G K ++
Sbjct: 1008 LEVSSPKFKMPSLN--IKSPK----VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPTFGFSGSKVKGKDIDIALPEGEIDVSVPKLDISAPELDIECPEGKVK-GPNFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDISAPDVNLEAPDVDIDGKVKGSKFKM 1256          

HSP 2 Score: 67.3958 bits (163), Expect = 1.674e-11
Identity = 103/372 (27.69%), Postives = 168/372 (45.16%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL-DVEAPDIDVDIHGKKPKGEI----------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHG------LDFNLPDWKLPKFEGKLKKPKGEL---DIDIRGPEVDVD--IHGNRAK------GNVDVTFNKPDLEIDITKPDMDIEIDGKK---KKHGINIGLPSMKGLKFEGKGKKPKSEV-------------DLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINL--PNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDI----------QGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +DI+ PD  +   EGK+K PK  +  +  PDID+++ G K +G+           ++N++ P+VDID    D+DI+  + G K K        LDFNL   K PK EG LK PK ++   ++++  P+VD+D  + G++ K       ++D     P +E D+  P M+ E+ G K   K    ++ +P ++    EGK K PK ++             D+ +  P  +IDI G K  IS  +L ++ P+  +              ID NL  P  +      K +      ++D+  PE+D                   DV +E P+  + +           G K  G  DV +S+PE +ID+ G K
Sbjct:  417 VDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKGPKVDIKAPEVNLEAPDVDIDGKVKDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKMEGELKGPKIDMKGPEFDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIECPEGKVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKGPKMEGELKGPNIDMKGPEVDVAIP---------------DVELEGPEGKLKMPKFKMPKFGFSGLKADGK-DVDISLPEGEIDISGPK 769          

HSP 3 Score: 65.4698 bits (158), Expect = 5.956e-11
Identity = 83/216 (38.43%), Postives = 116/216 (53.70%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDI-----DVDIHG------KKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPS---------MKGLKFEGKGKKPKSEVDLG-VKTPSIDIDIDGK 672
            +D NL   K PK EG LK PK  +D++AP++     DVD+ G      K PK E DL  K P VDI  + P++ +E   VDIDGK K  G  F +P   +P  +  LK PK  ++ D++GP+V+ D+ G +      V  N P  E+++  PD+D  IDGK K  G    +PS         +KG K EG  K PK +++   V   + D+DIDGK
Sbjct:    4 IDFNL---KGPKVEGDLKGPK--VDIKAPEVNLEAPDVDVDGKVKGDLKGPKVEGDL--KGPKVDI--NAPEVKLEGPDVDIDGKVK--GSKFKMPSLHMPDLDFNLKGPK--VEGDLKGPKVEGDLKGPK------VDINAP--EVNLEAPDVD--IDGKVK--GSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGK 194          

HSP 4 Score: 59.6918 bits (143), Expect = 4.939e-9
Identity = 112/372 (30.11%), Postives = 163/372 (43.82%), Query Frame = 1
Query:  100 DINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI-EVDIDGKKKK----HGLDFNLPDWKLPKFEGKLKKPK--GEL---DIDIRGPEVDV---DIHGNRAKGNVDVT-FNKPDL----------EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLD------------INTPEIDFXXXXXXXXXXXXXXXXXI---DVNVEVPDASID--IQGKK------HKGDIDVHLSIPEVDIDVDGKK 1041
            ++ +PD +L   EG+LK PK          L  +  D+D+ +    P+GEID++   P VDI   K DI+  E  + G K K    H  D +L + K PK EG LK PK  GEL    ID++GPEVDV   D+     +G + +  F  P            EIDI  P+ +I++ G K    ++I  P +     EGK K PK       K PS+   DID++ K  ++ GD                    K   +DI  P                 VD+D            ++ P++DF+    K +   K  K  I   +VN+E PD  ID  ++G K      H  D+D +L  P+V+ D+ G K
Sbjct:  245 EVAIPDVELEGPEGRLKMPKFKMPKFGFSGLKADGKDVDISL----PEGEIDIS--GPKVDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDL-NLKGPKVEGDLKGPKMEGELKGPKIDMKGPEVDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDIKLPEGEIDVSGPK----VDISAPDLNMECPEGKVKGPK------FKMPSLHMPDIDLNLKGPKVEGD-------------------SKGPKVDIKAPEVNLEAPDVDIDGKVKDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPK 580          

HSP 5 Score: 55.4546 bits (132), Expect = 1.095e-7
Identity = 99/348 (28.45%), Postives = 166/348 (47.70%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDV---DIHGKKPKGEIDL-NVKNPNVDIDFHKP---DIDI-----EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL--------DIDIRGPEVDVDIHGNRAKGNV---DVTFNKPDLEIDITKPDMDIE-IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDV-NVEVPDASIDIQGKKHKGDI---DVHLSIPEV-----DIDVDGKKKKHGF 1056
            D K PK EG+LK P   +D++ P+ +V   D+  + P+G + +   K P       K    D+DI     E+DI G K    +D + P   +   EGK+K PK ++        D++++GP+V+ D+ G + +G +    +    P  E+D+  PD+++E  +GK K     +      G K +GK      E+D  +K P  +ID+ G K  IS  DL+++ P+  +              ID+NL   K    S   K      ++++  P++D DG  K      K K  K  + ++ +PD   +++G K +GD+    V ++ PEV     D+D+DGK K   F
Sbjct:  222 DLKGPKMEGELKGPN--IDMKGPEAEVAIPDVELEGPEGRLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPK----VDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDLKGPKMEGELKGPKIDMKGP--EVDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGK------EID--IKLPEGEIDVSGPKVDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKGPKVDIKAPEVNLEAPDVDIDGKVKDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKF 553          

HSP 6 Score: 54.299 bits (129), Expect = 2.273e-7
Identity = 100/355 (28.17%), Postives = 153/355 (43.10%), Query Frame = 1
Query:  103 INLPDWKLPKF-----------------EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-DFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPK--GEL---DIDIRGPEVDV---DIHGNRAKGNVDVT-FNKPDL----------EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKK 1047
            + +P +K+PKF                 EG++      +D+ AP++D++     P+G+    VK P   +   H PDI               DFNL   K PK EG LK PK  GEL   +ID++GPEVDV   D+     +G + +  F  P            ++DI+ P+ +I+I G K    ++I  P +     EG+ K PK       K PS+   DID + K  ++ GDL   K                   +DI  P                  ++++  P++DFDG  K  K K  S    +   V +P+   +++G K KGDID    +PEV+++ D K  K
Sbjct:  613 LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIEC----PEGK----VKGPKFKMPSLHMPDI---------------DFNL---KGPKLEGDLKGPKMEGELKGPNIDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPK----VDISAPELDIECPEGRVKGPK------FKMPSLHMPDIDFNLKGPKLEGDLKAPK-------------------VDIKAP------------------EVNLEAPDVDFDGKIKGPKFKMPSIGVSLP-KVSIPETDHNVKGPKFKGDID----LPEVNLEADLKPTK 889          

HSP 7 Score: 51.6026 bits (122), Expect = 1.541e-6
Identity = 90/301 (29.90%), Postives = 129/301 (42.86%), Query Frame = 1
Query:  223 EIDLNVKNPNVDIDFHKPDIDI----------EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV---DLGVKTPSIDID--IDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASID--IQGKK------HKGDIDVHLSIPEVDIDVDGKK 1041
            +ID N+K P V+ D   P +DI          +VD+DGK K         D K PK EG LK PK    +DI  PEV     DVDI G + KG+    F  P L +    PD+D  + G K +         +KG K EG  K PK ++   ++ ++ P +DID  + G K ++    S+  PD                 ID NL                 +V+ D+  P++D +                 +VN+E PD  ID  ++G K      H  DID +L  P+V+ D+ G K
Sbjct:    3 DIDFNLKGPKVEGDLKGPKVDIKAPEVNLEAPDVDVDGKVKG--------DLKGPKVEGDLKGPK----VDINAPEVKLEGPDVDIDG-KVKGS---KFKMPSLHM----PDLDFNLKGPKVEG-------DLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMP---SLHMPD-----------------IDFNLKGP--------------KVEGDLKGPKVDINAP---------------EVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPK 227          

HSP 8 Score: 50.447 bits (119), Expect = 3.605e-6
Identity = 89/381 (23.36%), Postives = 150/381 (39.37%), Query Frame = 1
Query:  103 INLPDWKLPKF-----------------EGKLKKPKGALDVEAPDIDVDIHGKKPKG-----------EIDLNVKNPNVDIDFHKPDIDI----------EVDIDG-----KKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLS--------------IPEVD-----IDVDGKKKKHGF 1056
            + +P +K+PKF                 EG++      +D+ AP++D++    + KG           +ID N+K P ++ D   P +DI          +VD DG     K K   +  +LP   +P+ +  +K PK + DID+    ++ D+   + K   D     P   + +  PD  I+   K K        PS  G + + KG K K +VDL V   S    + G    +SG ++ ++ P+  +        K         +P                  DL++++P+        KS              V +PD  ++++G K KGD+DV +                PEVD     +++DGK K H F
Sbjct:  732 LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIECPEGRVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKAPKVDIKAPEVNLEAPDVDFDGKIKGPKFKMPSIGVSLPKVSIPETDHNVKGPKFKGDIDLPEVNLEADLKPTKVKTK-DPEVKFPSSGVSVEVPDSKIK-GPKFKLPSWGFSKPSNSGTEIDMKGPKIKGDVDLSVSKGS---SLKGSDLTVSGPNIDLEMPEGKVKKSKFKFPKFNFSSPKAQIPET---------DVKIANTDLEVSSPKFKMPSLNIKSP------------KVSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKF 1086          

HSP 9 Score: 50.0618 bits (118), Expect = 4.409e-6
Identity = 103/394 (26.14%), Postives = 167/394 (42.39%), Query Frame = 1
Query:   91 HGLDINLPDWKL--PKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNV----DIDFHKPDIDIEV-------------------------DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNK-----PDLEIDITKPDMD-----IEIDGKKKKHGI--------NIGLP----SMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVD-----LDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDI----------DVHLSIPEVDIDVDGKKKKHGF 1056
             G+ + +PD K+  PKF        KP  +        ++D+ G K KG++DL+V   +     D+    P+ID+E+                         + D K     L+ + P +K+P     +K PK      +  P+V++++ G + KG++DV   K      DL+ DI  P++D     + IDGK K H           + +P    ++KG K EG+ K PK    + +K P +D+ I D +     G L +  P   +       +K K   IDI LP               G++D     LDI+ PE+D +    K K  N         ++ +PD   +++G K +GD+          DV+L  P  D+D+DGK K   F
Sbjct:  902 SGVSVEVPDSKIKGPKFKLPSWGFSKPSNS------GTEIDMKGPKIKGDVDLSVSKGSSLKGSDLTVSGPNIDLEMPEGKVKKSKFKFPKFNFSSPKAQIPETDVKIANTDLEVSSPKFKMPSLN--IKSPK------VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKM--PKFKMPTFGFSGSKVKGKDIDIALPE--------------GEIDVSVPKLDISAPELDIECPEGKVKGPNFKMP-----SLHMPDIDFNLKGPKVEGDLKGPKVDISAPDVNLEAP--DVDIDGKVKGSKF 1254          
BLAST of SMED30001359 vs. Ensembl Xenopus
Match: ENSXETT00000017705.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:41381047:41386344:-1 gene:ENSXETG00000008286.1 transcript:ENSXETT00000017705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 2.900e-13
Identity = 82/260 (31.54%), Postives = 129/260 (49.62%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-----DFHKPDIDI---EVDIDGKKKKHGL--------DFNLPDWKL----PKFEGKLKKPKGELDIDIRGPEVDVDI------------------------HGNRAKG-NVDVTFNKPDLEI-----DITKPDMDIEIDGKKKKHGINIGLPS---------MKGLKFEGKGKKPK---SEVDLGVKTPSIDID--IDGKKHRI 684
            L+++ P +K+P     +K PK    V  PD+++++ G K KG++D+ V     DI     D H P++D+   EV+IDGK K H          + ++PD+ L    PK EG+LK PK    ID++GPEVDV I                         G++ KG ++D+   + ++++     DI+ P++DIE    K K G N  +PS         +KG K EG  K PK   S  D+ ++ P +DID  + G K ++
Sbjct: 1025 LEVSSPKFKMPSLN--IKSPK----VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPTFGFSGSKVKGKDIDIALPEGEIDVSVPKLDISAPELDIECPEGKVK-GPNFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDISAPDVNLEAPDVDIDGKVKGSKFKM 1273          

HSP 2 Score: 67.3958 bits (163), Expect = 1.330e-11
Identity = 108/396 (27.27%), Postives = 173/396 (43.69%), Query Frame = 1
Query:  103 INLPDWKLPKF-----------------EGKLKKPKGALDVEAPDIDVDIHGKKPKG-----------EIDLNVKNPNVD-------IDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELD-----IDIRGPEVDVD---------IHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK---KKHGINIGLPSMKGLKFEGKGKKPK----------SEVDL-----GVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLP--NWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASID--IQGKK------HKGDIDVHLSIPEVDIDVDGKK 1041
            + +P +K+PKF                 EG++      +D+ AP +D++    K KG           +IDLN+K P V+       +D + P+I++E   VDIDGK K  G  F +P   +P  +  LK PK E D     +DI+ P+V+++         + G + K       + PDL ++I  P M+ E+ G K   K   +++ +P ++    EGK K PK          S+VD+     G K PS+   D+D + K  ++ GDL   K                   +DIN P  N + P      K    +V+ D+  P++D +                 +VN+E PD  ID  ++G K      H  D+D +L  P+V+ D+ G K
Sbjct:  189 LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDLKGPKVDINAPEINLEAPDVDIDGKVK--GSKFKMPSLHMPDLDFNLKGPKMEGDLKGPKVDIKAPKVNLEAPDVDFDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEVDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDVEGDSKGPKMPSLHMPDLDFNLKGPKVEGDLKGPK-------------------VDINAPEVNLEAPDVDIDGKVKGPKVEGDLKGPKVDINAP---------------EVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPK 548          

HSP 3 Score: 66.2402 bits (160), Expect = 3.526e-11
Identity = 117/408 (28.68%), Postives = 179/408 (43.87%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK-----GALDVEAPDIDVDIHGKKPKGE-----------IDLNVKNPNVD-------IDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKF-------EGK---LKKPKGELDI-----DIRGPEVDVDIHGNRAKG-----------NVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSM------------KGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL-----DINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDI---DVHLSIPEV-----DIDVDGKKKKHGF-----GINLP 1071
            LD NL   K PK EG LK PK       +++EAPD+DVD   K PK E           + LN+K P ++       ID   P+ D+   +V+++G + K      +P +K+PKF       +GK   +  P+GE+DI     DI  PE+D++    + KG           ++D     P LE D+     D++IDGK K  G    +PSM            KG K EG+ K P    ++ +K P +D+ I D +     G L +  P   +        K     +DI+LP               G++D+     DI+ PE+D +    + K            ++ +PD   +++G K +GD+    V +  PEV     D+D DGK K   F     G++LP
Sbjct:  531 LDFNL---KGPKVEGDLKGPKVEIKAPKVNLEAPDVDVDGKVKGPKFEMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEFDVAIPDVELEGPEGK----LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIECPEGKVKGPKFKMPSLHMPDIDFNLKGPKLEGDLK----DVDIDGKVK--GPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGP----NIDMKGPEVDVAIPDVELEGPEGKLKM--PKFKMPKFGFSGLKADGKDVDISLPE--------------GEIDISGPKVDISAPELDIECPEGRVKGPKFKMP-----SLHMPDIDFNLKGPKLEGDLKAPKVDIKAPEVNLEAPDVDFDGKIKGPKFKMPSIGVSLP 900          

HSP 4 Score: 56.6102 bits (135), Expect = 4.548e-8
Identity = 83/290 (28.62%), Postives = 131/290 (45.17%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK----------GALDVEA------------PDIDVDIHGKKPKGEI----------DLNVKNPNVDI------------------DFHKPDIDIE---VDIDGKKKKHG----------LDFNLPDWKLPKFEGKLKKPKGEL---DIDIRGPEVDVD--IHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK---KKHGINIGLPSMKGLKFEGKGKKPKSEV-------------DLGVKTPSIDIDIDGKKHRISG-DLSVDKP 711
            +D+ +PD +L   EGK+K PK            +DVE             PD+D ++ G K +G++          ++N++ P+VDI                  D + P++++E   VDIDGK K             LDFNL   K PK EG LK PK E+    +++  P+VDVD  + G + +       + PDL ++I  P M+ E+ G K   K    ++ +P ++    EGK K PK ++             D+ +  P  +IDI G K  IS  +L ++ P
Sbjct:  392 VDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDVEGDSKGPKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKVEGDLKGPKVEIKAPKVNLEAPDVDVDGKVKGPKFEMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEFDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIECP 678          

HSP 5 Score: 53.9138 bits (128), Expect = 2.740e-7
Identity = 70/228 (30.70%), Postives = 109/228 (47.81%), Query Frame = 1
Query:   97 LDINLPDWKLPKFE---------GKLKKPKGAL----DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI-EVDIDGKKKKHGLDFNLPDWKLPKF-------EGK---LKKPKGELDI-----DIRGPEVDVDIHGNRAKG-----------NVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV-DLGVKTPSIDI 657
            +D NL   K PK E         GK+K PK  +     V  PD+ ++I G K +GE+    K PN+D+   + D+ I +V+++G + K      +P +K+PKF       +GK   +  P+GE+DI     DI  PE+D++    R KG           ++D     P LE D+  P +DI      K   +N+  P    + F+GK K PK ++  +GV  P + I
Sbjct:  697 IDFNL---KGPKLEGDLKDVDIDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGEL----KGPNIDMKGPEVDVAIPDVELEGPEGK----LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIECPEGRVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKAPKVDI------KAPEVNLEAPD---VDFDGKIKGPKFKMPSIGVSLPKVSI 904          

HSP 6 Score: 52.7582 bits (125), Expect = 7.458e-7
Identity = 112/387 (28.94%), Postives = 162/387 (41.86%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEV---DIDGKKKKHG------LDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEV-----DVDIHGNRAKG------NVDVTFNK------------PDLEIDITKPDMDIEIDGKKKKHGI---NIGLPSMKGLKFE---GKGKKPKSEV-DLGVKTPS-IDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLS--------------IPEVD-----IDVDGKKKKHGF 1056
            +D+ +PD +L   EGKLK PK          L  +  D+D+ +    P+GEID++   P VDI    P++DIE     + G K K        +DFNL   K PK EG LK PK    +DI+ PEV     DVD  G + KG      ++ V+  K            P  + DI  P++++E D K  K       +  PS  G+  E    K K PK ++   G   PS    +ID K  +I GD  V K           S K +    D+ + N                 DL++++P+        KS              V +PD  ++++G K KGD+DV +                PEVD     +++DGK K H F
Sbjct:  762 VDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISL----PEGEIDIS--GPKVDI--SAPELDIECPEGRVKGPKFKMPSLHMPDIDFNL---KGPKLEGDLKAPK----VDIKAPEVNLEAPDVDFDG-KIKGPKFKMPSIGVSLPKVSIPETDHNVKGPKFKGDIDLPEVNLEADLKPTKVKTKDPEVKFPS-SGVSVEVPDSKIKGPKFKLPSWGFSKPSNSGTEIDMKGPKIKGDGKVKKSKFKFPKFNFSSPKAQIPETDVKIAN----------------TDLEVSSPKFKMPSLNIKSP------------KVSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKF 1103          
BLAST of SMED30001359 vs. Ensembl Xenopus
Match: ENSXETT00000017926.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:41381047:41392497:-1 gene:ENSXETG00000008286.1 transcript:ENSXETT00000017926.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 3.044e-13
Identity = 82/260 (31.54%), Postives = 129/260 (49.62%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-----DFHKPDIDI---EVDIDGKKKKHGL--------DFNLPDWKL----PKFEGKLKKPKGELDIDIRGPEVDVDI------------------------HGNRAKG-NVDVTFNKPDLEI-----DITKPDMDIEIDGKKKKHGINIGLPS---------MKGLKFEGKGKKPK---SEVDLGVKTPSIDID--IDGKKHRI 684
            L+++ P +K+P     +K PK    V  PD+++++ G K KG++D+ V     DI     D H P++D+   EV+IDGK K H          + ++PD+ L    PK EG+LK PK    ID++GPEVDV I                         G++ KG ++D+   + ++++     DI+ P++DIE    K K G N  +PS         +KG K EG  K PK   S  D+ ++ P +DID  + G K ++
Sbjct: 1507 LEVSSPKFKMPSLN--IKSPK----VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPTFGFSGSKVKGKDIDIALPEGEIDVSVPKLDISAPELDIECPEGKVK-GPNFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDISAPDVNLEAPDVDIDGKVKGSKFKM 1755          

HSP 2 Score: 70.0922 bits (170), Expect = 2.011e-12
Identity = 103/356 (28.93%), Postives = 158/356 (44.38%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK-----GALDVEAPDIDVD--IHGKKPK------GEIDLNVKNPNVDIDFHKPDIDIEVDIDGKK---KKHGLDFNLPDWKLPKFEGKLKKPKGEL-------------DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPS---------MKGLKFEGKGKKPKSEV---DLGVKTPSIDID--IDGKKHRISGDLSVDKP-XXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL-DINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            LD NL   K PK EG LK PK       +++EAPD+D+D  + G K K       ++D N+K P V+ D   P ++I+ ++ G K   K    D  +PD +L   EGKLK PK ++             D+DI  PE ++DI G +               +DI+ P++DIE    K K G    +PS         +KG K EG  K PK ++   D+ ++ P +DID  + G K ++     V  P          +  + K   ID+  P         + +  +G++ +     P+  F G     K          DV++ +P+  IDI G K      V +S PE+DI+ 
Sbjct:  960 LDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVEIKGELKGPKIDMKGPEFDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPK---------------VDISAPELDIECPEGKVK-GPKFKMPSLHMPDIDFNLKGPKLEGDLKGPKVDIQAPDVNLEAPDVDIDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGPNIDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGK----------DVDISLPEGEIDISGPK------VDISAPELDIEC 1280          

HSP 3 Score: 69.707 bits (169), Expect = 2.753e-12
Identity = 105/369 (28.46%), Postives = 163/369 (44.17%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL-DVEAPDIDVDIHGKKPKGEI-DLNVKNPNVDIDFHKPDIDI----------EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELD-----IDIRGPEV-----DVDIHGNRAKGN-----------VDVTFNKPDLEIDITKPDMDI--EIDGKK---KKHGINIGLPSMKGLKFEGKGKKPKSEV-------------DLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASID--IQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +DI+ PD  +   EGK+K PK  +  +  PDID+++ G K +G+  D N+K P V+ D   P +DI          +VDIDGK K  G  F +P   +P  +  LK PK E D     +DI  PEV     DVDI G + KG+           +D     P +E D+  P ++I  E+ G K   K    ++ +P ++    EGK K PK ++             D+ +  P  +IDI G K  IS  +L ++ P+  +              ID NL                 +++ D+  P++D                   DVN+E PD  ID  ++G K K      +S+P++ +++ G K
Sbjct:  862 VDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDG-KVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVEIKGELKGPKIDMKGPEFDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIECPEGKVKGPKFKMPSLHMPDIDFNL--------------KGPKLEGDLKGPKVDIQAP---------------DVNLEAPDVDIDGKVKGPKFKMPSMPKVSMPDLGLNIKGPK 1198          

HSP 4 Score: 65.855 bits (159), Expect = 5.560e-11
Identity = 87/254 (34.25%), Postives = 123/254 (48.43%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK-----GALDVEAPDIDVD--IHGKKPK------GEIDLNVKNPNVDIDFHKPDIDI----------EVDIDGKKKKHGLDFNLPDWKL---------PKFEGKLKKPK--GEL---DIDIRGPEVDV---DIHGNRAKGNVDVT-FNKPDL----------EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI---DIDIDGKKHRISGDL 696
            +D NL   K PK EG LK PK       +++EAPD+D+D  + G K K       +ID N+K P V+ D   P +DI          +VDIDGK K  G  F +P   +         PK EG LK PK  GEL   +ID++GPE +V   D+     +G + +  F  P            ++DI+ P+ +I+I G K    ++I  P +     EGK K PK       K PS+   DID++ K  ++ GDL
Sbjct:  529 IDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKMEGELKGPNIDMKGPEAEVAIPDVELEGPEGRLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPK----VDISAPKLDIECPEGKVKGPK------FKMPSLHMPDIDLNLKGPKVEGDL 767          

HSP 5 Score: 62.003 bits (149), Expect = 7.881e-10
Identity = 111/364 (30.49%), Postives = 167/364 (45.88%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGA-LDVEAPDIDVDIHGKK-----PKGEIDL---NVKNPNVDI-DFHKPDIDI------------EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV---DIHGNRAKGNVDVT-FNKPDL----------EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKK-HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLP--NWXXXXXXXXXXXXXGQVDL-DINTPEIDFXXXXXXXXXXXXXXXXXI---DVNVEVPDASID--IQGKK------HKGDIDVHLSIPEVDIDVDGKK 1041
            + +P +K+PKF     K  G  +D+  P+ ++DI G K     PK +I+     VK P   +   H PDID+            +VD DGK K    D  L + K PK EG+LK PK    ID++GPEVDV   D+     +G + +  F  P            EIDI  P+ +I++ G K    ++I  P +     EGK K PK ++   +  P ID+++ G K    S D ++  P         V    K   +DIN P  N + P      K    +  +  ++ P++DF+    K +   K  K  I   +VN+E PD  ID  ++G K      H  D+D +L  P+V+ D+ G K
Sbjct:  685 LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDLKDVDFDGKVKVSMPDLGL-NIKGPKMEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDIKLPEGEIDVSGPK----VDISAPDLNMECPEGKVKGPKFKMP-SLHMPDIDLNLKGPKVEGDSKDFNLKGPK--------VEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPK 1030          

HSP 6 Score: 59.6918 bits (143), Expect = 5.247e-9
Identity = 103/356 (28.93%), Postives = 167/356 (46.91%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL--------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGE---LDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPS---------MKGLKFEGKGKKPKSEV---DLGVKTPSIDID--IDGKKHRISG------DLSVDKPXXX---XXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL-DINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-DGKKKKHGF 1056
            +D+ +PD +L   EGK+K PK  +         V+  +ID+    K P+GEID  V  P VDI    PD+++E   +GK K  G  F +P   +P  +  LK PK E    D +++GP+V+ D+ G +      V  N P  E+++  PD+D  IDGK K  G    +PS         +KG K EG  K PK ++   ++ ++ P +DID  + G K ++        D ++  P  +       +++  + K   ID+  P +       + +  +G++ +     P+  F G     K          DV++ +P+  IDI G K      V +S PE+DI+  +GK K   F
Sbjct:  808 VDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDI----KLPEGEID--VSGPKVDI--SAPDLNMECP-EGKVK--GPKFKMPSLHMPDIDLNLKGPKVEGDSKDFNLKGPKVEGDLKGPK------VDINAP--EVNLEAPDVD--IDGKVK--GSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVEIKGELKGPKIDMKGPEFDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGK----------DVDISLPEGEIDISGPK------VDISAPELDIECPEGKVKGPKF 1124          

HSP 7 Score: 59.3066 bits (142), Expect = 5.783e-9
Identity = 76/240 (31.67%), Postives = 114/240 (47.50%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDV--EAPDIDVDIHGKKPK-----------GEIDLNVKNPNVD-------IDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKF-------EGK---LKKPKGELDI-----DIRGPEVDVDIHGNRAKG-----------NVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV-DLGVKTPSIDI 657
            +D NL   K PK EG LK PK    A DV  EAPD+D+D   K PK            ++ LN+K P ++       ID   P++D+   +V+++G + K      +P +K+PKF       +GK   +  P+GE+DI     DI  PE+D++    R KG           ++D     P LE D+  P +DI      K   +N+  P    + F+GK K PK ++  +GV  P + I
Sbjct: 1134 IDFNL---KGPKLEGDLKGPKVDIQAPDVNLEAPDVDIDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGPNIDMKGPEVDVAIPDVELEGPEGK----LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIECPEGRVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKAPKVDI------KAPEVNLEAPD---VDFDGKIKGPKFKMPSIGVSLPKVSI 1357          

HSP 8 Score: 57.3806 bits (137), Expect = 2.859e-8
Identity = 95/350 (27.14%), Postives = 157/350 (44.86%), Query Frame = 1
Query:  100 DINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPK------------------FEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASID--IQGKK------HKGDIDVHLSIPEVDIDVDGKK 1041
            ++ +PD +L   EG+LK PK          L  +  D+D+ +    P+GEID++   P VDI    P +DIE   +GK K  G  F +P   +P                   F+GK+K    +L ++I+GP+++ ++ G +      +    P  E+D+  PD+++E  +GK K     +      G K +GK      E+D  +K P  +ID+ G K  IS  DL+++ P+  +              ID+NL   K    S        +V+ D+  P++D +                 +VN+E PD  ID  ++G K      H  D+D +L  P+V+ D+ G K
Sbjct:  670 EVAIPDVELEGPEGRLKMPKFKMPKFGFSGLKADGKDVDISL----PEGEIDIS--GPKVDI--SAPKLDIECP-EGKVK--GPKFKMPSLHMPDIDLNLKGPKVEGDLKDVDFDGKVKVSMPDLGLNIKGPKMEGELKGPK------IDMKGP--EVDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGK------EID--IKLPEGEIDVSGPKVDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKDFNLKGPKVEGDLKGPKVDINAP---------------EVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPK 977          

HSP 9 Score: 56.6102 bits (135), Expect = 4.325e-8
Identity = 65/211 (30.81%), Postives = 113/211 (53.55%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL----DVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKF-------EGK---LKKPKGELDIDIRGPEVDV---DIHGNRAKGNVDVT-FNKPDLEIDITK-PDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI 663
            +DI+ P+  +   EGK+K PK  +     V  PD+ +++ G K +GE+    +++K P VD+    PD+++E   +GK K       +P +K+PKF       +GK   +K P+GE  ID+  P+VD+   D+     +G + +  F  P + +++ K PD+D  I   K K G +I  P ++G   + +G      +D+ +K+P IDID+
Sbjct:  100 VDISAPNLDIEYQEGKVKGPKFKMPSMPKVSMPDVGLNVKGPKVEGELKGPKIDMKGPEVDVAI--PDVELE-GPEGKLK-------MPKFKMPKFGFSGSKVDGKDIDIKLPEGE--IDLSAPKVDITVPDVELEGPEGKLKMPKFKMPSVNVNLPKVPDVDFNIKSPKWKGGADISGPKLEG---DVRG------LDVEIKSPEIDIDV 289          

HSP 10 Score: 56.225 bits (134), Expect = 5.835e-8
Identity = 112/393 (28.50%), Postives = 171/393 (43.51%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD---VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDID-IEVDIDGKKKKHG---------LDFNL--PDWKL-----PKFEGKLKKPKGELDIDIRGPEVDVD--------------------------IHGNRAKG-NVDVTFNKPDLEI-----DITKPDMDIEIDGKKKKHGINIGLPSM---------KGLKFEGKGKKPKSEV---DLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLP--NWXXXXXXXXXXXXXGQVDL-DINTPEIDFXXXXXXXXXXXXXXXXXI---DVNVEVPDASID--IQGKK------HKGDIDVHLSIPEVDIDVDGKK 1041
            LDI  P+ K+   + +   PK        EAPD+DV +       + +LNV  P V+ID    DI+  E  + G K K           +D N+  P WK      PK EG+LK P    +IDI+ P+V++D                            G++ +G +VD+T  + ++++     DI+ PD+DIE    K K G    +PS+         KG K EG  K PK ++   ++ ++ P ID ++ G K  + GDL   K                   +DIN P  N + P      K    +  +  ++ P+IDF+    K +   K  K  I   +VN+E PD  ID  ++G K      H  DID +L  P+V+ D+ G K
Sbjct:  292 LDIGGPEAKVKNKKSRFHMPKFGFSSSKAEAPDVDVKLP------KTNLNVSGPKVNIDTPTLDIEGPEAKVKGTKFKMPSIPKMSIPDVDLNIKSPKWKGTDISGPKIEGELKGP----EIDIKAPKVELDSPTLDIESPEGKGKLKMPKFKMPKFGFSGSKVEGKDVDITLPEGEMDVSGPKVDISAPDLDIECPEGKVK-GPKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDIDFNLKGPK--VEGDLKGPK-------------------VDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPK 652          

HSP 11 Score: 53.9138 bits (128), Expect = 3.212e-7
Identity = 115/404 (28.47%), Postives = 169/404 (41.83%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEV---DIDGKKKKHG------LDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEV-----DVDIHGNRAKG------NVDVTFNK------------PDLEIDITKPDMDIEIDGKKKKHGI---NIGLPSMKGLKFE---GKGKKPKSEV-DLGVKTPS---IDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPN---------------WXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLS--------------IPEVD-----IDVDGKKKKHGF 1056
            +D+ +PD +L   EGKLK PK          L  +  D+D+ +    P+GEID++   P VDI    P++DIE     + G K K        +DFNL   K PK EG LK PK    +DI+ PEV     DVD  G + KG      ++ V+  K            P  + DI  P++++E D K  K       +  PS  G+  E    K K PK ++   G   PS    +ID+ G K +   DLSV K  +    D+ VS       ID+ +P                        ++       DL++++P+        KS              V +PD  ++++G K KGD+DV +                PEVD     +++DGK K H F
Sbjct: 1215 VDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISL----PEGEIDIS--GPKVDI--SAPELDIECPEGRVKGPKFKMPSLHMPDIDFNL---KGPKLEGDLKAPK----VDIKAPEVNLEAPDVDFDG-KIKGPKFKMPSIGVSLPKVSIPETDHNVKGPKFKGDIDLPEVNLEADLKPTKVKTKDPEVKFPS-SGVSVEVPDSKIKGPKFKLPSWGFSKPSNSGTEIDMKGPKIKGDVDLSVSKGSSLKGSDLTVSG----PNIDLEMPEGKVKKSKFKFPKFNFSSPKAQIPETDVKIANTDLEVSSPKFKMPSLNIKSP------------KVSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKF 1585          

HSP 12 Score: 53.1434 bits (126), Expect = 4.894e-7
Identity = 72/222 (32.43%), Postives = 113/222 (50.90%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL--------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKH-----GLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI-----EIDGKKKK-HGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI-----DIDGKKHRISG 690
            +D+ +PD +L   EGKLK PK  +         V+  DID+    K P+GEIDL+   P VDI    PD+++E   +GK K        ++ NLP  K+P  +  +K PK +   DI GP+++ D+ G      +DV    P+++ID+  PD+DI     ++  KK + H    G  S K    +   K PK+  +L V  P ++I     DI+G + ++ G
Sbjct:  159 VDVAIPDVELEGPEGKLKMPKFKMPKFGFSGSKVDGKDIDI----KLPEGEIDLSA--PKVDITV--PDVELE-GPEGKLKMPKFKMPSVNVNLP--KVPDVDFNIKSPKWKGGADISGPKLEGDVRG------LDVEIKSPEIDIDV--PDLDIGGPEAKVKNKKSRFHMPKFGFSSSKAEAPDVDVKLPKT--NLNVSGPKVNIDTPTLDIEGPEAKVKG 359          

HSP 13 Score: 51.6026 bits (122), Expect = 1.490e-6
Identity = 86/306 (28.10%), Postives = 139/306 (45.42%), Query Frame = 1
Query:  172 VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKK--HGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSM------------KGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVP--DASIDIQGKKHKGDI---DVHLSIPEVDIDV 1029
            V   D+++ + G K K E+D+++  P ++     P I+IE  + G + +   G    +P +K+PKF     K  G+ D+DI+ PEV++D+ G +               +DI+ P++DIE    K K G    +PSM            KG K EG+ K PK    + +K P +D+ I D +     G L +  P   +       +K     IDI LP  +    + K   +   V+L+    ++        S + N  K   +D N++ P      DI G K +GD+   DV +  PE+DIDV
Sbjct:   11 VPMTDLNLYMKGSKAK-EVDISI--PTLEGGLKGPQIEIESSVPGVELEGPEGTQ-KMPKFKMPKFGFSGSKVDGK-DVDIKLPEVEIDVSGPK---------------VDISAPNLDIEYQEGKVK-GPKFKMPSMPKVSMPDVGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKM--PKFKMPKFGFSGSKVDGKDIDIKLPEGEIDLSAPKVDITVPDVELEGPEGKLKMPKFKMPSVNVNLPKVPDVDFNIKSPKWKGGADISGPKLEGDVRGLDVEIKSPEIDIDV 289          

HSP 14 Score: 50.0618 bits (118), Expect = 5.249e-6
Identity = 103/394 (26.14%), Postives = 167/394 (42.39%), Query Frame = 1
Query:   91 HGLDINLPDWKL--PKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNV----DIDFHKPDIDIEV-------------------------DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNK-----PDLEIDITKPDMD-----IEIDGKKKKHGI--------NIGLP----SMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVD-----LDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDI----------DVHLSIPEVDIDVDGKKKKHGF 1056
             G+ + +PD K+  PKF        KP  +        ++D+ G K KG++DL+V   +     D+    P+ID+E+                         + D K     L+ + P +K+P     +K PK      +  P+V++++ G + KG++DV   K      DL+ DI  P++D     + IDGK K H           + +P    ++KG K EG+ K PK    + +K P +D+ I D +     G L +  P   +       +K K   IDI LP               G++D     LDI+ PE+D +    K K  N         ++ +PD   +++G K +GD+          DV+L  P  D+D+DGK K   F
Sbjct: 1401 SGVSVEVPDSKIKGPKFKLPSWGFSKPSNS------GTEIDMKGPKIKGDVDLSVSKGSSLKGSDLTVSGPNIDLEMPEGKVKKSKFKFPKFNFSSPKAQIPETDVKIANTDLEVSSPKFKMPSLN--IKSPK------VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKM--PKFKMPTFGFSGSKVKGKDIDIALPE--------------GEIDVSVPKLDISAPELDIECPEGKVKGPNFKMP-----SLHMPDIDFNLKGPKVEGDLKGPKVDISAPDVNLEAP--DVDIDGKVKGSKF 1753          
BLAST of SMED30001359 vs. Ensembl Xenopus
Match: ENSXETT00000032387.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:41381047:41388699:-1 gene:ENSXETG00000008286.1 transcript:ENSXETT00000032387.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 3.070e-13
Identity = 82/260 (31.54%), Postives = 129/260 (49.62%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-----DFHKPDIDI---EVDIDGKKKKHGL--------DFNLPDWKL----PKFEGKLKKPKGELDIDIRGPEVDVDI------------------------HGNRAKG-NVDVTFNKPDLEI-----DITKPDMDIEIDGKKKKHGINIGLPS---------MKGLKFEGKGKKPK---SEVDLGVKTPSIDID--IDGKKHRI 684
            L+++ P +K+P     +K PK    V  PD+++++ G K KG++D+ V     DI     D H P++D+   EV+IDGK K H          + ++PD+ L    PK EG+LK PK    ID++GPEVDV I                         G++ KG ++D+   + ++++     DI+ P++DIE    K K G N  +PS         +KG K EG  K PK   S  D+ ++ P +DID  + G K ++
Sbjct: 1042 LEVSSPKFKMPSLN--IKSPK----VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPTFGFSGSKVKGKDIDIALPEGEIDVSVPKLDISAPELDIECPEGKVK-GPNFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDISAPDVNLEAPDVDIDGKVKGSKFKM 1290          

HSP 2 Score: 65.4698 bits (158), Expect = 5.829e-11
Identity = 82/233 (35.19%), Postives = 120/233 (51.50%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDI-----DVDIHG------KKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELD-----IDIRGPEVDVD--IHGNRAK------GNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKP 711
            +D NL   K PK EG LK PK  +D++AP++     DVD+ G      K PK E DL  K P VDI  + P++ +E   VDIDGK K  G  F +P   +P  +  LK PK E D     +DI  P+VD+D  + G++ K       ++D     P +E D+  P +DI    + K  G ++ +P  K  KF   G K + + D+ +  P  ++D+ G K  IS  DL ++ P
Sbjct:    4 IDFNL---KGPKVEGDLKGPK--VDIKAPEVNLEAPDVDVDGKVKGDLKGPKVEGDL--KGPKVDI--NAPEVKLEGPDVDIDGKVK--GSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDISAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDINAP-EVKLEGPDLKMPKFKMPKFGFSGSKVEGK-DVDITLPEGEMDVSGPKVDISAPDLDIECP 223          

HSP 3 Score: 64.3142 bits (155), Expect = 1.324e-10
Identity = 104/346 (30.06%), Postives = 159/346 (45.95%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL-DVEAPDIDVDIHGKKPKGEI----------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHG------LDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL-----DINTPEIDFXXXXXXXXXXXXXXXXX----IDVNVEVPDASIDIQGKKHKGDI---DVHLSIPEVDIDV 1029
            +DI+ PD  +   EGK+K PK  +  +  PDID+++ G K +G+           ++N++ P+VDID    D+DI+  + G K K        LDFNL   K PK EG LK PK    +DI  PEV     DVDI G + KG+    F  P L +    PD+D  + G K +         +KG K E KG+    ++D+  K P  D+ I D +     G L +  P   +        K     +DI+LP               G++D+     DI+ PE+D +    K K             ID N++ P    D++G K +G++   ++ +  PEVD+ +
Sbjct:  449 VDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKGPKVDIKAPEVNLEAPDVDIDGKVKDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKVEGDLKGPK----VDINAPEVNLEAPDVDIDG-KVKGS---KFKMPSLHM----PDLDFNLKGPKVEG-------DLKGPKVEIKGELKGPKIDM--KGPEFDVAIPDVELEGPEGKLKM--PKFKMPKFGFSGLKADGKDVDISLPE--------------GEIDISGPKVDISAPELDIECPEGKVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKGPKMEGELKGPNIDMKGPEVDVAI 754          

HSP 4 Score: 54.299 bits (129), Expect = 2.243e-7
Identity = 97/377 (25.73%), Postives = 154/377 (40.85%), Query Frame = 1
Query:  103 INLPDWKLPKF-----------------EGKLKKPKGALDVEAPDIDVDIHGKKPKG-----------EIDLNVKNPNVDIDFHKPDIDIE-----VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-------------DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPS---------MKGLKFEGKGKKPKSEVDLG-VKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASID--IQGKK------HKGDIDVHLSIPEVDIDVDGKK 1041
            + +P +K+PKF                 EG++      +D+ AP +D++    K KG           +IDLN+K P V+ D   P ++ E     +D+ G +    +D  +PD +L   EGK+K PK ++             +IDI+ PE ++D+ G +               +DI+ PD+++E    K K G    +PS         +KG K EG  K PK ++    V   + D+DIDGK   +  D  V                 K     +++P+  F     K +       +DIN PE                      VN+E PD  ID  ++G K      H  D+D +L  P+V+ D+ G K
Sbjct:  292 LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDLKGPKMEGELKGPKIDMKGPE----VDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDIKLPEGEIDVSGPK---------------VDISAPDLNMECPEGKVK-GPKFKMPSLHMPDIDLNLKGPKVEGDSKGPKVDIKAPEVNLEAPDVDIDGKVKDVDIDGKV--------------KGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPE----------------------VNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPK 612          

HSP 5 Score: 53.9138 bits (128), Expect = 2.675e-7
Identity = 100/355 (28.17%), Postives = 153/355 (43.10%), Query Frame = 1
Query:  103 INLPDWKLPKF-----------------EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-DFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPK--GEL---DIDIRGPEVDV---DIHGNRAKGNVDVT-FNKPDL----------EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKK 1047
            + +P +K+PKF                 EG++      +D+ AP++D++     P+G+    VK P   +   H PDI               DFNL   K PK EG LK PK  GEL   +ID++GPEVDV   D+     +G + +  F  P            ++DI+ P+ +I+I G K    ++I  P +     EG+ K PK       K PS+   DID + K  ++ GDL   K                   +DI  P                  ++++  P++DFDG  K  K K  S    +   V +P+   +++G K KGDID    +PEV+++ D K  K
Sbjct:  647 LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIEC----PEGK----VKGPKFKMPSLHMPDI---------------DFNL---KGPKLEGDLKGPKMEGELKGPNIDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPK----VDISAPELDIECPEGRVKGPK------FKMPSLHMPDIDFNLKGPKLEGDLKAPK-------------------VDIKAP------------------EVNLEAPDVDFDGKIKGPKFKMPSIGVSLP-KVSIPETDHNVKGPKFKGDID----LPEVNLEADLKPTK 923          

HSP 6 Score: 51.6026 bits (122), Expect = 1.765e-6
Identity = 85/306 (27.78%), Postives = 136/306 (44.44%), Query Frame = 1
Query:  223 EIDLNVKNPNVDIDFHKPDIDI----------EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL---DIDIRGPEVDVD--IHGNRAK------GNVDVTFNKPDLEIDITKPDMDI-----EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKK------HKGDIDVHLSIPEVDIDVDGKK 1041
            +ID N+K P V+ D   P +DI          +VD+DGK K         D K PK EG LK PK ++   ++ + GP+VD+D  + G++ K       ++D     P +E D+  P +DI     +IDGK K  G    +PS+     +   K PK E DL  K P   +DI+  + ++ G DL +  P   +       +K +   +DI LP                  ++D++ P++D                   D+++E P+    ++G K      H  DID +L  P+V+ D+ G K
Sbjct:    3 DIDFNLKGPKVEGDLKGPKVDIKAPEVNLEAPDVDVDGKVKG--------DLKGPKVEGDLKGPKVDINAPEVKLEGPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDISAPDVDIDGKVK--GSKFKMPSLHMPDIDFNLKGPKVEGDL--KGPK--VDINAPEVKLEGPDLKM--PKFKMPKFGFSGSKVEGKDVDITLPEG----------------EMDVSGPKVDISAP---------------DLDIECPEGK--VKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPK 259          

HSP 7 Score: 50.447 bits (119), Expect = 4.128e-6
Identity = 89/381 (23.36%), Postives = 150/381 (39.37%), Query Frame = 1
Query:  103 INLPDWKLPKF-----------------EGKLKKPKGALDVEAPDIDVDIHGKKPKG-----------EIDLNVKNPNVDIDFHKPDIDI----------EVDIDG-----KKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLS--------------IPEVD-----IDVDGKKKKHGF 1056
            + +P +K+PKF                 EG++      +D+ AP++D++    + KG           +ID N+K P ++ D   P +DI          +VD DG     K K   +  +LP   +P+ +  +K PK + DID+    ++ D+   + K   D     P   + +  PD  I+   K K        PS  G + + KG K K +VDL V   S    + G    +SG ++ ++ P+  +        K         +P                  DL++++P+        KS              V +PD  ++++G K KGD+DV +                PEVD     +++DGK K H F
Sbjct:  766 LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIECPEGRVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKAPKVDIKAPEVNLEAPDVDFDGKIKGPKFKMPSIGVSLPKVSIPETDHNVKGPKFKGDIDLPEVNLEADLKPTKVK-TKDPEVKFPSSGVSVEVPDSKIK-GPKFKLPSWGFSKPSNSGTEIDMKGPKIKGDVDLSVSKGS---SLKGSDLTVSGPNIDLEMPEGKVKKSKFKFPKFNFSSPKAQIPET---------DVKIANTDLEVSSPKFKMPSLNIKSP------------KVSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKF 1120          

HSP 8 Score: 50.0618 bits (118), Expect = 5.137e-6
Identity = 103/394 (26.14%), Postives = 167/394 (42.39%), Query Frame = 1
Query:   91 HGLDINLPDWKL--PKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNV----DIDFHKPDIDIEV-------------------------DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNK-----PDLEIDITKPDMD-----IEIDGKKKKHGI--------NIGLP----SMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVD-----LDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDI----------DVHLSIPEVDIDVDGKKKKHGF 1056
             G+ + +PD K+  PKF        KP  +        ++D+ G K KG++DL+V   +     D+    P+ID+E+                         + D K     L+ + P +K+P     +K PK      +  P+V++++ G + KG++DV   K      DL+ DI  P++D     + IDGK K H           + +P    ++KG K EG+ K PK    + +K P +D+ I D +     G L +  P   +       +K K   IDI LP               G++D     LDI+ PE+D +    K K  N         ++ +PD   +++G K +GD+          DV+L  P  D+D+DGK K   F
Sbjct:  936 SGVSVEVPDSKIKGPKFKLPSWGFSKPSNS------GTEIDMKGPKIKGDVDLSVSKGSSLKGSDLTVSGPNIDLEMPEGKVKKSKFKFPKFNFSSPKAQIPETDVKIANTDLEVSSPKFKMPSLN--IKSPK------VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKM--PKFKMPTFGFSGSKVKGKDIDIALPE--------------GEIDVSVPKLDISAPELDIECPEGKVKGPNFKMP-----SLHMPDIDFNLKGPKVEGDLKGPKVDISAPDVNLEAP--DVDIDGKVKGSKF 1288          
BLAST of SMED30001359 vs. Ensembl Mouse
Match: Ahnak (AHNAK nucleoprotein (desmoyokin) [Source:MGI Symbol;Acc:MGI:1316648])

HSP 1 Score: 68.1662 bits (165), Expect = 6.420e-12
Identity = 108/359 (30.08%), Postives = 163/359 (45.40%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKL----------------PKFEGKL----KKPKGEL---DIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI---DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLS-------IPEVDI 1023
            +DI+ PD  +   EGKLK PK         A  +  PD D+++ G K KG++DL +  PNV+ D   P+IDIE   +GK K  G  F +PD +                 PK +G L     KP+G+L    +DI+GP++     D+DIHG   K      F  PDL +    I+ P++D+ + G K K  +++ LP     K EG  K P  EVD  +K P +DI   D+D     + G D  +  P   +        K +   +D++LP                +VD+D+    I+      K       +       + +PD  ++++G K KGD+DV L        +PEVDI
Sbjct: 4204 VDIDTPDVNIEVPEGKLKGPKFKMPDMHIKAPKISMPDFDLNLKGPKVKGDVDLAL--PNVEGDLKGPEIDIE-GPEGKLK--GPKFKVPDVQFKTPQISMSDIDLNVKGPKIKGDLDISIPKPEGDLKGPKVDIKGPKLDIDTPDIDIHGPEGKLK-GPKFKMPDLHLKAPKISMPEVDLNLKGPKVKGDVDVSLP-----KVEGDLKGP--EVD--IKGPKVDISAPDVD-----VHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVSLPKANIDVSGP-------KVDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLPKVEGEIKVPEVDI 4535          

HSP 2 Score: 65.4698 bits (158), Expect = 5.514e-11
Identity = 112/359 (31.20%), Postives = 173/359 (48.19%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKK-HGLDFNL--PDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKF---EGKGKKPK---SEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGID--INLPNWXXXXXXXXXXXXXG--------QVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDVH---LSIPEVDIDVDGKKKKHGFGINLP 1071
            LDI+ PD  +   EGKLK PK         A  +  P++D+++ G K KG++D+++  P V+ D   P++DI+   VDI       HG D++L  P  K+PKF   +   KGE      GPEVDV +     K N+DV+  K    +DI  PD++IE    K           +KG KF   E   K PK    ++DL +K P +  D+D    ++ G++ V + D               HG D  + +P  K PKFS    K +G        + DLD++ P++D D                 DVNVE PD  + ++G K +  +I++    +S+P+VD+++ G K K  F  ++P
Sbjct: 4338 LDIDTPDIDIHGPEGKLKGPKFKMPDLHLKAPKISMPEVDLNLKGPKVKGDVDVSL--PKVEGDLKGPEVDIKGPKVDISAPDVDVHGPDWHLKMPKVKMPKFS--MPGFKGE------GPEVDVSL----PKANIDVSGPK----VDIDVPDVNIEGPDAK-----------LKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLPKVEGEIKVPEVDIKGPKVDIDVPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADLDVSGPKVDIDVP---------------DVNVEGPD--MKVKGPKFRMPEINIKAPKISMPDVDLELKGPKVKGAFDGSVP 4650          

HSP 3 Score: 65.4698 bits (158), Expect = 5.921e-11
Identity = 106/371 (28.57%), Postives = 164/371 (44.20%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD---VEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDW-------KLPKFEGKLKKPKG--------ELDIDIRGPEVDVDIHGNRAKGNV----DVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPS-----------MKGLKF------------EGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            +D+ +PD  L   + KLK PK  +     +AP I   DVD+H K PK + D++V  P ++ +   PD+DI   +VDI+       +D   PDW       K+PKF     K +G        + DID+ GP+VD+D+     +G         F  PD+      I+ PD+D  + G K K  I++ +P            +KG K             EGK K PK ++ D+  KTP I   DID+  K  +I G++ VD P         +    K   +D++ P                  D++I  PE    G   K  + N          + +PD  + ++G K KGD+D+  S+P+V+ D+ G
Sbjct: 2135 VDVEVPDVDLECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDMDVTVPKIEGEMKVPDVDIKGPKVDINAPD----VDVRGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPDMHFKAPKISMPDVDFNLKGPKIKGDIDVSVPKIEGELKGPELDLKGPKLDANIPEVAVEGPEGKWKSPKFKMPDMHFKTPKISMPDIDLHLKSPKIKGEVDVDVP--------KLEGDLKGPNVDMSRP------------------DIEIEGPEGKLKGPKFKMPEMNIKAP-----KISMPDFDLHLKGPKVKGDVDI--SLPKVEGDIKG 2468          

HSP 4 Score: 65.0846 bits (157), Expect = 6.647e-11
Identity = 103/355 (29.01%), Postives = 162/355 (45.63%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDIDV-DIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL-------PDWKLPKFEGK-----LKKPKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-------------GDIDVHLSIPEVDIDVDG 1035
            +DI++PD  +   + KLK PK     ++++AP I + D+H K PK + D++V  P V+ D   P++DI   ++DI       HG D++L       P + +P F+G+     +  PK +LD     +DI GP V+++    + KG     F  PDL +    I+ P++D+ + G K K  +++ LP     K EG  K P  EVD  +K P +DI   D   H    D  +  P   +        K +   +D+NLP                + D+D++ P++D D                 DVN+E PDA   ++G K K              D D+HL  P+V  DVD 
Sbjct: 3876 VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKMDISAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADLDVSGPKVDIEGPNVNIEGPEGKLKGP---KFKMPDLHLKAPKISMPEIDLNLKGPKLKGDVDVSLP-----KVEGDLKGP--EVD--IKGPKVDISAPDMDVH--GPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLP----------------KADIDVSGPKVDIDVP---------------DVNIEGPDAK--LKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDA 4183          

HSP 5 Score: 65.0846 bits (157), Expect = 7.802e-11
Identity = 70/214 (32.71%), Postives = 109/214 (50.93%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELD------IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE------------IDGKKKKHGINIGLPSMKGLKFEGKGKKPKS-EVDLGVKTPSIDI 657
            +DI++PD  +   + KLK PK         A  +  PD+++++ G   KG++D+++  PN++ D   P +DI        K   LD N PD  +   EGKLK PK ++         I  PE+D+++ G++ KG+VD++   P LE DI  P +D++            IDGK KK      LP     KF   G K ++ EVD+ +K P +DI
Sbjct: 2914 VDIDVPDVNIEGPDAKLKGPKFKMPEVNIKAPKISMPDLNLNLKGPNVKGDVDVSI--PNIEGDLKGPSLDI--------KSPKLDVNAPDIDVHGPEGKLKGPKLKMPDMHVSMPKISMPEIDLNLKGSKVKGDVDIS--GPKLEGDIKVPRVDLKGPEVDISAPKVNIDGKAKKS--RFKLP-----KFNFSGSKVQTPEVDVKLKKPDVDI 3108          

HSP 6 Score: 63.1586 bits (152), Expect = 2.830e-10
Identity = 100/358 (27.93%), Postives = 166/358 (46.37%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE----VDIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEIDITKPDM-DIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DI++PD  +   + KLK PK         A  +  PDID+++ G K KG++D+++  P V+ +   P++DI+             HG D++L  P  K+PKF     K +G        + D+D+ GP+VD+D     I G  AK      F  P++ I   K  M D+ + G K K  +++ LP     K EG  K P    D+ +K P   +DI+     + G D  +  P   +        K +   +D+NLP                +VDLD++ P++D D                 DVN+E PDA   ++G K K  ++++    +S+P++D+++ G K K    ++LP
Sbjct: 3494 VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSL--PKVEGEIKVPEVDIKDPKVDIDVPDVDVHGPDWHLKMPKIKMPKFSMPGFKGEGPEVDVNLPKADLDVSGPKVDIDVPDVNIEGPDAKLK-GPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSLP-----KVEGDLKGP----DVDIKGPK--MDINAPDMDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLP----------------KVDLDVSGPKVDIDVP---------------DVNIEGPDAK--LKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDMSLP 3804          

HSP 7 Score: 62.7734 bits (151), Expect = 3.596e-10
Identity = 104/368 (28.26%), Postives = 163/368 (44.29%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD---VEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKL--PKFEGK---LKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-----IDITKPDMDIEIDGKKKKHGINIGLP---------SMKGLKFEGKGKKPKSEVDLGV-------KTPSIDI-----DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVH-----LSIPEVDIDVDGKKKKHGFGINLP 1071
            +D+ +PD  L   + KLK PK  +     +AP I   DVD+H K PK + D++V  P ++ +   P +D+EV          +D   PD KL  PKF+      K PK      I  P+VD+ + G + KG+VDVT  K + E     +D+  PD+D+E    K K G    +P         SM  +    KG K K ++D+ V       K P +DI     DI+     + G D  +  P   +        K +   +D+NLP                + D+D++ P++D D                 DVN+E P+    ++G K K   D+H     +S+P+VD ++ G K K    +++P
Sbjct: 2001 VDVEVPDVDLECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDMDVTVPKLEGELKGPSVDVEV--------PDVDLECPDAKLKGPKFKMPDMHFKAPK------ISMPDVDLHLKGPKVKGDVDVTVPKLEGELKGPSVDVEVPDVDLECPDAKLK-GPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDMDVTVPKIEGEMKVPDVDIKGPKVDINAPDVDVRGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLP----------------KADIDVSGPKVDIDVP---------------DVNIEGPEGK--LKGPKFKMP-DMHFKAPKISMPDVDFNLKGPKIKGDIDVSVP 2319          

HSP 8 Score: 62.7734 bits (151), Expect = 4.450e-10
Identity = 103/359 (28.69%), Postives = 160/359 (44.57%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD---VEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDW-------KLPKFEGKLKKPKG------ELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEIDITKPDM-DIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVH-----LSIPEVDIDVDGKKKKHGFGINLP 1071
            LDI   D  L   EGKLK PK  +     +AP I   DVD++ K PK + D++V  P ++ +   PD+DI   +VDI        +D   PDW       K+PKF     K +G      + D+D+ GP+VD+D     I G  AK      F  P++ I   K  M D+ + G K K  +++ LP     K EG  K P    D+ +K P   +DI+     + G D  +  P   +        K +   +D+NLP                + D+D++ P++D +                 DV++E P+    ++G K K   D+H     +S+P+VD+++ G K K     +LP
Sbjct: 1161 LDIETSDVSLEGPEGKLKGPKFKMPDMHFKAPKISMPDVDLNMKGPKVKGDMDVTVPKIEGEMKVPDVDIKGPKVDISAPD----VDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVSLPKADLDVSGPKVDIDVPDVNIEGPDAKLK-GPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSLP-----KVEGDLKGP----DIDIKGPK--MDINAPDMDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLP----------------KADIDVSGPKVDIEAP---------------DVSIEGPEGK--LKGPKFKMP-DMHFKAPKISMPDVDLNIKGPKGKADVDASLP 1469          

HSP 9 Score: 62.3882 bits (150), Expect = 4.735e-10
Identity = 106/386 (27.46%), Postives = 172/386 (44.56%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD---VEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKG------ELDIDIRGPEVDVDIHGNRAKGN----VDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK---GDIDVH-LSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNL K +IDV   K                 +DI  PD  +   EGKLK PK  +     +AP I   DVD++ K PKG+ D++   P V+     PD+DI   +V ID    + HG D++L  P  K+PKF     K +G      + +ID+ GP+VD+D+     +G         F  P++ I    I+ PD+ + + G K K   ++ +P     K  G+ K P  ++  G K  + D+++ G       D  +  P   +        K +   +D+NL                 + ++D++ P++D D                 DVN+E P+    ++G K K    +I  H +S+P+V +++ G K K G  ++LP
Sbjct: 1398 DVNLPKADIDVSGPK-----------------VDIEAPDVSIEGPEGKLKGPKFKMPDMHFKAPKISMPDVDLNIKGPKGKADVDASLPEVEGGVKVPDVDIKGPKVGIDAPDVEVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDIPKANIDVSGPKVDIDVPDVNIEGPDTKLKGPKFKMPEMNIKPQKISMPDVSLNLKGPKVKADCDVSVP-----KVGGEIKAPAVDIK-GPKVEAPDVEVHGP------DWHLKMPKVKMPKFSMPGFKGEGAEVDVNL----------------QKANIDVSGPKVDIDVP---------------DVNIEGPEGK--LKGPKFKMPSMNIQTHKISMPDVGLNLKGPKLKSGVDVSLP 1721          

HSP 10 Score: 61.2326 bits (147), Expect = 1.277e-9
Identity = 106/365 (29.04%), Postives = 166/365 (45.48%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDIDV-DIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDW-------KLPKFEGKLKKPKG--------ELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASID----------------------IQGKKHKGDIDVHLSIPEVDIDVDG 1035
            +DI++PD  +   + KLK PK     ++++AP I + D+H K PK + D++V  P V+ D   PD+DI   ++DI+       +D   PDW       K+PKF     K +G        ++D+D+ GP+VD+D     I G  AK      F  P++ I    I+ PD+D+ + G K K  +++ LP     K EG+ K P  EVD  +K P +DID+         D  +  P   +        K +   +D+NLP                + DLD++ P++D D                 DVN+E PDA +                       ++G K KGD+DV  S+P+V+ D+ G
Sbjct: 3622 VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSLPKVEGDLKGPDVDIKGPKMDINAPD----MDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKVDLDVSGPKVDIDVPDVNIEGPDAKLK-GPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDMSLP-----KVEGEIKVP--EVD--IKGPKVDIDVPDVDVH-GPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLP----------------KADLDVSGPKVDIDVP---------------DVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDV--SLPKVEGDLKG 3938          

HSP 11 Score: 60.8474 bits (146), Expect = 1.665e-9
Identity = 71/217 (32.72%), Postives = 103/217 (47.47%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDIDV-DIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDW-------KLPKFEGKLKKPKG--------ELDIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI 657
            +DI++PD  +   + KLK PK     ++++AP I + D+H K PK + D++V  P V+ D   PDIDI   ++DI+       +D   PDW       K+PKF     K +G        + DID+ GP+V     DV I G   K      F  PD+      I+ PD+D+ I G K K  ++  LP                EV+ GVK P +DI
Sbjct: 1287 VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSLPKVEGDLKGPDIDIKGPKMDINAPD----MDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPKVDIEAPDVSIEGPEGKLK-GPKFKMPDMHFKAPKISMPDVDLNIKGPKGKADVDASLP----------------EVEGGVKVPDVDI 1482          

HSP 12 Score: 59.6918 bits (143), Expect = 3.721e-9
Identity = 104/370 (28.11%), Postives = 159/370 (42.97%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKF---EGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEID---------FXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKK---HKGDI-----------------DVH-----LSIPEVDIDVDGKKKKHGFGINLP 1071
            +D+ +PD  +   EGKLK PK     ++++AP I   DVD+H K PK + + +V  P ++ D   P +D+ V        HG D+NL  P  K+PKF   +   KGE      GPE+DV    N  K +VD++  K    +DI+ PD+++E  G + K         +KG KF   E   K PK      V  P +D+D+ G K + + D+S  K          +  + K   +DI  PN                  +DI  PE+D                       K    DV+V +P A+ID+ G K      D+                 D+H     +S+P+VD+++ G K K    + +P
Sbjct:  912 VDVKVPDVNIEGPEGKLKGPKLKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDVTMPKLEGDLKGPKVDVSVP---DVDVHGPDWNLKMPKIKMPKFS--MPSLKGE------GPELDV----NMPKADVDISVPK----LDISAPDLNLE--GPEGK---------LKGPKFKMPEMHFKAPK------VSLPDVDLDLKGPKMKGNLDMSAPK----------IEGEMKAPDVDIKGPN------------------VDIKAPEVDVQGPEWSLKMPKMKMPKFSMPTLKGEGPDVDVSLPKATIDVSGPKLDIETSDVSLEGPEGKLKGPKFKMPDMHFKAPKISMPDVDLNMKGPKVKGDMDVTVP 1217          

HSP 13 Score: 59.3066 bits (142), Expect = 4.519e-9
Identity = 69/230 (30.00%), Postives = 112/230 (48.70%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEV--------DIDGKKKKHGLDFNL--PDWKLPKF-------EG---KLKKPKGELDID-----IRGPEVDVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKG 582
            DV LKKP++D+   K                 +DIN P+ ++   +GK+K  K         +  V  PD+++++ G K KG  DL+   PN++ DF  P +DI+         D+D     HG ++NL  P  K+PKF       EG    +  PKG+++I+     I GPE++V+      KG     F  P++ I    I+ PD+D+ + G K K  +++ LP ++G
Sbjct: 3098 DVKLKKPDVDITAPK-----------------VDINAPEVEV---QGKVKGSKFKMPFLSISSPKVSMPDVELNLKGPKVKG--DLDAAGPNLEGDFKGPKVDIKAPDVQLNAPDVD----VHGPEWNLKMPKMKMPKFGVSGIKAEGPDVAVDLPKGDINIEGPSMNIEGPELNVECPEGSLKGP---KFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLPKVEG 3298          

HSP 14 Score: 58.9214 bits (141), Expect = 6.264e-9
Identity = 109/401 (27.18%), Postives = 167/401 (41.65%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE----VDIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEIDITKPDM-DIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASI------------------------DIQGKKHKGDIDVHLS-------IPEVDI 1023
            DVNL K +IDV   K                 +DI++PD  +   + KLK PK         A  +  PDID+++ G K KG++D+++  P V+ +   P++DI+             HG D++L  P  K+PKF     K +G          D+D+ GP+VD+D     I G  AK      F  P++ I   K  M D+ + G K K  +++ LP     K EG  K P    D+ +K P +DI+       + G D  +  P   +        K +   +D+NLP                + DLD++ P++D D                 DVN+E PDA +                        +++G K KGD+D+ L        +PEVDI
Sbjct: 2517 DVNLPKADIDVSGPK-----------------VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSL--PKVEGEIKVPEVDIKGPKVDIDVPDVDVHGPDWHLKMPKIKMPKFSMPGFKGEGPEVDVSLPNADLDVSGPKVDIDVPDVNIEGPDAKLK-GPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSLP-----KVEGDLKGP----DVDIKGPKMDIN--APDMDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLP----------------KADLDVSGPKVDIDVP---------------DVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDMSLPKVEGEIKVPEVDI 2855          

HSP 15 Score: 58.5362 bits (140), Expect = 9.398e-9
Identity = 101/391 (25.83%), Postives = 165/391 (42.20%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPK-----GALDVEAPD----------------------IDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDW-------KLPKFEGKLKKPKG--------ELDIDIRGPEVDVDI------------HGNRAK-------------GNVDVTFNKPDL--EIDITKPDMDIEIDGKK---KKHGINIGLPSMKGLKFEGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDV-------HLSIPEVDIDV 1029
            D  LPK EG+LK P+     G +D+E P+                       DVD+H K PK + D++V  P ++ +   PD+DI   +VDI+       +D   PDW       K+PKF     K +G        + DID+ GP+VD+D+             G++ K              +VD+ F  P L  EID + P+M+ ++ G +   K   +++ +P +     + K K PK ++ D+  K P I   D+D+  K  ++ GD+ V  P         +  + K   +D+ +P                  D+D+  P+    G   K  D +          + +PD  + ++G K KGD+DV        L  P VD++V
Sbjct: 1717 DVSLPKVEGELKGPEVDVDVGDIDIECPEGKLKGPKFKMPDMHFKTPKISMPDVDLHLKGPKVKGDMDVTMPKIEGEMKVPDVDIKGPKVDINAPD----VDVRGPDWHLKMPKVKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPKVDIDVPDLDIEGPEGKLKGSKFKMPKLNIKAAKISMPDVDLNFKGPKLKGEIDASVPEMEADLRGPQVDIKGTNVDVKVPDVDLECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDMDVTVP--------KLEGELKGPSVDVEVP------------------DVDLECPDAKLKGPKFKMPDMHFKAP-----KISMPDVDLHLKGPKVKGDMDVTVPKLEGELKGPSVDVEV 2072          

HSP 16 Score: 57.7658 bits (138), Expect = 1.772e-8
Identity = 78/259 (30.12%), Postives = 125/259 (48.26%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE----VDIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDVDIHGNRAKG-NVDVT---FNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG 690
            DV+L K NIDV   K                 +DI++PD  +   + KLK PK         A  +  PDID+++ G K KG++D+++  P V+ +   P++DI+             HG D++L  P  K+PKF     K +G        + D+D+ GP+VD+D+     +G ++ V    F  P++ I    I+ PD+D+E+ G K K   +  +P     K EG  K P  E+D+  K P   +D +G   ++SG
Sbjct: 4451 DVSLPKANIDVSGPK-----------------VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSL--PKVEGEIKVPEVDIKGPKVDIDVPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADLDVSGPKVDIDVPDVNVEGPDMKVKGPKFRMPEINIKAPKISMPDVDLELKGPKVKGAFDGSVP-----KIEGTLKGP--EIDM--KGPG--LDFEGPDAKLSG 4679          

HSP 17 Score: 56.6102 bits (135), Expect = 3.224e-8
Identity = 70/216 (32.41%), Postives = 112/216 (51.85%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKP----KGA-LDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGP-----EVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE------IDGKKKKHG--INIGLPSMKGLKFEGKGKKPKS-EVDLGVKTPSIDIDIDGKK 675
            D  LPK EG +K P    KG  +D+ APD+DV   D H K PK ++          + P VD++  K DID+     G K    +D ++PD  +   + KLK PK ++ +++I+ P     ++D+++ G + KG+VDV+   P +E +I  P++DI+             HG   ++ +P +K  KF   G K +  EVD  V  P+ D+D+ G K
Sbjct: 2456 DISLPKVEGDIKGPEVDIKGPKVDINAPDVDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVS----GPK----VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSL--PKVEGEIKVPEVDIKGPKVDIDVPDVDVHGPDWHLKMPKIKMPKFSMPGFKGEGPEVD--VSLPNADLDVSGPK 2659          

HSP 18 Score: 56.6102 bits (135), Expect = 3.459e-8
Identity = 88/347 (25.36%), Postives = 155/347 (44.67%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI-EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNV-DVT------------FNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            G DINLP       E  +K PK    +  PD+D+ I G K KGE ++       ++   K DID  +VD+      HG D  +P  K+PKF     K +G  ++D+  P+ D+DI G + + +  DV+            F  P++ I    I+ PD+D+ + G   K   ++ +P     + EG+ K P    D+ +K+  +DID+     +   +L +  P   +        K +   +++NLP                + D+D++ P +D                   DVN+E P+    ++G K K  ++++    +S+P+VD+ + G K K  + + +P
Sbjct:  683 GPDINLP-------EVSVKTPK----ISMPDVDLHIKGPKVKGEYEVTPPKLEGELKGSKVDIDTPQVDV------HGPDLKIPKMKMPKFSVPGFKAEGP-EVDVNLPKADLDISGTKVEVSAPDVSIEGSEGKLKGHKFKMPEMNIRAPKISMPDVDLHLKGPNVKGEYDVTVP-----RAEGEIKVP----DVELKSAKLDIDVPNVDVQ-GPELHMKMPKIKMPKFGMPGFKAESPEMEVNLP----------------KSDIDVSGPNVDVKVP---------------DVNIEGPEGK--LKGPKLKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDVTMP 968          

HSP 19 Score: 56.6102 bits (135), Expect = 3.777e-8
Identity = 94/343 (27.41%), Postives = 154/343 (44.90%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKP----KGA-LDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGP-----EVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            D  +PK EG++K P    KG  +D+ APD+DV   D H K PK ++          + P VD++  K DID+     G K    +D ++PD  +   EGKLK PK ++ D+  + P     +VD ++ G + KG++DV+   P +E ++  P++D+      K   ++  +P +     EGK K PK ++ D+  KTP I   DID+  K  +I G++ VD P         +    K   +D++ P                  D++I  PE    G   K            ++N++ P                  +S+P+ D+ + G K K    I+LP
Sbjct: 2187 DVTVPKIEGEMKVPDVDIKGPKVDINAPDVDVRGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVS----GPK----VDIDVPDVNIEGPEGKLKGPKFKMPDMHFKAPKISMPDVDFNLKGPKIKGDIDVSV--PKIEGELKGPELDL------KGPKLDANIPEVAVEGPEGKWKSPKFKMPDMHFKTPKISMPDIDLHLKSPKIKGEVDVDVPK--------LEGDLKGPNVDMSRP------------------DIEIEGPEGKLKGPKFKMP----------EMNIKAP-----------------KISMPDFDLHLKGPKVKGDVDISLP 2460          

HSP 20 Score: 55.8398 bits (133), Expect = 5.964e-8
Identity = 98/374 (26.20%), Postives = 164/374 (43.85%), Query Frame = 1
Query:   97 LDINLPDW-------KLPKF----------EGKLKKPKGALDVEAPDIDVDIHG---KKPKGEI--------DLNVKN-----PNVDIDFHKPDI---------DIEVDIDGKK---KKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEV---DVDIH--GNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP--SMKGLKFEGKGKKPKSEVDLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDV-------HLSIPEVDIDV 1029
            +D+  PDW       K+PKF          E  +  PK  +DV  P +D+D+     + P+G++         LN+K      P+VD++F  P +         ++E D+ G +   K   +D  +PD  L   + KLK PK ++ D+  + P++   DVD+H  G + KG++DVT   P LE ++  P +D+E+        +++  P   +KG KF    K P    D+  K P I   D+D+  K  ++ GD+ V  P         +  + K   +D+ +P                  D+D+  P+    G   K  D +          + +PD  + ++G K KGD+DV        L  P VD++V
Sbjct: 1813 VDVRGPDWHLKMPKVKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPKVDIDVPDLDIEGPEGKLKGSKFKMPKLNIKAAKISMPDVDLNFKGPKLKGEIDASVPEMEADLRGPQVDIKGTNVDVKVPDVDLECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDMDVTV--PKLEGELKGPSVDVEV------PDVDLECPDAKLKGPKF----KMP----DMHFKAPKISMPDVDLHLKGPKVKGDMDVTVP--------KLEGELKGPSVDVEVP------------------DVDLECPDAKLKGPKFKMPDMHFKAP-----KISMPDVDLHLKGPKVKGDVDVTVPKLEGELKGPSVDVEV 2139          

HSP 21 Score: 55.4546 bits (132), Expect = 9.334e-8
Identity = 110/403 (27.30%), Postives = 170/403 (42.18%), Query Frame = 1
Query:   97 LDINLPDW-------KLPKF----------EGKLKKPKGALDVEAPDIDVDI----------------------HGKKPK---GEIDLNVKNPNV--DIDFHKPDID-----IEVDIDGKK--------KKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEIDITKPDM-DIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            +D+  PDW       K+PKF          E  +  PK  +DV  P +D+D+                      + K PK    +IDLN+K P V  D+D   P ++      EVDI G K          HG D++L  P  K+PKF     K +G          D+D+ GP+VD+D     I G  AK      F  P++ I   K  M D+ + G K K  +++ LP     K EG  K P    D+ +K P   +DI+     + G D  +  P   +        K +   +D+NLP                + DLD++ P++D D                 DVN+E PDA   ++G K K  ++++    +S+P++D+++ G K K    ++LP
Sbjct: 2485 VDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLPKVEGEIKVPEVDIKGPKVDIDVPDVDVHGPDWHLKMPKIKMPKFSMPGFKGEGPEVDVSLPNADLDVSGPKVDIDVPDVNIEGPDAKLK-GPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSLP-----KVEGDLKGP----DVDIKGPK--MDINAPDMDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLP----------------KADLDVSGPKVDIDVP---------------DVNIEGPDAK--LKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDMSLP 2842          

HSP 22 Score: 55.0694 bits (131), Expect = 1.122e-7
Identity = 69/227 (30.40%), Postives = 112/227 (49.34%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALD-----VEAPDIDV---DIHGKKPK---------------GEIDLNVKNPNVDIDFHKPDIDI-EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKP 711
            D  +PK  G++K P  A+D     VEAPD++V   D H K PK                E+D+N++  N+D+   K DID+ +V+I+G + K       P +K+P    +  K        I  P+V +++ G + K  VDV+   P +E ++  P++D+++        I+I  P       EGK K PK ++ D+  KTP I   D+D+  K  ++ GD+ V  P
Sbjct: 1591 DVSVPKVGGEIKAP--AVDIKGPKVEAPDVEVHGPDWHLKMPKVKMPKFSMPGFKGEGAEVDVNLQKANIDVSGPKVDIDVPDVNIEGPEGK----LKGPKFKMPSMNIQTHK--------ISMPDVGLNLKGPKLKSGVDVSL--PKVEGELKGPEVDVDV------GDIDIECP-------EGKLKGPKFKMPDMHFKTPKISMPDVDLHLKGPKVKGDMDVTMP 1788          

HSP 23 Score: 54.6842 bits (130), Expect = 1.314e-7
Identity = 74/262 (28.24%), Postives = 126/262 (48.09%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE----VDIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKG-LKF----------------------EGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKP 711
            +DI++PD  +   + KLK PK         A  +  PDID+++ G K KG++D+++  P V+ +   P++DI+             HG D++L  P  K+PKF     K +G        + D+D+ GP+VD+D     I G  AK      F  P++ I    I+ PD+++ + G   K  +++ +P+++G LK                       EGK K PK ++ D+ V  P I   +ID++ K  ++ GD+ +  P
Sbjct: 2786 VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDMSL--PKVEGEIKVPEVDIKGPKVDIDVPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADLDVSGPKVDIDVPDVNIEGPDAKLK-GPKFKMPEVNIKAPKISMPDLNLNLKGPNVKGDVDVSIPNIEGDLKGPSLDIKSPKLDVNAPDIDVHGPEGKLKGPKLKMPDMHVSMPKISMPEIDLNLKGSKVKGDVDISGP 3044          

HSP 24 Score: 52.373 bits (124), Expect = 7.379e-7
Identity = 99/372 (26.61%), Postives = 177/372 (47.58%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKP----KGA-LDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGP-----EVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE------IDGKKKKHG--INIGLPSMKGLKFEG---KGKKPKSEV-----DLGVKTPSIDID-----IDGKKHRISG------DLSVDKPXXXXX-XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVH-----LSIPEVDIDVDGKKKKHGFGINLP 1071
            D  LPK EG LK P    KG  +D+ APD+DV   D H K PK ++          + P VD++  K D+D+     G K    +D ++PD  +   + KLK PK ++ +++I+ P     ++D+++ G + KG+VD++   P +E +I  P++DI+             HG   ++ +P +K  KF     KG+ P+ +V     DL V  P +DID     I+G   ++ G      ++++  P   +  +++++     K  +D+++PN +                LDI +P++D +                 D++V  P+  +  +G K K   D+H     +S+PE+D+++ G K K    I+ P
Sbjct: 2710 DVSLPKVEGDLKGPDVDIKGPKMDINAPDMDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADLDVS----GPK----VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDMSL--PKVEGEIKVPEVDIKGPKVDIDVPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADLDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEVNIKAPKISMPDLNLNLKGPNVKGDVDVSIPNIEGDLKGP---------SLDIKSPKLDVNAP---------------DIDVHGPEGKL--KGPKLKMP-DMHVSMPKISMPEIDLNLKGSKVKGDVDISGP 3044          

HSP 25 Score: 49.6766 bits (117), Expect = 6.264e-6
Identity = 64/202 (31.68%), Postives = 97/202 (48.02%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE------IDGKKKKHG--INIGLPSMKGLKFEGKGKKPKS-EVDLGVKTPSIDIDIDGKK 675
            + +P + +P F+G           E P++DV +    PK  ID  V  P VDID   PD++IE          G D  L  P +K+P  E  +K PK      I  P++D+++ G + KG+VDV+   P +E +I  P++DI+             HG   ++ +P +K  KF   G K +  EVD  V  P  D+D+ G K
Sbjct: 3333 VKMPKFSMPGFKG-----------EGPEVDVSL----PKANID--VSGPKVDIDV--PDVNIE----------GPDAKLKGPKFKMP--EMNIKAPK------ISMPDIDLNLKGPKVKGDVDVSL--PKVEGEIKVPEVDIKGPKVDIDVPDVDVHGPDWHLKMPKIKMPKFSMPGFKGEGPEVD--VSLPKADLDVSGPK 3493          
BLAST of SMED30001359 vs. Ensembl Mouse
Match: Ahnak2 (AHNAK nucleoprotein 2 [Source:MGI Symbol;Acc:MGI:2144831])

HSP 1 Score: 56.9954 bits (136), Expect = 2.380e-8
Identity = 65/257 (25.29%), Postives = 110/257 (42.80%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIE-------VDIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK---------------------------KKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            H   + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E        D+  K  K    F +P++K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +  P  D+E+  ++                           K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+L++
Sbjct:  223 HLPKVQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSK----FKMPEFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQL--PSADLELKARQVGVKLPEGQLPEAELPAAQAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELAL 461          

HSP 2 Score: 55.0694 bits (131), Expect = 9.844e-8
Identity = 65/256 (25.39%), Postives = 110/256 (42.97%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIE-------VDIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEI--------DGKK------------------KKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            H   + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E        D+  K  K    F +P +K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +   D++++         +G+                   K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+LS+
Sbjct:  827 HLPKVQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSK----FKMPKFKMPSFGVSAPGKPSQEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQLRSADLELKAGQVGVKLPEGQLPEAELPAAQAAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELSL 1066          

HSP 3 Score: 53.9138 bits (128), Expect = 2.546e-7
Identity = 65/258 (25.19%), Postives = 108/258 (41.86%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIE-------VDIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK----------------------------KKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            H   + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E        D+  K  K    F +P +K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +  P  D+E+   +                            K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+L++
Sbjct:   50 HLPKVQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSK----FKMPKFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQL--PSADLELKAGQVGVKLPEGQLPEAELPAAQAAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELAL 289          

HSP 4 Score: 51.6026 bits (122), Expect = 1.163e-6
Identity = 58/258 (22.48%), Postives = 113/258 (43.80%), Query Frame = 1
Query:  103 INLPDWKLPKFE-GKLKKP--KGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEV--------DIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK----------------------------KKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
              +P +K+P F      KP  + +L+V AP+++ D+   + +G++   DL+V+ P+ D++ +   + +++        D+  K  K    F +P +K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +  P  D+E+   +                            K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+L++
Sbjct:  473 FKMPKFKMPSFGVSAPGKPSLEASLEVGAPNVEADVVPPQVQGDLKTPDLSVQLPSADLELNVGQVGVKLLEGHLADKDVAAKDSK----FKMPKFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQL--PSADLELKAGQVGVKLPEGQLPEAELPAAQAAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELAL 720          
BLAST of SMED30001359 vs. Ensembl Mouse
Match: MF597757.2 (pep chromosome:GRCm38:CHR_MG3490_PATCH:112777125:112799712:-1 gene:ENSMUSG00000116477.1 transcript:ENSMUST00000230761.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:MF597757.2)

HSP 1 Score: 56.225 bits (134), Expect = 4.334e-8
Identity = 64/253 (25.30%), Postives = 109/253 (43.08%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIE-------VDIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK---------------------------KKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E        D+  K  K    F +P++K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +  P  D+E+  ++                           K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+L++
Sbjct:  929 VQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSK----FKMPEFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQL--PSADLELKARQVGVKLPEGQLPEAELPAAQAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELAL 1163          

HSP 2 Score: 53.1434 bits (126), Expect = 4.567e-7
Identity = 64/254 (25.20%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIE-------VDIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK----------------------------KKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E        D+  K  K    F +P +K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +  P  D+E+   +                            K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+L++
Sbjct:  593 VQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSK----FKMPKFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQL--PSADLELKAGQVGVKLPEGQLPEAELPAAQAAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELAL 828          

HSP 3 Score: 53.1434 bits (126), Expect = 4.567e-7
Identity = 64/254 (25.20%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIE-------VDIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK----------------------------KKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E        D+  K  K    F +P +K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +  P  D+E+   +                            K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+L++
Sbjct: 1101 VQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSK----FKMPKFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQL--PSADLELKAGQVGVKLPEGQLPEAELPAAQAAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELAL 1336          

HSP 4 Score: 51.6026 bits (122), Expect = 1.426e-6
Identity = 63/252 (25.00%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIE-------VDIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEI--------DGK------------------KKKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E        D+  K  K    F +P +K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +   D++++         +G+                   K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+L++
Sbjct: 1274 VQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSK----FKMPKFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQLPSADLELKAGQVGVKLPEGQLPEAELPAAKAAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELAL 1509          
BLAST of SMED30001359 vs. Ensembl Mouse
Match: MF597757.2 (pep chromosome:GRCm38:CHR_MG3490_PATCH:112777125:112799712:-1 gene:ENSMUSG00000116477.1 transcript:ENSMUST00000231111.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:MF597757.2)

HSP 1 Score: 56.225 bits (134), Expect = 4.334e-8
Identity = 64/253 (25.30%), Postives = 109/253 (43.08%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIE-------VDIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK---------------------------KKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E        D+  K  K    F +P++K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +  P  D+E+  ++                           K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+L++
Sbjct:  929 VQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSK----FKMPEFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQL--PSADLELKARQVGVKLPEGQLPEAELPAAQAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELAL 1163          

HSP 2 Score: 53.1434 bits (126), Expect = 4.567e-7
Identity = 64/254 (25.20%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIE-------VDIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK----------------------------KKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E        D+  K  K    F +P +K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +  P  D+E+   +                            K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+L++
Sbjct:  593 VQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSK----FKMPKFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQL--PSADLELKAGQVGVKLPEGQLPEAELPAAQAAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELAL 828          

HSP 3 Score: 53.1434 bits (126), Expect = 4.567e-7
Identity = 64/254 (25.20%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIE-------VDIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK----------------------------KKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E        D+  K  K    F +P +K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +  P  D+E+   +                            K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+L++
Sbjct: 1101 VQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSK----FKMPKFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQL--PSADLELKAGQVGVKLPEGQLPEAELPAAQAAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELAL 1336          

HSP 4 Score: 51.6026 bits (122), Expect = 1.426e-6
Identity = 63/252 (25.00%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIE-------VDIDGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEI--------DGK------------------KKKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E        D+  K  K    F +P +K+P F      KP  E  +++  P+V+ D+   + +G+       PDL + +   D++++         +G+                   K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+L++
Sbjct: 1274 VQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSK----FKMPKFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGD----LKTPDLSVQLPSADLELKAGQVGVKLPEGQLPEAELPAAKAAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELAL 1509          
BLAST of SMED30001359 vs. Ensembl Mouse
Match: Ahnak2 (AHNAK nucleoprotein 2 [Source:MGI Symbol;Acc:MGI:2144831])

HSP 1 Score: 55.8398 bits (133), Expect = 5.671e-8
Identity = 64/252 (25.40%), Postives = 109/252 (43.25%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDI---DGKKKKHGLDFNLPDWKLPKFE-GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEID--GKK------------------------KKHGINIGLPSMKGLKFEGKG-----KKPKSEV----------DLGVKTPSIDIDIDGKKHRISGDLSV 702
            H   + +P  K+PK +  LK P   +D++ P +DV    K  KGE+   DL V  P V++D   P   +E ++   D         F +P +K+P F      KP  E  +++  P+V+ D+   + +G++      PDL + +   D++++    G K                        K H   + +PS+K  K + KG     K PK +V          DL V  P +++DI     ++ G+LS+
Sbjct:  220 HLPKVQMPSLKMPKVD--LKGPH--VDLKGPKVDV----KGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELALADKDVAAKDSKFKMPKFKMPSFGVSAPGKPSLEASLEVGAPKVEADVAPPQVQGDLKT----PDLSVQLRSADLELKAGQVGVKLPEGQLPEAELPAAQAAAAAGAGLKGHLPKVQMPSLKMPKVDLKGPHVDLKGPKVDVKGAKGEVSAPDLEVSLPGVEVDIQAPGAKLEGELSL 459          
BLAST of SMED30001359 vs. UniProt/SwissProt
Match: sp|Q09666|AHNK_HUMAN (Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 1.017e-11
Identity = 112/365 (30.68%), Postives = 170/365 (46.58%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDW--KLPKFE-GKLKKP--KGE----------LDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHL-----SIPEVDIDVDGKKKKHGFGINLP 1071
            +DI++PD  +   EGKLK PK         A  +  PDID+++ G K KG++D+++  P V+ D   PD+DI   +VDI+       +D   PDW  K+PK +  K+  P  KGE           D+D+ GP+VDVD     I G  AK      F  P++ I    I+ PD D+ + G K K  +++ LP M     EG  K P  EVD  +K P +DID  D   H    D  +  P   +        K +   +D+NLP                + D+D++ P++D D                 D+++  P+    ++G K K   D+HL     S+PEVD+++ G K K    ++LP
Sbjct: 3840 VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSL--PKVEGDMQVPDLDIKGPKVDINAPD----VDVRGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLPKADLDVSGPKVDVDVPDVNIEGPDAKLK-GPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKM-----EGDLKAP--EVD--IKGPKVDIDAPDVDVH--GPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLP----------------KADIDVSGPKVDIDTP---------------DIDIHGPEGK--LKGPKFKMP-DLHLKAPKISMPEVDLNLKGPKMKGDVDVSLP 4152          

HSP 2 Score: 67.781 bits (164), Expect = 7.032e-11
Identity = 111/360 (30.83%), Postives = 179/360 (49.72%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDID-----IDGKKHRISG------DLSVDKPXXXXX-XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDAS-----IDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +DI++PD  +   + KLK PK     ++++AP I   D D+H K PK + D++V  P V+ D   P++DI   +VDID      HG D++L  P  K+PKF     K +G        + DI+I GP+VD+D     I G  AK      F  P++ I    I+ PD+D  + G K K  +++ LP     K EG  K P  E+D  +K PS+DID     I+G + ++ G      ++++  P   +   D+ +   K K  +D++LP                +V+ D+  PE+D +G   K K          DV+ + P  S     ++++G K KGD+D+  S+P+++ D+ G K
Sbjct: 4224 VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVTLPKADIEISGPKVDIDAPDVSIEGPDAKLK-GPKFKMPEMNIKAPKISMPDIDFNLKGPKVKGDVDVSLP-----KVEGDLKGP--EID--IKGPSLDIDTPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLP----------------KVESDLKGPEVDIEGPEGKLKGPKFKMP---DVHFKSPQISMSDIDLNLKGPKIKGDMDI--SVPKLEGDLKGPK 4552          

HSP 3 Score: 67.3958 bits (163), Expect = 9.031e-11
Identity = 100/362 (27.62%), Postives = 165/362 (45.58%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDW-------KLPKFEGKLKKPKG--------ELDIDIRGPEVDVDIHGNRAKGNV----DVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DI+ PD  +   EGK K PK         A  +  PDID+++ G K KG++D+++  P ++ D   P++DI   +VDI+       +D   PDW       K+PKF     K +G        + D+D+ GP+VD+D+     +G         F  P++ I    I+ PD+D+ + G K K  +++ LP     K EG  + P    DL +K P +DI+      R   D  +  P   +        K +   +D+NLP                + DLD++ P++D D                 DVN+E PDA   ++G K K  ++++    +S+P+ D+ + G K K    ++LP
Sbjct: 3712 VDIDTPDINIEGSEGKFKGPKFKIPEMHLKAPKISMPDIDLNLKGPKVKGDVDVSL--PKMEGDLKGPEVDIKGPKVDINAPD----VDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLP-----KVEGDMQVP----DLDIKGPKVDINAPDVDVR-GPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLP----------------KADLDVSGPKVDVDVP---------------DVNIEGPDAK--LKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLP 4024          

HSP 4 Score: 66.6254 bits (161), Expect = 1.672e-10
Identity = 110/370 (29.73%), Postives = 169/370 (45.68%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP---------------------------DWKLPKFEGKLKKPKGELDIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            LDI+ PD  +   EGKLK PK     ++++AP I   D D+H K PK + D++V  P V+ D   P++DIE   +GK K  G  F +P                           D  +PK EG LK PK    +D++GP+V     D+DIHG   K      F  PDL +    I+ P++D+ + G K K  ++I LP     K EG  K P  EVD  ++ P +DID+     +   D  +  P   +        K +   +D+NLP                + D+D++ P++D D                 DVN+E PDA   ++G K K  ++ +    +S+P++D+++ G K K    + LP
Sbjct: 4426 LDIDTPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVESDLKGPEVDIE-GPEGKLK--GPKFKMPDVHFKSPQISMSDIDLNLKGPKIKGDMDISVPKLEGDLKGPK----VDVKGPKVGIDTPDIDIHGPEGKLK-GPKFKMPDLHLKAPKISMPEVDLNLKGPKVKGDMDISLP-----KVEGDLKGP--EVD--IRDPKVDIDVPDVDVQ-GPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLP----------------KADIDVSGPKVDVDVP---------------DVNIEGPDAK--LKGPKFKMPEMSIKAPKISMPDIDLNLKGPKVKGDVDVTLP 4744          

HSP 5 Score: 66.2402 bits (160), Expect = 1.894e-10
Identity = 113/394 (28.68%), Postives = 177/394 (44.92%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPD---------WKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKK-HGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV---DIHGNRAKGNV-DVTFNKPDLEIDITK---PDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDVH---LSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNL K +IDV   K                 +D+  PD         WK PKF   E   K PK    +  PDID+++ G K KG++D  V  P V+ D   P++D++   VDID       G D++L  P  K+PKF     K +G        + D+D+ GP+VDV   D++    +G +    F  P++ I   K   PD D+ + G K K  ++I LP     K EG  K P  EVD  ++ P +DID+     +   D  +  P   +        K +   +D+NLP                + DLD++ P++D D                 DVN+E P+  +  +G K K  ++++    +S+P++D+++ G K K    ++LP
Sbjct: 2787 DVNLPKADIDVSGPK-----------------VDVECPDVNIEGPEGKWKSPKFKMPEMHFKTPK----ISMPDIDLNLTGPKIKGDVD--VTGPKVEGDLKGPEVDLKGPKVDIDVPDVNVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDVSGPKVDVEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKIPMPDFDLHLKGPKVKGDVDISLP-----KVEGDLKGP--EVD--IRGPQVDIDVPDVGVQ-GPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLP----------------KADLDVSGPKVDIDVP---------------DVNIEGPEGKL--KGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLP 3114          

HSP 6 Score: 65.0846 bits (157), Expect = 5.715e-10
Identity = 97/326 (29.75%), Postives = 153/326 (46.93%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKP----KGA-LDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL------DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVD 1020
            D  +PK EG++K P    +G  +D++APD+DV   D H K PK ++          + P VD++  K D    VD+ G K    +D  +PD  L   EGKLK PK ++         I  P+VD ++ G + KG+VDV+   P LE ++  P++D+      K   ++  +P +      GK K PK ++ D+  K P I   D+D+  K  +  G++ VD P         +    K   +D++ P                  D+DI  PE    G   K  D +         N+ +PD  ++++G K KGD+DV  S+PEV+
Sbjct: 2203 DVSVPKVEGEMKVPDVDIRGPKVDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKGEGPEVDVNLPKAD----VDVSGPK----VDVEVPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDFNLKGPKIKGDVDVS--APKLEGELKGPELDV------KGPKLDADMPEVAVEGPNGKWKTPKFKMPDMHFKAPKISMPDLDLHLKSPKAKGEVDVDVPK--------LEGDLKGPHVDVSGP------------------DIDIEGPEGKLKGPKFKMPDMHFKAP-----NISMPDVDLNLKGPKIKGDVDV--SVPEVE 2479          

HSP 7 Score: 64.6994 bits (156), Expect = 6.589e-10
Identity = 103/359 (28.69%), Postives = 170/359 (47.35%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDVDIHGNRAKGNV----DVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI---DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINL 1068
            +D+  PD  +   EGKLK PK     ++++AP I   D D+H K PK + D+++  P V+ D   P++DI   +VDID       G D++L  P  K+PKF     K +G        + D+D+ GP+VD+D+     +G         F  P++ I    I+ PD+D+ + G K K  +++ LP     K EG  K P    D+ +K P +DI   D+D     + G D  +  P   +        K +   +D+NLP                + DLD++ P++D D                 DVN+E PDA   ++G K K  ++++    +S+P++D+++ G K K    ++L
Sbjct: 2930 VDVEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKIPMPDFDLHLKGPKVKGDVDISLPKVEGDLKGPEVDIRGPQVDIDVPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLP-----KVEGDMKVP----DVDIKGPKVDINAPDVD-----VQGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLP----------------KADLDVSGPKVDVDVP---------------DVNIEGPDAK--LKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSL 3241          

HSP 8 Score: 64.6994 bits (156), Expect = 7.138e-10
Identity = 76/218 (34.86%), Postives = 115/218 (52.75%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKF----------EGKLKKPKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDID 660
            +DI  PD  +   EGKLK PK     ++++AP I   D D+H K PK + D++V  P V+ D   P++DI   +VDI+       G D++L  P  K+PKF          +G +K PK ++D     +DI GP+V+++    + KG     F  P++ I    I+ PD+D+ + G K K  +++ LP     K EG  K P  EVD  +K P +DID
Sbjct: 2546 VDIEGPDVNIEGPEGKLKGPKLKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDINAPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDGDVKLPKADIDVSGPKVDIEGPDVNIEGPEGKLKGP---KFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLP-----KVEGDLKGP--EVD--IKGPKVDID 2751          

HSP 9 Score: 64.6994 bits (156), Expect = 7.331e-10
Identity = 112/358 (31.28%), Postives = 175/358 (48.88%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKP----KGA-LDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEV---DVDIH--GNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP--SMKGLKF---EGKGKKPK---SEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGID--INLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD----IDVH-----LSIPEVDIDVDGKKKKHGFGINLP 1071
            D  +PK EG++K P    KG  +D++APD+DV   D H K PK ++          + P VD++  K D    V + G K    +D  +PD  L   EGKLK PK ++ ++  + P++   DVD+H  G + KG+VDV+   P LE D+T P +D+E+        + +  P   +KG KF   E   K PK    +V+L +K P +  D+D    ++ G++ V   D         +     HG D  + +P  K PKFS    K +G  ++D+N P+ D D +  K             V+VEVPD S++    K KG      ++H     +S+P+VD ++ G K K    ++ P
Sbjct: 2008 DVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKAD----VVVSGPK----VDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSL--PKLEGDLTGPSVDVEV------PDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVNLNLKGPKVKGDMDVSVPKVEGEMKVPDVDIRGPKVDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKGEGP-EVDVNLPKADVDVSGPK-------------VDVEVPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDFNLKGPKIKGDVDVSAP 2335          

HSP 10 Score: 64.3142 bits (155), Expect = 1.019e-9
Identity = 107/360 (29.72%), Postives = 172/360 (47.78%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKF-------EG---KLKKPKGELDID-----IRGPEVDVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DIN PD ++   +GK+K  K     L + +P +   DV+++ K PK + DL++  PN++ DF  P +DI   EV+++      HG D+NL  P  K+PKF       EG    +  PKG+++I+     I GP+++V+      KG     F  PD+ I    I+ PD+D+ + G K K  ++I LP     K EG  K P  EVD  +K P +DI+  D   H    D  +  P   +        K +   +D+ LP                + D+DI+ P +D D                 DVN+E PDA   ++G K K  ++++    +S+P+ D+++ G K K    ++LP
Sbjct: 3385 VDINAPDVEV---QGKVKGSKFKMPFLSISSPKVSMPDVELNLKSPKVKGDLDIAGPNLEGDFKGPKVDIKAPEVNLNAPDVDVHGPDWNLKMPKMKMPKFSVSGLKAEGPDVAVDLPKGDINIEGPSMNIEGPDLNVEGPEGGLKGP---KFKMPDMNIKAPKISMPDIDLNLKGPKVKGDVDISLP-----KLEGDLKGP--EVD--IKGPKVDINAPDVDVH--GPDWHLKMPKVKMPKFSMPGFKGEGPEVDVTLP----------------KADIDISGPNVDVDVP---------------DVNIEGPDAK--LKGPKFKMPEMNIKAPKISMPDFDLNLKGPKMKGDVVVSLP 3694          

HSP 11 Score: 63.5438 bits (153), Expect = 1.588e-9
Identity = 74/226 (32.74%), Postives = 117/226 (51.77%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGP-----EVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE---IDGKK---KKHGI--NIGLPSMKGLKFEG---KGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKP 711
            D  +PK EG LK PK  +DV APD+++   D + K PK ++       L  + P  D++  K ++DI            +D N PD  L   EGKLK PK ++ ++  R P     +VD+D+ G + KGNVD++   P +E ++  PD+DI    +D K    +  G+  ++ +P MK  KF     KG+ P+ +V+L    P  D+ + G K  I   D+S++ P
Sbjct:  965 DMTVPKLEGDLKGPK--VDVSAPDVEMQGPDWNLKMPKIKMPKFSMPSLKGEGPEFDVNLSKANVDISA--------PKVDTNAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPKMKGNVDIS--APKIEGEMQVPDVDIRGPKVDIKAPDVEGQGLDWSLKIPKMKMPKFSMPSLKGEGPEVDVNL----PKADVVVSGPKVDIEAPDVSLEGP 1174          

HSP 12 Score: 62.3882 bits (150), Expect = 3.755e-9
Identity = 109/387 (28.17%), Postives = 172/387 (44.44%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKP----KGA-LDVEAPDIDV---DIHGKKPKGEI-------------DLNVKNPNVDIDFHKPDIDIEV---DIDGKKKK-HGLDFNLPDW---------------------------KLPKFEGKLKKPKGELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI---DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            D  LPK EG LK P    KG  +D+ APD+DV   D H K PK ++             +++V  P  DID   P++D++V   +I+G   K  G  F +P+                             LPK EG LK P    ++DI+GP+VD+D     I G+  K      F  P++ +    I+ PD+D+ + G K K  +++ LP M     EG  K P  EVD  +K P +DI   D+D     + G D  +  P   +        K +   +D+NLP                + DLD++ P++D D                 DVN+E P+    ++G K K  ++++    +S+P++D+++ G K K    ++LP
Sbjct: 3562 DISLPKLEGDLKGPEVDIKGPKVDINAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVTLPKADIDISGPNVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLNLKGPKMKGDVVVSLPKVEGDLKGP----EVDIKGPKVDIDTPDINIEGSEGKFK-GPKFKIPEMHLKAPKISMPDIDLNLKGPKVKGDVDVSLPKM-----EGDLKGP--EVD--IKGPKVDINAPDVD-----VQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLP----------------KADLDVSGPKVDIDVP---------------DVNIEGPEGK--LKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLP 3896          

HSP 13 Score: 62.003 bits (149), Expect = 4.405e-9
Identity = 96/357 (26.89%), Postives = 151/357 (42.30%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEV-DIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTF-----NKPDLEID----------------------ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI---DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLD----------INTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVD 1020
            + +PD  +   EGKLK PK         A  +  PD+D+ + G K KGE D+ V  P ++ D   P +D+   D++      G D+NL  P  K+PKF   +   KGE      GPE DV    N +K NVD++      N PDL ++                      ++ PD+D+++ G K K  ++I  P     K EG+ + P    D+ ++ P +DI   D++G+      D S+  P   +      S K +   +D+NLP         K       V L+             PE+ F                     + +PD  + ++G K KGD+DV  S+P+V+
Sbjct:  915 VEVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDMTV--PKLEGDLKGPKVDVSAPDVE----MQGPDWNLKMPKIKMPKFS--MPSLKGE------GPEFDV----NLSKANVDISAPKVDTNAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPKMKGNVDISAP-----KIEGEMQVP----DVDIRGPKVDIKAPDVEGQGL----DWSLKIPKMKMPKFSMPSLKGEGPEVDVNLPKADVVVSGPKVDIEAPDVSLEGPEGKLKGPKFKMPEMHFKTP-----------------KISMPDVDLHLKGPKVKGDVDV--SVPKVE 1221          

HSP 14 Score: 62.003 bits (149), Expect = 4.405e-9
Identity = 80/236 (33.90%), Postives = 120/236 (50.85%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDW--KLPKFE-GKLKKP--KGE----------LDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPS----MKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG 690
            +DI++PD  +   EGKLK PK         A  +  PDID+++ G K KG++D+++  P V+ D   PD+DI   +VDI+       +D   PDW  K+PK +  K+  P  KGE           D+D+ GP+VDVD     I G  AK      F  P++ I    I+ PD+D+ + G K K  +++ L +    +KG   + KG  PK +VD      + DIDI G   ++ G
Sbjct: 3058 VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSL--PKVEGDMKVPDVDIKGPKVDINAPD----VDVQGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLPKADLDVSGPKVDVDVPDVNIEGPDAKLK-GPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSLANVEGDLKGPALDIKG--PKIDVD------APDIDIHGPDAKLKG 3278          

HSP 15 Score: 62.003 bits (149), Expect = 5.353e-9
Identity = 101/360 (28.06%), Postives = 165/360 (45.83%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKGE--------LDIDIRGPEVDVDIHGNRAKGNV----DVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI---DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DI  PD  L   EGKLK PK     +  + P I   DVD+H K PK + D++V  P V+ +   PD++I   ++DID    +  G D++L  P  K+PKF     K +G          DID+ GP+VDV++     +G         F  P++      I+ PD+D+ + G K K  +++ LP +     EG+ K P    D+ +K P +DI   D+D     + G D  +  P   +        K +   +D+ LP                + D+D++ P++D +                 DVN+E PDA   ++G K K  ++ +    +SIP+V + + G K K  + + +P
Sbjct: 1162 VDIEAPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDVDVSVPKVEGEMKVPDVEIKGPKMDIDAPDVEVQGPDWHLKMPKMKMPKFSMPGFKGEGREVDVNLPKADIDVSGPKVDVEVPDVSLEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLNLKGPKLKGDVDVSLPEV-----EGEMKVP----DVDIKGPKVDISAPDVD-----VHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVKLP----------------KADVDVSGPKMDAEVP---------------DVNIEGPDAK--LKGPKFKMPEMSIKPQKISIPDVGLHLKGPKMKGDYDVTVP 1474          

HSP 16 Score: 61.2326 bits (147), Expect = 8.788e-9
Identity = 92/332 (27.71%), Postives = 154/332 (46.39%), Query Frame = 1
Query:  103 INLPDWKLPKFEGK-----LKKPKGALDVEAPDIDVDI---HGKKPKGEI-DLNVKNPNVDIDFHKPDI-DIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV-----DIHGNRAKGNVDVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            + +P + +P F+G+     +  PK  L V  P +D+D+   + + P+G++     K P+++I  HK  + D+ +++   K K  +D +LP     K EG LK P    +ID++ P++DV     DI G   K      F  P++      I+ PD+D+ + G K K  +++ +P     K EG+ K P    D+ +K P +DID  D + H    D  +  P   +        K +   +D+NLP                  DLDI  PE    G+  K    N          V +PD  ++++G K KG+ID   S+PE++ D+ G +
Sbjct: 1513 VKMPKFSMPGFKGEGPEVDMNLPKADLGVSGPKVDIDVPDVNLEAPEGKLKGPKFKMPSMNIQTHKISMPDVGLNLKAPKLKTDVDVSLP-----KVEGDLKGP----EIDVKAPKMDVNVGDIDIEGPEGKLK-GPKFKMPEMHFKAPKISMPDVDLHLKGPKVKGDMDVSVP-----KVEGEMKVP----DVDIKGPKVDIDAPDVEVH--DPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPSVDTD--APDLDIEGPEGKLKGSKFKMPKLNIKAP-----KVSMPDVDLNLKGPKLKGEIDA--SVPELEGDLRGPQ 1814          

HSP 17 Score: 60.4622 bits (145), Expect = 1.604e-8
Identity = 108/355 (30.42%), Postives = 168/355 (47.32%), Query Frame = 1
Query:   97 LDINLPDWKL--PKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEV---DVDIH--GNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP--SMKGLKF---EGKGKKPK---SEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGID--INLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD----IDVH-----LSIPEVDIDVDGKKKKHGFGINLP 1071
            +D+  PD KL  PKF   E   K PK ++       DVD+H K PK + D +V  P ++ D   P + +EV               PD +L   + KLK PK ++ D+  + P++   DVD+H  G + KG+VDV+   P LE D+T P + +E+        + +  P   +KG KF   E   K PK    +VDL +K P +  D+D    ++ G++ V   D         +     HG D  + +P  K PKFS    K++G  ++D+N P+ D   +  K             V+VEVPD S++    K KG      ++H     +S+P+VD+ + G K K    ++LP
Sbjct: 1829 VDLECPDAKLKGPKFKMPEMHFKAPKISMP------DVDLHLKGPKVKGDADVSVPKLEGDLTGPSVGVEV---------------PDVELECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDVDVSV--PKLEGDLTGPSVGVEV------PDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKAEGP-EVDVNLPKADVVVSGPK-------------VDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSLP 2140          

HSP 18 Score: 60.077 bits (144), Expect = 2.090e-8
Identity = 70/215 (32.56%), Postives = 109/215 (50.70%), Query Frame = 1
Query:  118 WKLPKFEGK---LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKK-HGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKS-EVDLGVKTPSIDIDIDGKKHRISG-DLSVDKP 711
            WK PKF+      K PK    +  PD+D+ +   K KGE+D++V  P ++ D   P +D+   ++DI+G + K  G  F +PD          K P      +I  P+VD+++ G + KG+VDV+   P++E  +  PDM+I   G K        +    ++ +P MK  KF   G K +  EVD  V  P  D+DI G K  I G D++++ P
Sbjct: 2369 WKTPKFKMPDMHFKAPK----ISMPDLDLHLKSPKAKGEVDVDV--PKLEGDLKGPHVDVSGPDIDIEGPEGKLKGPKFKMPDMHF-------KAP------NISMPDVDLNLKGPKIKGDVDVSV--PEVEGKLEVPDMNIR--GPKVDVNAPDVQAPDWHLKMPKMKMPKFSMPGFKAEGPEVD--VNLPKADVDISGPKVDIEGPDVNIEGP 2558          

HSP 19 Score: 59.6918 bits (143), Expect = 2.345e-8
Identity = 67/192 (34.90%), Postives = 100/192 (52.08%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEV-----DVDIHG--NRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKG 582
            +D+N+ D  +   EGKLK PK     +  +AP I   DVD+H K PK + D++V  P V+ +   PD+DI   +VDID    + H  D++L  P  K+PKF     K +G        + DID+ GP V     D+DI G   + KG+    F  P L I    ++ PD+D+ + G K K  I+  +P ++G
Sbjct: 1620 MDVNVGDIDIEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKVDIDAPDVEVHDPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPSVDTDAPDLDIEGPEGKLKGS---KFKMPKLNIKAPKVSMPDVDLNLKGPKLKGEIDASVPELEG 1808          

HSP 20 Score: 58.151 bits (139), Expect = 8.062e-8
Identity = 97/367 (26.43%), Postives = 154/367 (41.96%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD--------VEAPDIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV---DIHGNRAKGNV-DVTFNKPDLEIDITK---PDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKG------DIDV---HLSIPEVDIDVDGKKKKHGFGINLP 1071
            +++  PD  L    GKLK P   L         +  PD+D+ + G K KGE D+ V       K P VDID   PD+D+          HG D++L  P  K+PKF     K +G        + D+DI GP++DV   D+     +G +    F  P++ I + K   PD+D+ + G   K   ++ +P     K E + K P  E+       S  +DID     + G D  +  P   +        K +   +D+NLP                + D+DI+ P+                      V VEVPD +I+    K KG      ++++    +S+P+VD+ + G K K  + + +P
Sbjct:  664 VNVEAPDVNLEGLGGKLKGPDVKLPDMSVKTPKISMPDVDLHVKGTKVKGEYDVTVPKLEGELKGPKVDID--APDVDV----------HGPDWHLKMPKMKMPKFSVPGFKAEGPEVDVNLPKADVDISGPKIDVTAPDVSIEEPEGKLKGPKFKMPEMNIKVPKISMPDVDLHLKGPNVKGEYDVTMP-----KVESEIKVPDVELK------SAKMDIDVPDVEVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLP----------------KADVDISGPK----------------------VGVEVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDMTVP 969          

HSP 21 Score: 58.151 bits (139), Expect = 9.365e-8
Identity = 101/364 (27.75%), Postives = 167/364 (45.88%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDW--KLPKFEGKLKKPKGEL-DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK-KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG--------DLSVDKPXXXXXXXXXVSNKKKKHGI-------DINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDVH---LSIPEVDIDVDGKKKKHGFGINLP 1071
            +D++ PD  +   EGKLK PK         A ++  PD+D+++ G K KG++D++V  P V+     PD++I    VD++        D   PDW  K+PK    +K PK  +      GPEVDV    N  K +VD++  K    +DI  PD++IE     + G K K   +NI  P +    F+   K PK + D+ V  P ++ D+ G +  I G        D+ V  PD  + +      K    G        D+ LP                + D+D++ P++D +G                DVN+E P+  +  +G K K  ++++    +S+P++D+++ G K K    ++LP
Sbjct: 2420 VDVSGPDIDIEGPEGKLKGPKFKMPDMHFKAPNISMPDVDLNLKGPKIKGDVDVSV--PEVEGKLEVPDMNIRGPKVDVNAP------DVQAPDWHLKMPK----MKMPKFSMPGFKAEGPEVDV----NLPKADVDISGPK----VDIEGPDVNIEGPEGKLKGPKLKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDINAPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDGDVKLP----------------KADIDVSGPKVDIEGP---------------DVNIEGPEGKL--KGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLP 2730          

HSP 22 Score: 58.151 bits (139), Expect = 9.448e-8
Identity = 86/260 (33.08%), Postives = 126/260 (48.46%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDVD-----IHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG 690
            DVNL K +IDV   K                 +D+++PD  +   + KLK PK         A  +  PDID+++ G K KG++D+ +  P V+ D   P+ DI   +VDI+      HG D++L  P  K+PKF     K +G        + DID+ GP+VDVD     I G  AK      F  P++ I    I+ PD+D+++ G K K   ++ +P     K EG  K P  EVDL  K P   +D +G   ++SG
Sbjct: 4673 DVNLPKADIDVSGPK-----------------VDVDVPDVNIEGPDAKLKGPKFKMPEMSIKAPKISMPDIDLNLKGPKVKGDVDVTL--PKVEGDLKGPEADIKGPKVDINTPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVSLPKADIDVSGPKVDVDIPDVNIEGPDAKLK-GPKFKMPEINIKAPKISIPDVDLDLKGPKVKGDFDVSVP-----KVEGTLKGP--EVDL--KGPR--LDFEGPDAKLSG 4901          

HSP 23 Score: 57.3806 bits (137), Expect = 1.392e-7
Identity = 81/267 (30.34%), Postives = 125/267 (46.82%), Query Frame = 1
Query:   97 LDINLPDWKL--PKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK-KKHGLDFNL--PDWKLPKF----------------------------------------EGKLKKPKGEL-DIDIRGPEV---DVDIH--GNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP--SMKGLKF---EGKGKKPK---SEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +++  PD KL  PKF   E   K PK ++       DVD+H K PK + D++V  P V+ +   PD+DI   ++DID      HG D++L  P  K+PKF                                        EGKLK PK ++ ++  + P++   DVD+H  G + KG+VDV+   P LE D+T P +D+E+        + +  P   +KG KF   E   K PK    +V+L +K P +  D+D    ++ G++ V
Sbjct: 1963 VELECPDAKLKGPKFKMPEMHFKTPKISMP------DVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVVVSGPKVDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSL--PKLEGDLTGPSVDVEV------PDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVNLNLKGPKVKGDMDVSVPKVEGEMKV 2215          

HSP 24 Score: 56.225 bits (134), Expect = 3.354e-7
Identity = 101/367 (27.52%), Postives = 173/367 (47.14%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVDI----------HGKKPKGEI------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGP-----EVDVDIHGNRAKGNVDVTFNK-------PDLEI-----DITKPDMDIE-IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV-----DLGVKTPSIDID-----IDGKKHRISG------DLSVDKPXXXXXXX-XXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-GDIDVHL---SIPEVDIDVDGKKKK 1047
            D  LPK EG LK P+  +D+  P +D+D+          H K PK ++          + P+VD++  K D+D+     G K    +D ++PD  +   EGKLK PK ++ +++I+ P     ++D+++ G + KG++DV+  K       PD++I     DI  PD+D++  D   K   I +   SM G K EG    P+ +V     DL V  P +D+D     I+G   ++ G      ++++  P   +    +++   K K  +D++L N +                LDI  P+ID D                 D+++  PDA +  +G K K  D+ V++   S+PE+D+++ G K K
Sbjct: 2982 DISLPKVEGDLKGPE--VDIRGPQVDIDVPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVS----GPK----VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMKVPDVDIKGPKVDINAPDVDVQGPDWHLKMPKIKMPKISMPGFKGEG----PEVDVNLPKADLDVSGPKVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSLANVEGDLKGPA---------LDIKGPKIDVDAP---------------DIDIHGPDAKL--KGPKLKMPDMHVNMPKISMPEIDLNLKGSKLK 3308          

HSP 25 Score: 56.225 bits (134), Expect = 3.793e-7
Identity = 92/367 (25.07%), Postives = 152/367 (41.42%), Query Frame = 1
Query:  103 INLPDWKLPKFEGK-----LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDID---FHKPDIDI--------EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKK--KKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEID----------------------------FXXXXXXXXXXXXXXXXXIDVNVEVPDAS--IDIQGKKHKGDIDVHLSIPEVDIDVDGKKKK 1047
            + +P + +P F+G+     +  PK  +DV  P +DVDI         D+N++ P+  +    F  P+I+I        +VD+D K  K   DF   D  +PK EG LK P    ++D++GP +D +    +  G    +   P LEI    +T PD+D+ +   K    I    P ++G + + KG K        V+ PS+D+ +D     I G D+ + K           S K   K   +D+ +P                + +L++ TPEI                             FD N    +     K   +DVN+  PDA+  +D++  K K  +   +  P+V+ D+   K K
Sbjct: 4783 VKMPKFSMPGFKGEGPDVDVSLPKADIDVSGPKVDVDIP--------DVNIEGPDAKLKGPKFKMPEINIKAPKISIPDVDLDLKGPKVKGDF---DVSVPKVEGTLKGP----EVDLKGPRLDFEGPDAKLSGP---SLKMPSLEISAPKVTAPDVDLHLKAPK----IGFSGPKLEGGEVDLKGPK--------VEAPSLDVHMDSPDINIEGPDVKIPKFKKPKFGFGAKSPKADIKSPSLDVTVP----------------EAELNLETPEISVGGKGKKSKFKMPKIHMSGPKIKAKKQGFDLNVPGGEIDASLKAPDVDVNIAGPDAALKVDVKSPKTKKTMFGKMYFPDVEFDIKSPKFK 5103          

HSP 26 Score: 54.299 bits (129), Expect = 1.531e-6
Identity = 96/365 (26.30%), Postives = 165/365 (45.21%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALD---VEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKL--PKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNK-------PDLEI-----DITKPDMDIEIDGKKKKHG--INIGLPSMKGLKFEGKGKKPKS--------EVDLGVKTPSIDIDI-----DGKKHRISG------DLSVDKPXXXXX-XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEV-------DIDVDGKK 1041
            + +PD +L   + KLK PK  +     +AP I   DVD+H K PK + D++V  P ++ D   P + +EV          ++   PD KL  PKF   E   K PK      I  P+VD+ + G + KG++DV+  K       PD++I     DI  PD+D+        HG   ++ +P MK  KF   G K +         + D+ V  P +D+++     +G + ++ G      ++    P   +  +D+ +   K K  +D++LP  +              VD+++   E++      K       +       + +PD +++++G K KGD+DV  S+P+V       D+D+ G K
Sbjct: 1891 VEVPDVELECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDVDVSVPKLEGDLTGPSVGVEV--------PDVELECPDAKLKGPKFKMPEMHFKTPK------ISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDV--------HGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVVVSGPKVDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSLPKLEGDLTGP-------SVDVEVPDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVNLNLKGPKVKGDMDV--SVPKVEGEMKVPDVDIRGPK 2224          

HSP 27 Score: 52.373 bits (124), Expect = 6.319e-6
Identity = 48/173 (27.75%), Postives = 87/173 (50.29%), Query Frame = 1
Query:  214 PKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGL--DFNLP----DWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDL---EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI---DIDIDGKKHRISGDL 696
            P GEID ++K P+VD++   PD  ++VD+   K K  +      P    D K PKF+ +   P  +L+ +++ P++++ +     +G +D+    P +   ++DI+ P   IE D K  K   N+G P +     + K K P      G+  P +   D++++ K  +I GD+
Sbjct: 5047 PGGEIDASLKAPDVDVNIAGPDAALKVDVKSPKTKKTMFGKMYFPDVEFDIKSPKFKAEAPLPSPKLEGELQAPDLELSLPAIHVEG-LDIKAKAPKVKMPDVDISVP--KIEGDLKGPKVQANLGAPDINIEGLDAKVKTP----SFGISAPQVSIPDVNVNLKGPKIKGDV 5212          
BLAST of SMED30001359 vs. UniProt/SwissProt
Match: sp|Q8IVF2|AHNK2_HUMAN (Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2 PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 1.148e-10
Identity = 62/245 (25.31%), Postives = 114/245 (46.53%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDI------------EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNV---DVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKH-----RISGDLSV 702
            + +P +K+PK +  LK P+  +D++ P +D+ +    PK E+   D+ V  P+V++D   P   +            E D+  K  K    F +P +K+P F         E  +D+  P+V+ D+  +  +G++   D++   P  ++++    +D+E+           K H   + +PS+K  K + KG            K PK+EV   D+ V  PS+++D+   K      R+ GDLS+
Sbjct: 3394 VEMPSFKMPKVD--LKSPQ--VDIKGPKLDLKV----PKAEVTVPDVEVSLPSVEVDVQAPRAKLDGARLEGDLSLAEKDVTAKDSK----FKMPKFKMPSFGVSAPGRSIEASLDVSAPKVEADVSLSSMQGDLKATDLSIQPPSADLEVQAVQVDVELLEGPVPEGAGLKGHLPKVEMPSLKTPKVDLKGPQIDVKGPKLDLKGPKAEVRVPDVEVSLPSVEVDVQAPKAKLDAGRLEGDLSL 3626          

HSP 2 Score: 58.9214 bits (141), Expect = 5.185e-8
Identity = 61/245 (24.90%), Postives = 111/245 (45.31%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEV------------DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEI-DGK------KKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKHR-----ISGDLSV 702
            + +P  K PK +  LK P+  +DV+ P +D+    K PK E+   D+ V  P+V++D   P   ++             D+  K  K    F +P +K+P F         E  +D+  P+V+ D+     +G     D++   P  ++ +    MD+++ +G+       K+H   + +PS+K  K + KG            K  K+EV   D+ V  PS+++D+   + +     + GDLS+
Sbjct: 3559 VEMPSLKTPKVD--LKGPQ--IDVKGPKLDL----KGPKAEVRVPDVEVSLPSVEVDVQAPKAKLDAGRLEGDLSLADKDVTAKDSK----FKMPKFKMPSFRVSAPGKSMEASVDVSAPKVEADVSLPSMQGDLKTTDLSIQPPSADLKVQAGQMDVKLPEGQVPEGAGLKEHLPKVEMPSLKMPKVDLKGPQVDIKGPKLDLKVSKAEVTAPDVEVSLPSVEVDVQAPRAKLDSAQLEGDLSL 3791          

HSP 3 Score: 58.5362 bits (140), Expect = 5.663e-8
Identity = 63/245 (25.71%), Postives = 108/245 (44.08%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEV------------DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVT-----FNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKK-----HRISGDLSV 702
            + +P  K+PK    LK P+  +DV+ P +D+    K PK E+   D+ V  P+V++D   P   ++             D+  K  K    F +P +K+P F         E  +D+  P+V+ ++     +G++  T         DL     ++D+  P+  +      K H   + +PS K  K + KG            K PK+EV   D+ V  PS+++D+  +K      R+ GDLS+
Sbjct: 1744 VQMPSLKMPKV--ALKGPQ--MDVKGPKLDL----KGPKAEVMAPDVEVSLPSVEVDVEAPGAKLDSVRLEGDLSLADKDVTAKDSK----FKMPKFKMPSFGVSAPGKSIEASVDVSAPKVEAEVSLPSMQGDLKTTDLCIPLPSADLVVQAGQVDMKLPEGQVPEGAGLKGHLPKVDMPSFKMPKVDLKGPQTDVKGAKLDLKGPKAEVTAPDVEVSLPSMEVDVQAQKAKLDGARLEGDLSL 1976          

HSP 4 Score: 58.151 bits (139), Expect = 8.129e-8
Identity = 83/345 (24.06%), Postives = 154/345 (44.64%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLD------------FNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDID--GKK---HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHL 1002
            + +P +K+PK +  LK P+  +DV+ P +D+    K PK E+   D+ V  P+V++D   P       +DG + +  L             F +P +K+P F         E+ +D+  P+V+ ++     +G     D++   P  ++++    +D+++           K H   + +PS K  K + KG            K PK++V   D+ V  P +++D++  G K    R+ GDLS+         D DV+ K  K      +P +K P F   +     +V +D++ P+++    A  S    +      D+++E P A +++Q     G +DV L
Sbjct: 2899 VQMPSFKMPKVD--LKGPQ--IDVKGPKLDL----KGPKAEVTAPDVEVSLPSVEVDVEAP----RAKLDGARLEGDLSLADKDVTAKDSKFKMPKFKMPSFGVSAPGKSIEVSVDVSAPKVEAEVSLPSMQGDLKTTDISIEPPSAQLEVQAGQVDLKLPEGHVPEGAGLKGHLPKLQMPSFKMPKVDRKGPQIDVKGPKLDLKGPKTDVTAPDVEVSQPGMEVDVEAPGAKLDGARLEGDLSL--------ADKDVTAKDSK----FKMPKFKMPSFGVSAPGKSIEVLVDVSAPKVE----ADLSLPSMQGDLKNTDISIEPPSAQLEVQA----GQVDVKL 3211          

HSP 5 Score: 57.7658 bits (138), Expect = 1.198e-7
Identity = 55/215 (25.58%), Postives = 110/215 (51.16%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKL--KKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL---DIDIRGPEVDVDIHGNRAKGNV-DVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP--SMKGLKFEGKGKKPKSEV-DLGVKTP--SIDIDIDGKKHRISGDLSVD 705
              +P +K+P +      K  + ++DV AP  + D+     +G++   DL+++ P+VD++     +D+++      +  GL  +LP  ++P F    K PK +L    +DI+GP++D+ +   +A+  V DV  + P +E+D+  P    ++DG + +  +++     + K  KF    K PK ++   GV  P  SI+  +D    ++  D+S+ 
Sbjct: 3308 FKMPKFKMPSYRASAPGKSIQASVDVSAPKAEADVSLPSMQGDLKTTDLSIQLPSVDLEVQAGQVDVKLPEGHVPEGAGLKGHLPKVEMPSF----KMPKVDLKSPQVDIKGPKLDLKV--PKAEVTVPDVEVSLPSVEVDVQAP--RAKLDGARLEGDLSLAEKDVTAKDSKF----KMPKFKMPSFGVSAPGRSIEASLDVSAPKVEADVSLS 3510          

HSP 6 Score: 57.3806 bits (137), Expect = 1.573e-7
Identity = 58/245 (23.67%), Postives = 109/245 (44.49%), Query Frame = 1
Query:  103 INLPDWKLPKFEGK------------LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEV---DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKK-----HRISGDLSV 702
            + +P +K+PK + K            LK PK  +DV APD++V     +P  E+D  V+ P   +D  + + D+ +   D+  K  K    F +P +K+P +         +  +D+  P+ + D+     +G     D++   P +++++    +D+++           K H   + +PS K  K + K             K PK+EV   D+ V  PS+++D+   +      R+ GDLS+
Sbjct: 3229 LQMPSFKMPKVDRKGPQIDIKGPKLDLKGPK--MDVTAPDVEVS----QPSMEVD--VEAPGAKLDGARLEGDLSLADKDVTAKDSK----FKMPKFKMPSYRASAPGKSIQASVDVSAPKAEADVSLPSMQGDLKTTDLSIQLPSVDLEVQAGQVDVKLPEGHVPEGAGLKGHLPKVEMPSFKMPKVDLKSPQVDIKGPKLDLKVPKAEVTVPDVEVSLPSVEVDVQAPRAKLDGARLEGDLSL 3461          

HSP 7 Score: 53.9138 bits (128), Expect = 1.584e-6
Identity = 54/236 (22.88%), Postives = 104/236 (44.07%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEV------------DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKHRISG 690
            + +P +K+PK    LK P+  +DV+ P +D+    K PK E+   D+ V  P+V++D   P   ++             D+  K  +    F +P +K+P F         E  +D+  P+V+ D+     +G     D++   P  ++++    +D+++           K H   + +PS+K  K + KG            K  K+EV   ++ V  PS+++D+     ++ G
Sbjct: 1084 VEMPSFKMPKV--ALKGPQ--VDVKGPKLDL----KSPKAEVTAPDVEVSLPSVEVDVEAPGAKLDSARLEGELSLADKDVTAKDSR----FKMPKFKMPSFGASAPGKSIEASVDVSAPKVEADVSLPSMQGDLKTTDLSIQPPSADLEVHAGQVDVKLLEGHVPEGAGFKGHLPKVQMPSLKMPKVDLKGPQVEVRGPKLDLKGHKAEVTAHEVAVSLPSVEVDMQAPGAKLDG 1307          

HSP 8 Score: 53.5286 bits (127), Expect = 2.588e-6
Identity = 60/251 (23.90%), Postives = 108/251 (43.03%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEV---DIDGKKKKHGLD------------FNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK----------------KKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKH-----RISGDLSV 702
            + +P +K+PK +  LK P+  +DV+ P +D+    K PK    + V  P+V +     ++D++     +DG + +  L             F +P +K+P F         E  +D+  P+V+ D+     +G++  T      ++ I  P  D+E+   +                K H   + +PS+K  K   KG            K PK+EV   D+ V  PS+++D++         R+ GDLS+
Sbjct: 1579 VQMPSFKMPKVD--LKGPQ--IDVKGPKLDL----KGPK----VEVTAPDVKMSLSSMEVDVQAPRAKLDGAQLEGDLSLADKAVTAKDSKFKMPKFKMPSFGVSAPGKSIEASVDVSEPKVEADVSLPSMQGDLKTT------DLSIQSPSADLEVQAGQVNVKLPEGPLPEGAGFKGHLPKVQMPSLKMPKVALKGPQMDVKGPKLDLKGPKAEVMAPDVEVSLPSVEVDVEAPGAKLDSVRLEGDLSL 1811          

HSP 9 Score: 53.5286 bits (127), Expect = 2.588e-6
Identity = 82/348 (23.56%), Postives = 152/348 (43.68%), Query Frame = 1
Query:   94 GLDINLPDWKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEI------------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKK-----HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHL 1002
            GL  +LP  ++P F   E  LK P+  +DV+ P++D+    K PK E+            +++V+ P   +D  + + D+ +   G   K    F +P +K+P F         E  +D+   +V+ D      +G     D+    P  ++++    +D+++           K H   + +PS K  K + KG            K PK+EV   D+ V  PS+++D++  +      R+ GDLS+         D DV+ K  K      +P +K P F   +     +V +D++ P+++    A+ S    +      D+++E P A +++Q     G +D+ L
Sbjct: 2726 GLKGHLPKLQMPSFKMPEVDLKGPQ--IDVKGPNVDL----KGPKAEVTAPDVKMSLSSMEVDVQAPRAKLDGARLEGDLSLADKGMTAKDS-KFKMPKFKMPSFGVSAPGKSIEASVDVSELKVEADGSFPSMQGDLKTTDIRIQPPSAQLEVQAGQVDVKLPEGHVPEGAGLKGHLPKVQMPSFKMPKVDLKGPQIDVKGPKLDLKGPKAEVTAPDVEVSLPSVEVDVEAPRAKLDGARLEGDLSL--------ADKDVTAKDSK----FKMPKFKMPSFGVSAPGKSIEVSVDVSAPKVE----AEVSLPSMQGDLKTTDISIEPPSAQLEVQA----GQVDLKL 3046          

HSP 10 Score: 52.7582 bits (125), Expect = 3.803e-6
Identity = 42/148 (28.38%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKG---ALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV-----DIHGNRAKGNV-DVTFNKPDLEIDITKP 510
              +P +K+P F G L   K    ++DV AP ++ D+     +G++   DL ++ P+ D++     +D+++      +  GL  +LP  ++P F    K PK    +D++GP+VDV     D+ G +A+    DV  + P +E D+  P
Sbjct: 4463 FKMPKFKMPSF-GMLSPGKSIEVSVDVSAPKMEADMSIPSMQGDLKTTDLRIQAPSADLEVQAGQVDLKLPEGHMPEVAGLKGHLPKVEMPSF----KMPK----VDLKGPQVDVKGPKLDLKGPKAEVMAPDVEVSLPSVETDVQAP 4601          

HSP 11 Score: 52.7582 bits (125), Expect = 4.008e-6
Identity = 57/245 (23.27%), Postives = 111/245 (45.31%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLD------------FNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNV---DVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPSMKGLKFEGKG------------KKPKSEV---DLGVKTPSIDIDIDGKKHR-----ISGDLSV 702
            + +P +K+PK +  LK P+  +D++ P +D+    K PK E+   D+ V  P+V++D   P       +DG + +  L             F +P +K+P F         E  +D+  P+V+ D+     +G++   D++   P  ++++    +D+++           K H   + +PS K  K + KG            K PK+EV   D+ +   S+++D+   + +     + GDLS+
Sbjct: 3889 VQMPSFKMPKVD--LKGPE--IDIKGPKLDL----KDPKVEVTAPDVEVSLPSVEVDVEAPG----AKLDGARLEGDLSLADKDMTAKDSKFKMPKFKMPSFGVSAPGKSMEASVDVTAPKVEADVSLPSMQGDLKATDLSVQPPSADLEVQAGQVDVKLPEGPVPEGASLKGHLPKVQMPSFKMPKVDLKGPQIDVKGPKLDLKGPKAEVTAPDVKMSLSSMEVDVQAPRAKLDGVQLEGDLSL 4121          

HSP 12 Score: 51.9878 bits (123), Expect = 7.655e-6
Identity = 39/158 (24.68%), Postives = 80/158 (50.63%), Query Frame = 1
Query:  103 INLPDWKLPKF--EGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV-----DIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKK 546
              +P +K+P F      K  + ++DV AP ++ D+     +G++   DL+++ P+ D++     +D+++      +  G   +LP  ++P F    K PK    +D++GP++DV     D+ G +A+         PD E+ +  P M++++  +K K
Sbjct:  833 FKMPKFKMPSFGVSAPGKSMEDSVDVSAPKVEADVSLSSMQGDLKATDLSIQPPSADLEVQAGQVDVKLPEGPVPEGAGPKVHLPKVEMPSF----KMPK----VDLKGPQIDVKGPKLDLKGPKAE------VTAPDGEVSL--PSMEVDVQAQKAK 974          

HSP 13 Score: 51.6026 bits (122), Expect = 9.863e-6
Identity = 59/245 (24.08%), Postives = 114/245 (46.53%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDI---------DIEV---DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNV---DVTFNKPDLEIDITKPDMDIEI-------DGKKKKHGINIGLPS-------MKGLKFEGKGKK-----PKSEV---DLGVKTPSIDIDIDGKK-----HRISGDLSV 702
            + +P +K+PK +  LK P+  +DV+ P +D+    K PK ++   D+ V  P+V++D   P           D+ V   D+  K  +    F +P +K+P F         E  +D+  P+V+ D   +  +G++   D++   P  ++++    +D+++           K H   + +PS       +KG + + KG K     PK+EV   D+ +   S+++D+   +      R+ GDLS+
Sbjct: 2404 LQMPSFKMPKVD--LKGPQ--IDVKGPKLDL----KGPKTDVMAPDVEVSQPSVEVDVEAPGAKLDGAWLEGDLSVADKDVTTKDSR----FKIPKFKMPSFGVSAPGKSIEASVDVSAPKVEADGSLSSMQGDLKATDLSIQPPSADLEVQAGQVDVKLPEGPVPEGAGLKGHLPKVQMPSFKMPEMDLKGPQLDVKGPKLDLKGPKAEVTAPDVEMSLSSMEVDVQAPRAKLDGARLEGDLSL 2636          
BLAST of SMED30001359 vs. TrEMBL
Match: A0A0K2VA86 (Neuroblast differentiationassociated protein AHNAKlike [Danio rerio] (Fragment) OS=Lepeophtheirus salmonis OX=72036 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.028e-15
Identity = 113/352 (32.10%), Postives = 172/352 (48.86%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNL--PDW----KLPKFEGKLKKPK-------GELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDID------GKKH--------RISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINL 1068
            G DINL   K P F+  LKKP   + +  P       GKK KG+I+++V +P++ ++  KPD++I+ D D K KK G D  L  PD+    K P F+ K+ KPK       G++D ++  P++++D          D  F KPD+++++ KP +DI+ D K KK G +I L            KKP  ++DL +K P  D+ +       GKK             D++V+KP+  +D D D+  KK    I++  PN+                  DIN  + DFD      K    +KK  +D++V+ P+  +D++ KK + DID          D D K KK GF INL
Sbjct: 1402 GFDINL---KKPDFDINLKKPDLEMKMATPKFGF---GKK-KGDIEVDVNSPDIGLNMKKPDLNIDADTDLKIKKTGFDIGLKKPDFDIKMKKPDFDMKMSKPKFGFGQKKGDIDGEVDAPDLNLDADLQIKNPGFDSNFEKPDIDLNMKKPGLDIDADLKMKKPGFDINL------------KKP--DIDLNLKKPDFDMKMSMPKFGFGKKKGDLDVDVKVPDVDINVEKPNFSVDADADLKMKKPDFDINLKKPNF------------------DINMKKPDFDMKMSMPKFGFGNKKDDLDIDVDTPE--VDLKMKKLQLDIDA---------DADFKGKKPGFDINL 1703          

HSP 2 Score: 73.9442 bits (180), Expect = 1.790e-10
Identity = 62/180 (34.44%), Postives = 98/180 (54.44%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIH------GKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNL--PD----WKLPKFEGKLKKP-------KGELDIDIRGPEVDVDIH--GNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 570
            G D +L   K P F+  LKKP   ++++ PD D+ +       G K KG++D++V  P VD+   KP++DI+ D D K KK G D N   PD     K P F+ K+  P       KG++DID+ GP+VD+++   G     + D+   KP  +I++ KPD+D+ +  KK    + + +P
Sbjct: 1825 GADTDLK-MKKPDFDINLKKPNFDINMKKPDFDMKMSMPIFGFGNK-KGDLDVDVDTPEVDLKMKKPELDIDADADFKGKKPGFDINFKKPDIDLNMKKPDFDMKMSMPKFGYGKKKGDVDIDVDGPDVDLNMKKPGLDIDADADLKLKKPGFDINLKKPDIDLNL--KKPDFDMKMSMP 2000          

HSP 3 Score: 72.7886 bits (177), Expect = 4.408e-10
Identity = 103/346 (29.77%), Postives = 157/346 (45.38%), Query Frame = 1
Query:  121 KLPKFEGKLKKPKGALDVEAPDIDVDI------HGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNL--PD----WKLPKFEGKLKKPK----------------GELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG--KKKKHGFGINL 1068
            K P F+  LKKP   L+++ PD D+ +      +G+K KG++D++V  P+VD++  KP +DI+ D D K KK G D NL  PD     K P F+ K+  PK                 ++DI++  P+  V         + D+   KPD +I++ KP+ DI +  KK    + + +P        G G K K ++D+ V TP +D+ +   +  I  D                  K KK G DIN                  + D+D+N  + DFD      K     KKG +D++V+ P             D+D+++  P +DID D   K KK GF INL
Sbjct: 1695 KKPGFDINLKKPDIDLNMKKPDFDMKMSMPKFGYGRK-KGDVDIDVDGPDVDLNMKKPGLDIDADTDLKMKKPGFDINLKKPDIDLNLKKPDFDMKMSMPKFGFGKKKGDLDVDVEVPDVDINVEKPDFSVG-------ADTDLKMKKPDFDINLKKPNFDINM--KKPDFDMKMSMPIF------GFGNK-KGDLDVDVDTPEVDLKMKKPELDIDADADF---------------KGKKPGFDINF----------------KKPDIDLNMKKPDFDMKMSMPKFGYGKKKGDVDIDVDGP-------------DVDLNMKKPGLDIDADADLKLKKPGFDINL 1979          

HSP 4 Score: 62.7734 bits (151), Expect = 7.649e-7
Identity = 84/238 (35.29%), Postives = 122/238 (51.26%), Query Frame = 1
Query:   94 GLDINL-PDWKL--PKFEGKLKKPKGALDVEAPDIDVDIH------GKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNL--PDW----KLPKFEGKLKKP-------KGELDIDIRGPEVDVDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKS--------EVDLGVKTPSIDIDIDGKKHRISGDLSVDKP 711
            GLDI+   D K+  P F+  LKKP   L+++ PD D+ +       GKK KG++D++V+ P+VDI+  KPD  +  D D K KK   D NL  P++    K P F+ K+  P       KG+LD+D+  PEVD+ +       + D  F   KP  +I+  KPD+D+ +  KK    + + +P     KF G GKK           +VDL +K P +DID D        DL + KP
Sbjct: 1752 GLDIDADTDLKMKKPGFDINLKKPDIDLNLKKPDFDMKMSMPKFGFGKK-KGDLDVDVEVPDVDINVEKPDFSVGADTDLKMKKPDFDINLKKPNFDINMKKPDFDMKMSMPIFGFGNKKGDLDVDVDTPEVDLKMKKPELDIDADADFKGKKPGFDINFKKPDIDLNM--KKPDFDMKMSMP-----KF-GYGKKKGDVDIDVDGPDVDLNMKKPGLDIDAD-------ADLKLKKP 1973          

HSP 5 Score: 59.6918 bits (143), Expect = 8.294e-6
Identity = 126/402 (31.34%), Postives = 180/402 (44.78%), Query Frame = 1
Query:   94 GLDINL--PDW----KLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI-------EVDIDGKKKKHGLDFNL--PD----WKLPKFEGKLKKPK----------------GELDIDIRGP--EVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHG-------INIGLPS----MKGLKFE------GKGKKP-------KSEVDLGVKTPSIDIDIDGKKH---RISGDLSVD-----------KPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK--GDIDVHLSIPEVDIDVDGKKKKHGFGINL 1068
            G DI L  PD+    K P F+ K+ KPK     +  DID ++       + DL +KNP  D +F KPDID+       ++D D K KK G D NL  PD     K P F+ K+  PK                 ++DI++  P   VD D      K + D+   KP+ +I++ KPD D+++   K   G       I++  P     MK L+ +       KGKKP       K ++DL +K P  D+ +   K    R  GD+ +D           KP  DID D D+  K KK G DINL                 + D+D+N  + DFD      K     KKG +DV+VEVPD  I+++        D D+ +  P+ DI++    KK  F IN+
Sbjct: 1471 GFDIGLKKPDFDIKMKKPDFDMKMSKPKFGFGQKKGDIDGEVDAPDLNLDADLQIKNPGFDSNFEKPDIDLNMKKPGLDIDADLKMKKPGFDINLKKPDIDLNLKKPDFDMKMSMPKFGFGKKKGDLDVDVKVPDVDINVEKPNFSVDADADLKMKKPDFDINLKKPNFDINMKKPDFDMKMSMPKFGFGNKKDDLDIDVDTPEVDLKMKKLQLDIDADADFKGKKPGFDINLKKPDIDLNMKKPDFDMKMSMPKFGYGRKKGDVDIDVDGPDVDLNMKKPGLDIDADTDL--KMKKPGFDINL----------------KKPDIDLNLKKPDFDMKMSMPKFGFGKKKGDLDVDVEVPDVDINVEKPDFSVGADTDLKMKKPDFDINL----KKPNFDINM 1850          
BLAST of SMED30001359 vs. TrEMBL
Match: A0A3B4URF8 (Uncharacterized protein OS=Seriola dumerili OX=41447 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.765e-14
Identity = 107/322 (33.23%), Postives = 160/322 (49.69%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDID---VDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLK---FEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHG-------IDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            D  LPK +G +K P+  +D+E P+ID   VD + K PK + D+NV  P ++ D   P+IDI   EVDI+G K      F +P  K+P F    K PK      + GP+VD+    N  K N+DV    PD  +DI  P++DIE    K K G  + +P++KG K   F+ K K PK E D+ V  P I+ DI   K  I G D+ ++ P     +           G       ID++LP  +    +          +LDI  PE+DF+  + K K    +        + +PD   +++G K KGD+DV  S+P+++ D+
Sbjct:  258 DVSLPKIKGDIKAPE--VDIEGPEIDIDDVDFNLKGPKLKGDMNVSAPKLEGDIKTPEIDIKGPEVDIEGTKG----GFEMPKIKMPSF--GFKGPK------VEGPDVDI----NLPKANIDV--KAPD--VDIKAPEIDIEGPDAKIK-GPKMKMPTIKGPKMPDFDIKLKGPKVEGDVDVSLPKIEGDIKAPKVDIEGPDVDIEGPKGGFKMPKFKMPSFGVKGPNVEGPDIDVSLPKAEIDVKAP---------ELDIKGPEVDFESPSGKIKGPKFNMPTLSGPKLSMPDVDFNLKGPKLKGDVDV--SVPKIEGDI 545          

HSP 2 Score: 79.7221 bits (195), Expect = 2.515e-12
Identity = 110/383 (28.72%), Postives = 169/383 (44.13%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKL--PKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI-----DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            D+NL K NIDV   + D+              ++I  PD KL  PKF  KL    G      PD D+++ G K KG++D+++  P ++ D   P +DIE    DI+G    H   F +P +K+P F GK  K          PKG++D     +DIRGPE+D++    + KG     FN P +    I+ PD+D  + G K K  +++ +P M+G                 +KTP IDI     DI+G K         + P   +        K +   +DINLP                + ++D+  PEID  G                +++VE PDA   ++G K K       ++P+ DI++ G K K    +++P
Sbjct: 2196 DINLPKANIDVKAPEIDMKG----------PNVEIECPDAKLKGPKF--KLPSISGPT---MPDWDINLKGPKMKGDVDMSL--PKIEGDIKAPKVDIEGPDFDIEG----HKGGFKMPKFKMPSFGGKGPKLEGPEIDVSLPKGDIDLKAPELDIRGPEIDIESPSGKIKGP---KFNMPTISGPKISMPDVDFNLKGPKLKGDVDVSIPKMEG----------------DIKTPEIDIKGPQVDIEGPKG------GFEMPKIKMPSFGFKGPKVEGPDVDINLP----------------RANIDVKAPEIDMKGP---------------EIDVECPDAK--VKGPKFKLPSISGPTMPDWDINLKGPKIKGDVDVSVP 2499          

HSP 3 Score: 75.8702 bits (185), Expect = 4.135e-11
Identity = 102/371 (27.49%), Postives = 166/371 (44.74%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDV----EAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKF-------EGK---LKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI-----DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            D+NL K NIDV                     +DI  P+  +   + K+K PK  +      + PD D+ + G K +G++D+++  P ++ D   P +DIE   VDI+G K      F +P +K+P F       EG    +  PK E+D+     DI+GPEVD +    + KG     FN P L    ++ PD+D  + G K K  +++ +P ++G                 +KTP IDI     DI+G K         + P   +        K +   +DINLP       +          D+DI+ PE+D +G+  K K    +        + +PD   +++G K KGD+DV  ++P+++ D+
Sbjct:  353 DINLPKANIDVKAPD-----------------VDIKAPEIDIEGPDAKIKGPKMKMPTIKGPKMPDFDIKLKGPKVEGDVDVSL--PKIEGDIKAPKVDIEGPDVDIEGPKG----GFKMPKFKMPSFGVKGPNVEGPDIDVSLPKAEIDVKAPELDIKGPEVDFESPSGKIKGP---KFNMPTLSGPKLSMPDVDFNLKGPKLKGDVDVSVPKIEG----------------DIKTPKIDIKGPEVDIEGPKG------GFEMPKIKMPSFGMKGPKVEGPDVDINLPKGNIDMKAP---------DVDISAPEVDIEGSNLKLKGPKFNMPTISGPKISMPDVDFNLKGPKLKGDVDV--TVPKIEGDI 664          

HSP 4 Score: 71.633 bits (174), Expect = 1.014e-9
Identity = 114/407 (28.01%), Postives = 174/407 (42.75%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDV----EAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGELD-----IDIRGPE-----------------------------VDVDIHGNRAKGNVDVTFNKPD-----LEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVD-------KPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            D+NL K NIDV   +                 +D+  PD ++   + KLK PK  L        PD D+ + G K KG++D+++  P ++ D   P +DIE    DI+G K      F +P +K+P F GK  K          PK ++D     +DI+GPE                             VD ++ G + KG+VDV+  K +      EIDI  P +DIE     K    +I  P+M       KG K K +VD+ V  P I+ DI   K  I G D  ++        P   +        K +   ID++LP       +          +LDI  PE++FD  + K K    +        + +PD   +++G K KGD+DV  S+P+++ D+
Sbjct: 1782 DINLPKANIDVKAPE-----------------IDMKGPDVEVECPDAKLKGPKFKLPSISGPTMPDWDISLKGPKMKGDVDMSL--PKIEGDIKAPKVDIEGPDFDIEGPKG----GFKMPKFKMPSFGGKGPKLEGPEVDVSLPKADIDLKAPELDIKGPEVEFESPSGKIKGPKFNMPSISGPKISMPDVDFNLKGPKFKGDVDVSVPKIEGDIKTPEIDIKGPQVDIESPKGPKFKLPSISGPTMPDWDINLKGPKIKGDVDVSV--PKIEGDIKAPKVDIEGPDFEIEGHKGGFKMPKFKMPSFGGKGPKLEGPEIDVSLPKADSDLKAP---------ELDIKGPEVEFDSPSGKIKGPKFNMPTISGPKISMPDVDFNLKGPKLKGDVDV--SVPKIEGDI 2152          

HSP 5 Score: 70.4774 bits (171), Expect = 2.359e-9
Identity = 115/395 (29.11%), Postives = 172/395 (43.54%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKL--PKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKF-------EGK---LKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI-----DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEID-----FXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLS-------IPEVDI---DVDGKKKKHGFGI 1062
            D+NL K NIDV   +                 +DI  PD K+  PKF  KL    G      PD D+ + G K KG++D++V  P ++ D   P +DIE   +D++G    H   F +P +K+P F       EG    +  P+ ++D+     DI+GPE+D++    + KG     FN P +    I+ PD+D  + G K K  ++I +P ++G                 +KTP IDI     DI+G K         + P   +        K +   IDINLP                + D+D+  PE+D     F+     SK K    K       ++PD  I+++G K KGD+D+ L         P+VDI   D D +  K GF I
Sbjct: 1179 DINLPKANIDVKAPE-----------------VDIEGPDAKIKGPKF--KLPSISGP---SMPDWDISLKGPKIKGDVDVSV--PKIEGDIKAPKVDIEGPDIDLEG----HKGGFKMPKFKMPSFGVKGPNVEGPDIDVSLPRADIDVKAPELDIKGPEIDIESPSGKIKGP---KFNMPTISGPKISMPDVDFNLKGPKLKGDMDISIPKIEG----------------DIKTPEIDIKGPQVDIEGPKG------GFEMPKIKMPSFGFRGPKVEGPDIDINLP----------------KADIDLKGPEVDIKGPEFNVEGPDSKLKGPKIKLPSISGPKLPDWDINLKGPKMKGDVDMSLPKIEGDIKAPKVDIEGPDFDIEGPKGGFKI 1504          

HSP 6 Score: 68.9366 bits (167), Expect = 7.566e-9
Identity = 110/368 (29.89%), Postives = 167/368 (45.38%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKL--PKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKF----------EGKLKKPKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            D+NL + NIDV   + D+              +D+  PD K+  PKF  KL    G      PD D+++ G K KG++D++V  P ++ D   P +DIE   VD+DG K      F +P +K+P F          E  +  PK E+D     +DI+GPEV+ D    + KG     FN P +    I+ PD+D  + G K K   ++ +P     K EG+ K P  E+D  +K P   +DI+G K         + P   +        K +   +DINLP                  D+DI  PE+D +G   K K              ++PD  I+++G K KGD+D  +S P+++ D+   K
Sbjct: 2432 DINLPRANIDVKAPEIDMKGPE----------IDVECPDAKVKGPKF--KLPSISGPT---MPDWDINLKGPKIKGDVDVSV--PKIEGDIKAPKVDIEGPDVDLDGNKG----GFKMPKFKMPSFGVKGPNLEGPEVDVSLPKAEIDMKAPELDIKGPEVEFDSPSGKIKGP---KFNMPSISGPKISMPDVDFNLKGPKLKGDYDVSVP-----KIEGEMKAP--EID--IKGPQ--VDIEGPKG------GFEMPKIKMPSFGIKGPKFEGPDVDINLPKGNIDVKGP---------DVDIKGPEVDVEGPDAKIKGPKIKLPSI--SGPKLPDWDINLKGPKIKGDVD--MSAPKIEGDIKAPK 2745          

HSP 7 Score: 68.9366 bits (167), Expect = 9.549e-9
Identity = 101/333 (30.33%), Postives = 156/333 (46.85%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEG-----KGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHG-------IDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            LDI  P+ +     GK+K PK  +       +  PD+D ++ G K KG+ D++V  P ++ +   P+IDI   +VDI+G K      F +P  K+P F   +K PK E      GP+VD+    N  KGN+DV    PD  +DI  P++D+E    K K G  I LPS+ G K        KG K K +VD+    P I+ DI   K    G D+ ++ P     +           G       ID++LP       +          + DI  PE++F+  + K K    +        + +PD   +++G K KGD+DV  S+P+++ D+
Sbjct: 2564 LDIKGPEVEFDSPSGKIKGPKFNMPSISGPKISMPDVDFNLKGPKLKGDYDVSV--PKIEGEMKAPEIDIKGPQVDIEGPKG----GFEMPKIKMPSF--GIKGPKFE------GPDVDI----NLPKGNIDV--KGPD--VDIKGPEVDVEGPDAKIK-GPKIKLPSISGPKLPDWDINLKGPKIKGDVDM--SAPKIEGDIKAPKLDFEGPDVDIEGPKGGFKMPKFKMPSFGVKGPNVEGPEIDVSLPKGDIDVKAP---------EFDIKGPEVEFESPSGKIKGPKFNMPTISGPKMSMPDVDFNLKGPKLKGDVDV--SVPKIEGDI 2860          

HSP 8 Score: 68.1662 bits (165), Expect = 1.604e-8
Identity = 103/363 (28.37%), Postives = 151/363 (41.60%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEID-----LNVKNPNVDID----------FHKPDI------DIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL---DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI-----DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDAS--------------------IDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
              +P  K+P F    K PK    VE PDID+++    PK  ID     +++K PNV+I+          F  P I      D ++++ G K K  +D +LP     K EG +K PK ++   D DI GPEV+ D    + KG     FN P L    I+ PD+D  + G K K  +++ +P ++G                 +KTP IDI     DI+G K         + P   +        K +   IDINLP                + ++D+  PEID  G                DV VE PDA                     I ++G K KGD+D  +S+P+++ D+   K
Sbjct: 1570 FEMPKIKMPSF--GFKGPK----VEGPDIDINL----PKANIDVKAPEIDMKGPNVEIECPDAKLKGPKFKLPSISGPTMPDWDINLKGPKMKGDVDMSLP-----KIEGDIKAPKVDIEGPDFDIEGPEVEFDSPSGKIKGP---KFNMPTLSGPKISMPDVDFNLKGPKLKGDVDVSVPKIEG----------------DIKTPEIDIKGPEVDIEGPKG------GFEMPKIKMPSFGFKGPKVEGPDIDINLP----------------KANIDVKAPEIDMKGP---------------DVEVECPDAKLKGPKFKLPSISGPTMPDWDISLKGPKMKGDVD--MSLPKIEGDIKAPK 1859          

HSP 9 Score: 65.0846 bits (157), Expect = 1.306e-7
Identity = 103/366 (28.14%), Postives = 166/366 (45.36%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDV----EAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKF----------EGKLKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            D+NL K NIDV                     +DI  P+  +   + K+K PK  L      + PD D+++ G K KG++D++   P ++ D   P +D E   VDI+G K      F +P +K+P F          E  +  PKG++D+     DI+GPEV+ +    + KG     FN P +    ++ PD+D  + G K K  +++ +P     K EG  K P    D+ +K P++DI+  G K         + P   +        K ++  IDINLP       +          ++D+  PEID +G   K K              ++PD  I+++G K KGD+DV  S+P+++ D+
Sbjct: 2668 DINLPKGNIDVKGPD-----------------VDIKGPEVDVEGPDAKIKGPKIKLPSISGPKLPDWDINLKGPKIKGDVDMSA--PKIEGDIKAPKLDFEGPDVDIEGPKG----GFKMPKFKMPSFGVKGPNVEGPEIDVSLPKGDIDVKAPEFDIKGPEVEFESPSGKIKGP---KFNMPTISGPKMSMPDVDFNLKGPKLKGDVDVSVP-----KIEGDIKVP----DVDIKGPAVDIE--GPKG------GFEMPKIKMPSLNIKGPKVERPDIDINLPKTNIDVKAP---------EIDMKAPEIDIEGPGAKIKGPKMKMPTI--KGPKMPDFDINLKGPKLKGDVDV--SVPKIEGDI 2977          

HSP 10 Score: 65.0846 bits (157), Expect = 1.365e-7
Identity = 95/329 (28.88%), Postives = 145/329 (44.07%), Query Frame = 1
Query:  112 PDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKF----------EGKLKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            P +KLP   G             PD D+ + G K KG+ D++V  P ++ D   P +DIE    DI+G    H   F +P +K+P F          E  +  PK ++DI     DI+GPEV+ +    + KG     FN P +    I+ PD+D  + G K K  +++ +P     K EG  K P  E+DL  K P   +DI+G K         + P   +        K +   +DINLP                + ++D+  PE+D +G   K K               +PD  I ++G K KGD+DV  S+P+++ D+   K
Sbjct:  977 PKFKLPSISGPT----------MPDWDISLKGPKIKGDADVSV--PKIEGDIKAPKVDIEGPDFDIEG----HKGGFKMPKFKMPSFGVKGPNVEGPEVDVSLPKADIDIEAPELDIKGPEVEFERPSGKIKG---AKFNMPSISGPKISMPDVDFNLKGPKLKGDMDVSIP-----KIEGDIKTP--EIDL--KGPQ--VDIEGPKG------GFEMPKIKMPSFGFKGPKVEGPDVDINLP----------------KANIDVKAPEVDIEGPDAKIKGPKFKLPSI--SGPSMPDWDISLKGPKIKGDVDV--SVPKIEGDIKAPK 1249          

HSP 11 Score: 64.3142 bits (155), Expect = 2.392e-7
Identity = 97/384 (25.26%), Postives = 162/384 (42.19%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKG---------------LKFEGKGKKPKSEVDLG----VKTPSIDIDIDGKKHR--ISGDLSVDKPXXXXXXXXXVSNKKKK-------------HGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            LDI  P+       GK+K PK  +       +  PD+D ++ G K KG++D++V  P ++ D   P IDI   EVDI+G K      F +P  K+P F  K  K          PKG +D     +DI  PEVD++    + KG     FN P +    I+ PD+D  + G K K  +++ +P ++G               L+ +G+   P+ ++       +  P++DI++ G K +  + GD+ + K + +          K K               +D+NLP                +  ++I TP++D +G                DV +E PD  +     K        +S+P+VD ++ G K K    + +P
Sbjct:  485 LDIKGPEVDFESPSGKIKGPKFNMPTLSGPKLSMPDVDFNLKGPKLKGDVDVSV--PKIEGDIKTPKIDIKGPEVDIEGPKG----GFEMPKIKMPSFGMKGPKVEGPDVDINLPKGNIDMKAPDVDISAPEVDIEGSNLKLKGP---KFNMPTISGPKISMPDVDFNLKGPKLKGDVDVTVPKIEGDIKTPEVKLKGPNVDLESQGEFSGPRIKLPTTSGPKMSLPNVDINLKGPKLKGDLKGDVQLPKAELEGLTGPKTKGSKFKMPKFGFKGPKAEMQEVDLNLP----------------KAGINIKTPDVDIEGP---------------DVKIESPDGKVKGAKLKMPSISGPKISMPDVDFNLKGPKIKGDVDVTVP 828          

HSP 12 Score: 63.1586 bits (152), Expect = 6.135e-7
Identity = 96/346 (27.75%), Postives = 155/346 (44.80%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDL-------------NVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDI----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE---IDGKKKKHGINIGLPSMKGLKFEG-KGKKPKSEVDLG-----VKTPSID-----IDIDGKKHRISGD---LSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLD-----INTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            D   PK EG +K PK  LD E PD+D++     PKG   +             NV+ P +D+   K DID+        K    D   P+ +     GK+K PK  +       +  P+VD ++ G + KG+VDV+   P +E DI  PD+DI+   +D +  K G  +    M  L  +G K ++P  +++L      VK P ID     IDI+G   +I G    +   K     D DI++   K K  +D+++P  +    +        +VD++     I  P+I                     +N++ PD  ++++G K KG+ID   S P+++ D+ G
Sbjct: 2731 DMSAPKIEGDIKAPK--LDFEGPDVDIE----GPKGGFKMPKFKMPSFGVKGPNVEGPEIDVSLPKGDIDV--------KAPEFDIKGPEVEFESPSGKIKGPKFNMPTISGPKMSMPDVDFNLKGPKLKGDVDVSV--PKIEGDIKVPDVDIKGPAVDIEGPKGGFEMPKIKMPSLNIKGPKVERPDIDINLPKTNIDVKAPEIDMKAPEIDIEGPGAKIKGPKMKMPTIKGPKMPDFDINLKGPKLKGDVDVSVPKIEGDIKTPTINIKGPEVDVEGPKGGIEMPKIKMP-----------------SLNIKAPDLDVNLKGPKIKGEIDA--SFPKMEGDMKG 3041          

HSP 13 Score: 60.8474 bits (146), Expect = 3.708e-6
Identity = 89/341 (26.10%), Postives = 149/341 (43.70%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD-------IDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            LDI  P+  +    GK+K PK  +       +  PD+D ++ G K KG++D+++  P ++ D   P+IDI   +VDI+G K      F +P  K+P F    K PK      + GP+VD+    N  + N+DV       EID+  P++D+E    K K G    LPS+ G            + D+ +K P I  D+D    +I GD+   K D +        NK         +P++     + +      +VD+ +   EID                   +++++ P+   D    K KG            +S+P+VD ++ G K K  + +++P
Sbjct: 2328 LDIRGPEIDIESPSGKIKGPKFNMPTISGPKISMPDVDFNLKGPKLKGDVDVSI--PKMEGDIKTPEIDIKGPQVDIEGPKG----GFEMPKIKMPSF--GFKGPK------VEGPDVDI----NLPRANIDVKAP----EIDMKGPEIDVECPDAKVK-GPKFKLPSISGPTM--------PDWDINLKGPKIKGDVDVSVPKIEGDIKAPKVDIEGPDVDLDGNKGGFKMPKFKMPSFGVKGPNLEGP----EVDVSLPKAEIDMKAP---------------ELDIKGPEVEFDSPSGKIKGPKFNMPSISGPKISMPDVDFNLKGPKLKGDYDVSVP 2618          

HSP 14 Score: 60.8474 bits (146), Expect = 3.741e-6
Identity = 109/396 (27.53%), Postives = 159/396 (40.15%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVDIHG---KKPK------GEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKK--------KKHGLDFNLP-------------------------DWKLPKFEGKLKKPKGELDIDIRGPEVDVD-----------------IHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGV-------KTPSIDI---DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            D  +PK EG +K PK  +D+E PD D++ H    K PK      G    NV+ P VD+   K DIDIE   +DI G +        K  G  FN+P                         D  +PK EG +K P    +ID++GP+VD++                   G + +G  DV  N P   ID+  P++DIE     I G K K   +I  PSM       KG K K +VD+ V       K P +DI   DID + H+    +   K  +      +V        ID++LP                + D+D+  PE+D  G                ++++E P   I              +S+P+VD ++ G K K    I++P
Sbjct: 1006 DVSVPKIEGDIKAPK--VDIEGPDFDIEGHKGGFKMPKFKMPSFGVKGPNVEGPEVDVSLPKADIDIEAPELDIKGPEVEFERPSGKIKGAKFNMPSISGPKISMPDVDFNLKGPKLKGDMDVSIPKIEGDIKTP----EIDLKGPQVDIEGPKGGFEMPKIKMPSFGFKGPKVEGP-DVDINLPKANIDVKAPEVDIEGPDAKIKGPKFKL-PSISGPSMPDWDISLKGPKIKGDVDVSVPKIEGDIKAPKVDIEGPDIDLEGHKGGFKMPKFKMPSFGVKGPNVEGPD----IDVSLP----------------RADIDVKAPELDIKGP---------------EIDIESPSGKIKGPKFNMPTISGPKISMPDVDFNLKGPKLKGDMDISIP 1358          

HSP 15 Score: 59.6918 bits (143), Expect = 7.009e-6
Identity = 110/397 (27.71%), Postives = 165/397 (41.56%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL-DVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNL--------PDW---------------KLPKFEGKLKKPKGELDIDIRGPEVDVDIH-----------------GNRAKG-NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLK-------FEGKGKKPKSEVDLGV-------KTPSIDI-----DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            LDI  P+ +     GK+K PK  +  +  P I   DVD + K PK + D++V  P ++ D   P+IDI   +VDI+  K   G  F L        PDW                +PK EG +K PK    +DI GP+ +++ H                 G + +G  +DV+  K D      E+DI  P+++ +    K K G    +P++ G K       F  KG K K +VD+ V       KTP IDI     DI+G K         + P   +        K +   +DINLP                + ++D+  PEID  G                +V +E PDA   ++G K K       ++P+ DI++ G K K    ++LP
Sbjct: 1914 LDIKGPEVEFESPSGKIKGPKFNMPSISGPKISMPDVDFNLKGPKFKGDVDVSVPKIEGDIKTPEIDIKGPQVDIESPK---GPKFKLPSISGPTMPDWDINLKGPKIKGDVDVSVPKIEGDIKAPK----VDIEGPDFEIEGHKGGFKMPKFKMPSFGGKGPKLEGPEIDVSLPKADSDLKAPELDIKGPEVEFDSPSGKIK-GPKFNMPTISGPKISMPDVDFNLKGPKLKGDVDVSVPKIEGDIKTPEIDIKSPELDIEGPKG------GFEMPKIKMPSFGFRGPKVEGPDVDINLP----------------KANIDVKAPEIDMKGP---------------NVEIECPDAK--LKGPKFKLPSISGPTMPDWDINLKGPKMKGDVDMSLP 2263          
BLAST of SMED30001359 vs. TrEMBL
Match: A0A3B3DV46 (Uncharacterized protein OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.534e-14
Identity = 102/350 (29.14%), Postives = 155/350 (44.29%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNK--------------PDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSI--------------PEVDIDV 1029
            +D+  P +++PK +      KG   +E PD+D+ + G K  G  DL+VK P +  D   PD+DI   E+DI+G K      F  P + +PK  G          +++  P+VD ++ G + KG++D +  K              P+++ID+TKP  ++    K K   +NI  P M+    + K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DIN P++D  G                 +NV +PD   +++G K KGDID  L                PEVDIDV
Sbjct:  823 IDVTKPGFEMPKVKMPSLNIKGP-KMEKPDVDIKLKGPKLGG--DLDVKAPKIKGDITAPDVDIGGAELDIEGPKGGPDAKFKGPKFNMPKMPG----------LNVSMPDVDFNLKGPKLKGDIDASLPKIEGEVKTPDLDVKGPEVDIDVTKPGFEMP---KVKMPSLNIKGPKMEKPDVDIKLKGPKLGGDLDVKAPKIKGDITAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDINAPDVDIKG-----------------LNVSMPDVDFNLKGPKLKGDIDASLPKIEGEVKTPDLDVKGPEVDIDV 1130          

HSP 2 Score: 76.6406 bits (187), Expect = 2.242e-11
Identity = 99/345 (28.70%), Postives = 149/345 (43.19%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNK--------------PDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSI--------------PEVDIDV 1029
              +P +K+P F  K  K      +E PD+DV++         D+ VK P+VDI  + PD+DI        K     F  P + +PK  G          +++  P+VD ++ G + KG++D +  K              P+++ID+TKP  ++    K K   +NI  P M+    + K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DIN P++D  G   K K    +      +NV +PD   +++G K KGDID  L                PEVDIDV
Sbjct:  361 FKMPKFKMPTFGSKGHK------LEGPDVDVNLP------STDIEVKAPDVDI--NAPDVDI--------KGPDAKFKGPKFNMPKMPG----------LNVSMPDVDFNLKGPKLKGDIDASLPKIEGEVKTPDLDVKGPEVDIDVTKPGFEMP---KVKMPSLNIKGPKMEKPDVDIKLKGPKLGGDLDVKAPKIKGDITAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDINAPDVDIKGPDAKFKGPKFNMPKMPGLNVSMPDVDFNLKGPKLKGDIDASLPKIEGEVKTPDLDVKGPEVDIDV 661          

HSP 3 Score: 75.8702 bits (185), Expect = 4.839e-11
Identity = 101/361 (27.98%), Postives = 156/361 (43.21%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGE--------------------IDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVD-------------------KPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHL 1002
            L+I  P  + P  + KLK PK  G LDV+AP I       DVDI G +     PKG                     +D++V  P+ DI+   PD+DI   +VDI G   K    F  P + +PK  G          +++  P+VD ++ G + KG++D +   P +E ++  PD+D+   E+D    K G  +    M  L  +G  K+ KS+VD+ +K P +  D+D K  +I G++                       P   +      S++ +K    +NLP+                 D+DI  P+ID  G   K K    +      +NV +PD   +++G K KGDID  L
Sbjct: 1331 LNIKGPKMEKPDVDIKLKGPKLGGDLDVKAPKIKGDITAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGPTLEGLDVDVNLPSTDIEVKAPDVDINAPDVDIKGPDAK----FKGPKFNMPKMAG----------LNVSMPDVDFNLKGPKLKGDIDASL--PKIEGEVKTPDLDVKGPEVDIDVTKPGFEMPKVKMPSLNIKGS-KREKSDVDIKLKGPKLGGDLDVKAPKIKGEVKTTDLKSGGAEFDIEGPKRGFKMPKFKMPSFGSKSHRLEKSTTGVNLPSTDIEVK---------SPDVDITPPDIDIKGPDAKFKGPKFNMPKMSGLNVSMPDVDFNLKGPKLKGDIDTTL 1665          

HSP 4 Score: 75.485 bits (184), Expect = 5.850e-11
Identity = 110/394 (27.92%), Postives = 164/394 (41.62%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG----------------------ELDIDIRGPE----------------------VDVDIHGNRAKGNVDVTFNK--------------PDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSI--------------PEVDIDV 1029
            +D+  P +++PK +      KG   +E PD+D+ + G K  G  DL+VK P +  D   PD+DI   E+DI+G K      F +P +K+P F  K  K +G                        D+DI+GP+                      VD ++ G + KG++D +  K              P+++ID+TKP  ++    K K   +NI  P M+    + K K PK   DL VK P I       D+DI G +  I G     K P   +          +   +D+NLP+      +          D+DIN P++D  G   K K    +      +NV +PD   +++G K KGDID  L                PEVDIDV
Sbjct: 1128 IDVTKPGFEMPKVKMPSLNIKGP-KMEKPDVDIKLKGPKLGG--DLDVKAPKIKGDITAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDINAPDVDIKGPDAKFKGPKFNMPKMPGLNVSMPDVDFNLKGPKLKGDIDASLPKIEGEVKTPDLDVKGPEVDIDVTKPGFEMP---KVKMPSLNIKGPKMEKPDVDIKLKGPKLGGDLDVKAPKIKGDITAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGPTLEGLDVDVNLPSTDIEVKAP---------DVDINAPDVDIKGPDAKFKGPKFNMPKMAGLNVSMPDVDFNLKGPKLKGDIDASLPKIEGEVKTPDLDVKGPEVDIDV 1502          

HSP 5 Score: 66.6254 bits (161), Expect = 3.815e-8
Identity = 103/344 (29.94%), Postives = 165/344 (47.97%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSE-VDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLP----NWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPD--------ASIDIQG-KKHKGDIDVHLSIPEVDIDVDGKKKK 1047
            +DIN PD  +   + K K PK        L+V  PD+D ++ G K KG+ID ++  P ++ +   PD+D+   EVDID  K      F +P  K+P     +K PK      +  P+VD+ + G +  G++DV    P ++ DIT PD+DI   E+D +  K G    +P  K   F  KG  P  E +D+ V  PS DI++      I+  D+ +  PDA         N  K  G+++++P    N K PK       S  +++ ++ TP++D  G               +D++V  P          S++I+G K+ K D+D+ L  P++  D+D K  K
Sbjct: 1240 VDINAPDVDIKGPDAKFKGPKFNMPKMPGLNVSMPDVDFNLKGPKLKGDIDASL--PKIEGEVKTPDLDVKGPEVDIDVTKP----GFEMPKVKMPSLN--IKGPK------MEKPDVDIKLKGPKLGGDLDV--KAPKIKGDITAPDVDIGGAELDIEGPKGGFK--MPKFKMPTFGSKG--PTLEGLDVDVNLPSTDIEVKAPDVDINAPDVDIKGPDAKFKGPKF--NMPKMAGLNVSMPDVDFNLKGPKLKGDIDASLPKIEGEVKTPDLDVKGPE-------------VDIDVTKPGFEMPKVKMPSLNIKGSKREKSDVDIKLKGPKLGGDLDVKAPK 1548          

HSP 6 Score: 64.6994 bits (156), Expect = 1.754e-7
Identity = 115/388 (29.64%), Postives = 171/388 (44.07%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEV-----DVDIHGNRAK----------------GNVDVTFN-------KPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVS--NKKKKHGIDINLPNWXXXXXX--------XXXXXXXGQV---DLDINTPE--IDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVH-------LSIPEVDI---DVDGKKKKHGF 1056
            +D+  P +++PK    +K P  +L+++ P +   DVDI  K PK   DL+VK P +  D   PD+DI   E+DI+G K      F +P +K+P F  K  K +G          DI+++ P+V     DVDI G  AK                   DV FN        P+++ID+TKP  ++    K K   +NI  P M+    + K K PK   DL VK P I  DI      I G +L ++ P    D        N  K  G+++++P+  F                K +G+V   DLD+  PE  ID      +               +E PD  I ++G K  GD+DV        ++ P+VDI   ++D +  K GF
Sbjct:  659 IDVTKPGFEMPK----VKMP--SLNIKGPKMEKPDVDIKLKGPKLGGDLDVKAPKIKGDITAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDINAPDVDIKGPDAKFKGPKFNMPKMPGLNVSMPDVDFNLKDLDVKGPEVDIDVTKPGFEMP---KVKMPSLNIKGPKMEKPDVDIKLKGPKLGGDLDVKAPKIKGDITAPDVDIGGAELDIEGPKGGPDAKFKGPKFNMPKMPGLNVSMPDVDFNLKGPKLKGDIDASLPKIEGEVKTPDLDVKGPEVDIDVTKPGFEMPKVKMPSLNIKGPKMEKPDVDIKLKGPKLGGDLDVKAPKIKGDITAPDVDIGGAELDIEGPKGGF 1033          

HSP 7 Score: 62.7734 bits (151), Expect = 6.842e-7
Identity = 99/342 (28.95%), Postives = 146/342 (42.69%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEID--------------LNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVH-------LSIPEVDI 1023
            +DIN PD  +   + K K PK        L+V  PD+D ++ G K KG+ID              L+VK P VDID  KP                  F +P  K+P     +K PK      +  P+VD+ + G +  G++DV    P ++ DIT PD+DI   E+D +  K G    +P  K   F  KG K +   D+ V  PS DI++      I+  D+ +  PDA         N  K  G+++++P+  F              DLD+  PE  ID      +               +E PD  I ++G K  GD+DV        ++ P+VDI
Sbjct:  585 VDINAPDVDIKGPDAKFKGPKFNMPKMPGLNVSMPDVDFNLKGPKLKGDIDASLPKIEGEVKTPDLDVKGPEVDIDVTKP-----------------GFEMPKVKMPSLN--IKGPK------MEKPDVDIKLKGPKLGGDLDV--KAPKIKGDITAPDVDIGGAELDIEGPKGGFK--MPKFKMPTFGSKGHKLEGP-DVDVNLPSTDIEVKAPDVDINAPDVDIKGPDAKFKGPKF--NMPKMPGLNVSMPDVDFNLK-----------DLDVKGPEVDIDVTKPGFEMPKVKMPSLNIKGPKMEKPDVDIKLKGPKLGGDLDVKAPKIKGDITAPDVDI 883          
BLAST of SMED30001359 vs. TrEMBL
Match: H2LD51 (AHNAK nucleoprotein OS=Oryzias latipes OX=8090 GN=AHNAK PE=4 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 5.674e-14
Identity = 104/339 (30.68%), Postives = 160/339 (47.20%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLD--FNLPDWKLPKFEGKLKKPKG---------------ELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K    LD  F +P +K+P F  K  K +G                 D+DI  P+V ++   ++ KG     FN P +  ++++ PD+D  + G K K  IN  LP     K EG  K P    DL +K P  D++IDG K  I G     K P   +       +K +   +D+NLP+      +          D+DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct:  604 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKVGGDLDGGFKMPKFKMPTFGSKSHKLEGPDVDVNLPSKNIEVKTPDMDIALPDVGIEGPDSKFKGP---KFNMPKMPGMNVSMPDVDFNLKGPKLKGDINASLP-----KIEGDIKAP----DLDIKGP--DVNIDGTKLDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 915          

HSP 2 Score: 82.4185 bits (202), Expect = 2.632e-13
Identity = 102/331 (30.82%), Postives = 156/331 (47.13%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDL--SVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI+V +     K      +P +K+P F  K  K +G          DID++ P+V     DVDI G+ AK      FN P +  ++++ PD+D  + G K K  I+  LP     K EG  K P    DL +K P  D++IDG K  + GDL      P   +      S+K +   +D+NLP+      +          D+DI  P++  +G   K K    +      +NV +PD   +++G K KGDI+  L   E DI
Sbjct:  484 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVKMPSLNIKGPKMEKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP-----KIEGDMKTP----DLDIKGP--DVNIDGTK--VGGDLDGGFKMPKFKMPTFGSKSHKLEGPDVDVNLPSKNIEVKTP---------DMDIALPDVGIEGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKLKGDINASLPKIEGDI 789          

HSP 3 Score: 81.6481 bits (200), Expect = 5.712e-13
Identity = 101/338 (29.88%), Postives = 161/338 (47.63%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFN----LPDWKLPKFEGKLKKPKG--------ELDIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG   K G +      +P +K+P F  K  K +G          DID++ P+V     DVDI G+ AK      FN P +  ++++ PD+D  + G K K  I+  LP     K EG  K P  ++D+ VK PS++         I G      P   +       +K +   +D+NLP+                 D+DI  P++D  G+  K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct:  359 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDG--TKAGFEMPKVKIMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP-----KIEGDMKTP--DLDIKVKMPSLN---------IKGPKMEKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVP---------DVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 664          

HSP 4 Score: 73.1738 bits (178), Expect = 3.114e-10
Identity = 101/369 (27.37%), Postives = 157/369 (42.55%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEID--------------LNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV-----DIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD-------IDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID              L++K P+++ D   PD+DI   E+DI+G K      F +P +K+P F  K  K +G          DI+++ P+VD+     DI G  AK      FN P +  ++++ PD+D  + G K K  I+  LP     K EG  K P    DL +K P  D++IDG K           P   +       +K +   +D+NLP+                 D+D+  P                      DV++  PD  I     K KG          +++S+P+VD ++ G K K     +LP
Sbjct:  224 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKGPDIEGDIKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP-----KIEGDMKTP----DLDIKGP--DVNIDGTKAGFEMPKVKIMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIDVKVP----------------------DVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 538          

HSP 5 Score: 63.929 bits (154), Expect = 3.354e-7
Identity = 95/348 (27.30%), Postives = 150/348 (43.10%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV-----DIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
              +P  K+P     +K PK    +E P+ D+ + G K  G  DL+VK P ++ D   PD+DI   E+DI+G K      F +P +K+P F     K +G          DI+++ P+VD+     DI G  AK      FN P +  ++++ PD+D  + G K K  I+  LP     K EG  K P    DL +K P I       D+DI G +  I G     K P   +       +K +   +D+NLP+                 D+++  P++D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct:  119 FEMPKVKMPSLN--IKGPK----MEKPEFDLKLKGPKVGG--DLDVKVPKIEGDLKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP-----KIEGDMKTP----DLDIKGPDIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPDVDITAP---------------DFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 413          

HSP 6 Score: 63.5438 bits (153), Expect = 3.506e-7
Identity = 87/314 (27.71%), Postives = 137/314 (43.63%), Query Frame = 1
Query:  172 VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGK---LKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +E P  D+ + G K  G  DL+VK P ++ D   PD+DI   E+DI+G K      F +P +K+P F  K   L+ P  + DID   P+++ D+         D+    PD+ ID TK   ++    K K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+                 D+++  P++D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct:   11 MEKPQFDLKLKGPKVGG--DLDVKAPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVKGDIDASLPKIEGDMK------TPDLDIKGPDVNIDGTKAGFEMP---KVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPS----------------TDIEVKAPDVDITAP---------------DFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 278          

HSP 7 Score: 61.2326 bits (147), Expect = 2.478e-6
Identity = 120/428 (28.04%), Postives = 175/428 (40.89%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEI------------------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNRA--------------------KGNVDVTFNKPDLE-----IDITKPDMDIEIDGKKKKHGINIGLPSMKGLK-------FEGKGKKPKSEVDLG-------VKTPSIDI--------------DIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP I       DVDI G +     PKG                          D++   P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       D++ P+VD+     DI G +                       +VDV     D+E     +DIT PD DI+    K K G    +P M G+        F  KG K K ++D         +KTP +DI              DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct:    4 LNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVKGDIDASLPKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKGPDIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 419          
BLAST of SMED30001359 vs. TrEMBL
Match: A0A402EPP9 (PDZ domain-containing protein OS=Paroedura picta OX=143630 GN=parPi_0005794 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.501e-14
Identity = 111/343 (32.36%), Postives = 169/343 (49.27%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKL-------PKFEGKLKKPKGELDIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNV---EVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            LDI  PD ++   + K+K PK            +  PDID+++ G + KGE++ ++K PN+++    PDID+E   V+I+GK+KK    F LP +         P+ + KLKKP    D+DI GP+V     DVDIHG +AKG     F  P L I    ++ PD+++ + G K K  +++ +PS+     EG  K P    DL +K P +DID  D       G L +  P   +        K +   +D+NLP         K         LDI TP++D     +      K K  ++  NV    +PD  ++++G K KGDIDV  S P+++ D+ G
Sbjct: 2531 LDIETPDLEIEGPDAKIKGPKFKKPEMHFNVPKISMPDIDLNLKGPRLKGELEGDIKGPNIEV--KGPDIDLEAPKVEIEGKQKKS--RFRLPKFSFSSSKGQTPEVDVKLKKP----DVDISGPKVDVQAPDVDIHG-KAKGP---KFKMPSLNISSPKVSMPDVELNLKGPKLKGDLDVSVPSL-----EGDLKAP----DLDIKGPKLDIDAPDIDLQGPEGKLKM--PKFRMPKFGMSGFKAEGPEVDVNLPKADIDVSGPK---------LDIETPDLDI-EGPEGKIKGPKFKMPEMHFNVPKISMPDIDLNLKGPKLKGDIDV--SAPKLEGDLKG 2838          

HSP 2 Score: 75.8702 bits (185), Expect = 5.303e-11
Identity = 101/370 (27.30%), Postives = 172/370 (46.49%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI----------EVDIDGKKKKHGLD-FNLPDWKLPKFEGK-----LKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKG--------------------LKFEG---KGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            LD+++PD  +   EGK K PK     ++++AP I   DVD + K PK + DL+V  P ++ DF  P+IDI          +VD+ G + K  +  F +P + +P F+ +     +  PK +LD+     DI  P +D++    + KG     F  PD+      I+ PD D+ + G K K  +++ +P+++G                    ++FEG   K K PK ++ D+  K P I   D++++ K  ++ GD+ V  P         +    K   IDI  P+              G  D+DI  P+    G   K  + N          + +PD   +++G K KGD+D+ +S+P+++ D+ G
Sbjct: 3398 LDVDMPDVDIEGPEGKWKSPKFKMPEMNIKAPKISMPDVDFNLKGPKLKGDLDVSAPKLEGDFKGPEIDIKGPKLDIDAPDVDLHGPEGKLKMPKFKMPKFGMPSFKAEGPDVDVSLPKADLDVSVPKVDIEAPSLDIEGPEGKVKGP---KFKMPDMHFKTPKISMPDFDLNLKGPKMKGDVDMSVPTLEGDLKGPDVDIKGPKLDIDAPDVEFEGPEGKWKGPKFKMPDMHFKAPKISMPDMNLNLKGPKVKGDVDVSVPK--------IEGDLKGPEIDIKGPHI-------------GAPDIDIEGPDGKLKGPKFKMPEMNIKAP-----KISMPDVDFNLKGPKLKGDMDLDVSLPKMEGDLKG 3738          

HSP 3 Score: 72.4034 bits (176), Expect = 6.101e-10
Identity = 109/371 (29.38%), Postives = 171/371 (46.09%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI--------EVDIDGKKKK-HGLDFNLPDW-------KLPKFEGKLKKPK-------------GEL---DIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXX----XXXXXXXXXXXXXIDVN-----VEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            LD++LPD  +   EGKLK PK         A  +  PD D+++ G K KG++D++V  P ++ DF  P++DI        +VDI+G   K  G  F +PD         +P F+  LK PK             G+L   D+DI+GP++     DVDI G   K      F  P++ I    I+ PD+D  + G K K  +++  P     K EG  K P  E+D  +K P +DID  D   H   G L +  P   +      S K +   +D++LP                + DLD++ P++D D  +             K    D++     + +PD  ++++G K KGD+D  +S+P ++ D+ G
Sbjct: 2848 LDVDLPDVDIEGPEGKLKGPKFKMPDMHFKAPKISMPDFDLNLKGPKVKGDVDVSV--PKLEGDFKGPEVDITCPKMDIPDVDIEGPDAKLKGPKFKMPDMHFKTPKISMPDFDLNLKGPKVKGDVDVSMPKLEGDLKGPDVDIKGPKLDVDMPDVDIEGPEGKWK-GPKFKMPEMNIKAPKISMPDVDFNLKGPKLKGDLDVSAP-----KLEGDLKGP--EID--IKGPRLDIDAPDVDLHGPEGKLKM--PKFKMPKFGMPSFKAEGPDVDVSLP----------------KADLDVSVPKVDIDAPSLDIEGPEGKVKGPKFKMPDMHFKTPKISMPDFDLNLKGPKMKGDVD--MSVPTLEGDLKG 3186          

HSP 4 Score: 72.4034 bits (176), Expect = 7.237e-10
Identity = 105/361 (29.09%), Postives = 170/361 (47.09%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKPDIDI-EVDIDGKKKKHGLD-FNLPDWKLPKFEGK-----LKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHL-----SIPEVDIDVDGKKKKHGFGINLP 1071
            +DI  PD  +   EG++K PK         A  +  PD D+++ G K KG++D++V       K P++DI   K DID  +VD+ G + K  +  F +P + +P F+G+     +  PKG++DI     DI GP++D++    + KG     F  PD+ I    I+ PD+D  + G K K  +++ LP     K EG+   P    D+ +K P +DI+  D   H   G L +  P   +        K +   +DINLP                  D+DI+ P++D +G                D+++E P+  I  +G K K   D+H+     S+P+VD ++ G K K    ++LP
Sbjct: 2147 VDIEGPDLDIEGPEGRVKGPKFKMPEMHIKAPKISMPDFDLNLKGPKLKGDMDVSVPKLEGDLKGPDIDIKGPKLDIDAPDVDLHGPEGKLKMPKFKMPKFGMPGFKGEGPEVEINLPKGDIDISAPKVDIEGPDLDIEGPEGKIKGP---KFKMPDMHIKAPKISMPDVDFNLKGPKLKGDVDVSLP-----KVEGELTGP----DIDIKGPKLDIEAPDVDLHGPEGKLKM--PKFKMPKFGMPGFKGEGPEVDINLPKG----------------DIDISAPKVDIEGP---------------DLDIEGPEGKI--KGPKFKMP-DMHIKAPKISMPDVDFNLKGPKLKGDVDVSLP 2459          

HSP 5 Score: 71.633 bits (174), Expect = 1.046e-9
Identity = 114/370 (30.81%), Postives = 166/370 (44.86%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPD-----LEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            DVNL K +IDV   K                 LDI  PD  +   EGK+K PK  +         +  PDID+++ G K KG+ID  V  P ++ D   PD+DI        K   LD +LPD  +   EGKLK PK ++ D+  + P++     D+++ G + KG+VDV+  K +      E+DIT P MDI   +I+G   K         +KG KF    K P    D+  KTP I   D D++ K  ++ GD+ V  P         +    K   +DI  P                  D+DI  PE  + G   K  + N          + +PD   +++G K KGD+DV  S P+++ D+ G
Sbjct: 2759 DVNLPKADIDVSGPK-----------------LDIETPDLDIEGPEGKIKGPKFKMPEMHFNVPKISMPDIDLNLKGPKLKGDID--VSAPKLEGDLKGPDVDI--------KGPKLDVDLPDVDIEGPEGKLKGPKFKMPDMHFKAPKISMPDFDLNLKGPKVKGDVDVSVPKLEGDFKGPEVDITCPKMDIPDVDIEGPDAK---------LKGPKF----KMP----DMHFKTPKISMPDFDLNLKGPKVKGDVDVSMP--------KLEGDLKGPDVDIKGPKLDVD-----------MPDVDIEGPEGKWKGPKFKMPEMNIKAP-----KISMPDVDFNLKGPKLKGDLDV--SAPKLEGDLKG 3058          

HSP 6 Score: 71.2478 bits (173), Expect = 1.654e-9
Identity = 100/357 (28.01%), Postives = 171/357 (47.90%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLN---VKNPNVDIDFHKPDIDI-EVDIDGKKKKHGL-DFNLPDWKLPKFEGK-----LKKPKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVH-----LSIPEVDIDVDGKKKKHGFGINLP 1071
            LDI++P   +   EGK+K PK         A  +  PDID+++ G K KG+++++   V+ P++D+   K DID  ++++ G + K  +  F +P + +P F+ +     +  PKG++D     +DI GP++D++    R KG     F  P++ I    I+ PD D+ + G K K  +++ +P     K EG  K P    D+ +K P +DID  D   H   G L +  P   +        K +   ++INLP                  D+DI+ P++D +G                D+++E P+    I+G K K   D+H     +S+P+VD ++ G K K    ++LP
Sbjct: 2023 LDIDVPSMNIEGPEGKVKGPKFKMPEMNIKAPKISMPDIDLNLKGPKFKGDVEVSLPKVEGPDIDLKGPKFDIDAPDLELHGPEGKLKMPKFKMPKFGMPSFKAEGPEVDVNLPKGDIDFAVPKVDIEGPDLDIEGPEGRVKGP---KFKMPEMHIKAPKISMPDFDLNLKGPKLKGDMDVSVP-----KLEGDLKGP----DIDIKGPKLDIDAPDVDLHGPEGKLKM--PKFKMPKFGMPGFKGEGPEVEINLPKG----------------DIDISAPKVDIEGP---------------DLDIEGPEGK--IKGPKFKMP-DMHIKAPKISMPDVDFNLKGPKLKGDVDVSLP 2331          

HSP 7 Score: 70.4774 bits (171), Expect = 2.499e-9
Identity = 75/220 (34.09%), Postives = 116/220 (52.73%), Query Frame = 1
Query:   97 LDINLPDWKL--PKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL------DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKP 711
            +DI  PD KL  PKF   E  +K PK    +  PD+D ++ G K KG++DL+V  P ++ D   P +DI        K   LD ++PD +L   EGKLK PK ++         I  P+ D+++ G + KG+VD++   P +E  +  PD++I      K   ++I  P +     EGK K PK ++  + +K P I   D+D++ K  +I GDL+V  P
Sbjct: 3679 IDIEGPDGKLKGPKFKMPEMNIKAPK----ISMPDVDFNLKGPKLKGDMDLDVSLPKMEGDLKGPSVDI--------KGPKLDVDVPDIELECPEGKLKGPKFKMPEMHFKTPKISMPDFDLNLKGPKVKGDVDMSV--PKVEGGLEGPDVNI------KGPKLDIDTPDLDFKGPEGKLKGPKLKMPGMHIKAPQISMPDVDLNLKGPQIKGDLNVSGP 3878          

HSP 8 Score: 69.707 bits (169), Expect = 5.260e-9
Identity = 79/262 (30.15%), Postives = 125/262 (47.71%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK---GALDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI----------EVDIDGKKKKHGL-DFNLPDWKLPKFEGK-----LKKPKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSM-----------KGLKF------------EGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKP 711
            LDI+ PD +    EGK K PK     ++++AP I   DVD + K PK + DL+V  P ++ DF  P+IDI          +VD+ G + K  +  F +P + +P F+ +     +  PK +LD     +DI  P +D++    + KG     F  PD+      I+ PD D+ + G K K  +++ +P +           KG K             EGK K PK ++ ++ +K P I   D+D + K  ++ GDL V  P
Sbjct: 3196 LDIDAPDVEFEGPEGKWKGPKFKMPEMNIKAPKISMPDVDFNLKGPKLKGDLDVSAPKLEGDFKGPEIDIKGPKFDIDAPDVDLHGPEGKLKMPKFKMPKFGMPSFKAEGPDVDISLPKADLDVSVPKVDIEAPCLDIEGPEGKVKGP---KFKMPDMHFKTPKISMPDFDLNLKGPKMKGDVDVSMPKLEGDLKGPDVDIKGPKLDVDMPDVDIEGPEGKWKSPKFKMPEMNIKAPKISMPDVDFNLKGPKLKGDLDVSAP 3454          

HSP 9 Score: 68.5514 bits (166), Expect = 1.039e-8
Identity = 96/331 (29.00%), Postives = 162/331 (48.94%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD--------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV-DLGVKTPSIDI-DIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVH-----LSIPEVDI 1023
            +D++LPD  +   EGKLK PK  +         +  PDID++  G K KG++D++V  P ++ D   PD+DI        K   LD ++PD ++   EGK K PK ++ ++ I+ P++     D+++ G + KG+ DV+   P LE ++  PD+DI   G K    ++I +P +     EGK K PK ++ ++ +K P I + DI   K  +   DL++  P             K K  +D+++P  +      +      ++D+D    EI       K+      +       + +PD  ++++G K KGD+DV      L  PEVDI
Sbjct: 1719 VDVDLPDVDIEGPEGKLKGPKFKMPEMHFNVPKISMPDIDLNWRGPKVKGDVDVSV--PKLEGDLKGPDVDI--------KGPKLDVDVPDVEIEGPEGKWKSPKFKMPEMHIKAPKLSMPDFDLNLKGPKLKGDADVSL--PKLEGELKGPDVDIT--GPK----LDIDMPDVSLEGPEGKVKGPKFKMPEMHIKAPKISMPDIKAPKLSMPDVDLNLKGP-------------KLKGDVDVSIPKLEGDLKGPEVDIKGPKLDIDAPDVEIGGPEGKWKTPKFKMPEMHIKAPKISMPDFDLNLKGPKLKGDVDVPKLEGDLKGPEVDI 2018          

HSP 10 Score: 67.0106 bits (162), Expect = 3.760e-8
Identity = 104/371 (28.03%), Postives = 176/371 (47.44%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD---VEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI----------EVDIDGKKKKHGL-DFNLPDWKLPKFEGK-----LKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVD-----LDINTPEIDFXXXXXXXXXXXXXXXXXIDVNV---EVPDASIDIQGKKHKGDID-------VHLSIPEVD-----IDVDGKKKKHGF 1056
            +DI  PD  +   EGK+K PK  +    ++AP I   DVD + K PK + D++V  P V+ +   PDIDI          +VD+ G + K  +  F +P + +P F+G+     +  PKG++DI     DI GP++D++    + KG     F  PD+ I    I+ PD+D  + G K K  +++ LP     K EG+   P    D+ +K P +DI+  D   H   G L +  P   +        K +   +D++LP               G++D     LDI TP+++            K KK ++  NV    +PD  ++++G + KG+++       + +  P++D     ++++GK+KK  F
Sbjct: 2275 VDIEGPDLDIEGPEGKIKGPKFKMPDMHIKAPKISMPDVDFNLKGPKLKGDVDVSLPKVEGELTGPDIDIKGPKLDIEAPDVDLHGPEGKLKMPKFKMPKFGMPGFKGEGPEVDINLPKGDIDISAPKVDIEGPDLDIEGPEGKIKGP---KFKMPDMHIKAPKISMPDVDFNLKGPKLKGDVDVSLP-----KVEGELSGP----DIDIKGPKLDIEAPDVDLHGPEGKLKM--PKFKMPKFSMPGFKGEGPSVDVSLPK--------------GELDVSGPKLDIETPDLEI-EGPDAKIKGPKFKKPEMHFNVPKISMPDIDLNLKGPRLKGELEGDIKGPNIEVKGPDIDLEAPKVEIEGKQKKSRF 2616          

HSP 11 Score: 66.2402 bits (160), Expect = 6.958e-8
Identity = 101/344 (29.36%), Postives = 163/344 (47.38%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD---VEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI----------EVDIDGKKKKHGL-DFNLPDWKLPKFEGK-----LKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITK---PDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV---DLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            +DI  PD  +   EGK+K PK  +    ++AP I   DVD + K PK + D++V  P V+ +   PDIDI          +VD+ G + K  +  F +P + +P F+G+     +  PKGELD+     DI  P+++++    + KG     F KP++  ++ K   PD+D+ + G           P +KG + EG  K P  EV   D+ ++ P ++I+   KK R    L      +      +V  K KK  +DI+ P                   +D+  P++D  G AK  K K  S        V +PD  ++++G K KGD+DV  S+P ++ D+
Sbjct: 2403 VDIEGPDLDIEGPEGKIKGPKFKMPDMHIKAPKISMPDVDFNLKGPKLKGDVDVSLPKVEGELSGPDIDIKGPKLDIEAPDVDLHGPEGKLKMPKFKMPKFSMPGFKGEGPSVDVSLPKGELDVSGPKLDIETPDLEIEGPDAKIKGP---KFKKPEMHFNVPKISMPDIDLNLKG-----------PRLKG-ELEGDIKGPNIEVKGPDIDLEAPKVEIEGKQKKSRFR--LPKFSFSSSKGQTPEVDVKLKKPDVDISGPK------------------VDVQAPDVDIHGKAKGPKFKMPSLNIS-SPKVSMPDVELNLKGPKLKGDLDV--SVPSLEGDL 2708          

HSP 12 Score: 65.855 bits (159), Expect = 8.851e-8
Identity = 108/371 (29.11%), Postives = 162/371 (43.67%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDV-DIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKK-HGLDFNLP--------------DWKL-------------PKFEGKLKKPKGELDIDIRGPEVD-----VDIHGNRAKGNVDVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVH-----LSIPEVDIDVDGKKKKHGFGINLP 1071
            LDI+ PD +L   EGKLK PK    ++ P   +    G+ P    D++V  P  D+D   P+IDIE   +DI+G + K  G  F +P              DW L             PK EG+ K P    DIDI+GP++D     +DI G   K      F  P++ I    I+ PD+D  + G K K  +++  P     K EG  K P  E+D  +K P +DID  D   H   G L +  P   +        K +   +D++LP                + DLD++ P++D +                  VN+E P+  +  +G K K   D+H     LS+P+VD+++ G K K    ++ P
Sbjct: 1167 LDIDTPDVELHGPEGKLKMPK----LKMPKFGIPGFRGEAP----DVDVSLPKADVDISGPNIDIEGPHLDIEGPEGKLKGPRFKMPEMHFKAPKLSMPDVDWNLKGPKFKGDYDVSTPKLEGEWKGP----DIDIKGPKLDAGVPEIDIEGPEGKWK-SPKFKMPEMNIKAPKISMPDVDFNLKGPKLKGDLDVTAP-----KLEGDLKGP--EID--IKGPKLDIDTPDMDLHGPEGKLKM--PKFKMPKFGMPGFKAEGPDVDVSLP----------------KADLDVSVPKVDIEAPG---------------VNIEGPEGKV--KGPKFKMP-DMHFKTPKLSMPDVDLNLKGPKFKGDLDVSAP 1479          

HSP 13 Score: 65.0846 bits (157), Expect = 1.622e-7
Identity = 95/329 (28.88%), Postives = 159/329 (48.33%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD---VEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            +DI  P   +   EGK+K PK  +     + P +   DVD++ K PK + DL+V  P ++ D   PD DI        K   LD + PD ++   EGK K PK ++ ++ I+ P++     D+++ G + KG+VDV+   P LE D+  PD+DI      K   ++I  P +     EGK K PK ++ ++ +K P I   DID+  +  ++ GD+ +  P+ + ++       K    +D++LP                  D+D+  PE    G   K  D +          + +PD  +  +G K KGD+DV  S+P+++ D+ G
Sbjct: 1423 VDIEAPGVNIEGPEGKVKGPKFKMPDMHFKTPKLSMPDVDLNLKGPKFKGDLDVSAPKLEGDLKGPDFDI--------KGPKLDIDAPDVEIGGPEGKWKTPKFKMPEMHIKAPKISMPDFDLNLKGPKVKGDVDVSV--PKLEGDLKGPDVDI------KGPNLDIDAPDVNIEGPEGKWKGPKFKMPEMHIKAPKISMPDIDLSLRGPKVKGDMDLSTPNLEGELKAPEVEIKGPK-VDVDLP------------------DVDLEGPEGKLKGPKFKMPDMHFKTP-----KISMPDFDLGFKGPKLKGDVDV--SLPKLEGDLKG 1709          

HSP 14 Score: 64.6994 bits (156), Expect = 1.757e-7
Identity = 104/373 (27.88%), Postives = 165/373 (44.24%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL-------------DVEAP-----DIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKPDIDI-EVDIDGKKKK-------------HGLDFNLPDWKL-------------PKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVT----FNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            LDI++PD  L   EGK+K PK  +             D++AP     D+D+++ G K KG++D+++       K P VDI   K DID  +V+I G + K                  ++PD+ L             PK EG LK P    ++DI+GP++D+D+     +G         F  P++ I    I+ PD+D+ + G K K  + + LP ++G              D+ +K P  DID  D + H   G L +  P   +      S K +   +D+NLP         K        DLDI  PE    G   K  + +          + +PD  ++++G K KGD+DV  S+P+++ D+ G
Sbjct: 1867 LDIDMPDVSLEGPEGKVKGPKFKMPEMHIKAPKISMPDIKAPKLSMPDVDLNLKGPKLKGDVDVSIPKLEGDLKGPEVDIKGPKLDIDAPDVEIGGPEGKWKTPKFKMPEMHIKAPKISMPDFDLNLKGPKLKGDVDVPKLEGDLKGP----EVDIKGPKLDIDVPSMNIEGPEGKVKGPKFKMPEMNIKAPKISMPDIDLNLKGPKFKGDVEVSLPKVEG-------------PDIDLKGPKFDIDAPDLELHGPEGKLKM--PKFKMPKFGMPSFKAEGPEVDVNLPKGDIDFAVPKVDIE--GPDLDIEGPEGRVKGPKFKMPEMHIKAP-----KISMPDFDLNLKGPKLKGDMDV--SVPKLEGDLKG 2211          

HSP 15 Score: 64.6994 bits (156), Expect = 2.156e-7
Identity = 108/400 (27.00%), Postives = 172/400 (43.00%), Query Frame = 1
Query:   97 LDINLPD---------WKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKN-------PNVDIDFHKPDIDI-EVDIDGKKKK-HGLDFNLPDW-------KLPKFEGKLKKPK--GELDI-------DIRGPEV------------DVDIHGNRAKGNVDVTFNKPDLEIDITK---PDMDIEIDGKKKKHGINIGLPSM-----------KGLKF------------EGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQV--------DLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            LDI+ PD         WK PKF   E  +K PK    +  PDID+ + G K KG++DL+  N       P V+I   K D+D+ +VD++G + K  G  F +PD         +P F+   K PK  G++D+       D++GPEV            DVDI G   K      F  P++  ++ K   PD+D+   G K K  +++ +P +           KG K             EGK K PK ++ ++ +K P +   D D++ K  ++ GD  V  P         +  + K   +DI  P           +  +G+V        ++ I  P+I                       + +PD  ++++G K KGD+DV  SIP+++ D+ G
Sbjct: 1571 LDIDAPDVNIEGPEGKWKGPKFKMPEMHIKAPK----ISMPDIDLSLRGPKVKGDMDLSTPNLEGELKAPEVEIKGPKVDVDLPDVDLEGPEGKLKGPKFKMPDMHFKTPKISMPDFDLGFKGPKLKGDVDVSLPKLEGDLKGPEVDIKGPKVDVDLPDVDIEGPEGKLK-GPKFKMPEMHFNVPKISMPDIDLNWRGPKVKGDVDVSVPKLEGDLKGPDVDIKGPKLDVDVPDVEIEGPEGKWKSPKFKMPEMHIKAPKLSMPDFDLNLKGPKLKGDADVSLP--------KLEGELKGPDVDITGPKLDIDMPDVSLEGPEGKVKGPKFKMPEMHIKAPKISMPDIKAP--------------KLSMPDVDLNLKGPKLKGDVDV--SIPKLEGDLKG 1941          

HSP 16 Score: 64.3142 bits (155), Expect = 2.420e-7
Identity = 98/357 (27.45%), Postives = 171/357 (47.90%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD--------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPD--WKLPKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVT-------FNKPDLEI-----DITKPDMDIE-IDGKKKKHGINI---GLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDI-----DIDGKKHRISG------DLSVDKPXXXXX-XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            +DI+ P   +   EGK+K PK  +         +  PD D+++ G K KG++D++V  P ++ D   PD+DI   ++DID       ++F  P+  WK PKF   E  +K PK      I  P+VD ++ G + KG++DV+       F  P+++I     DI  PD+D+   +GK K     +   G+PS K    +     PK+++D+ V  P +DI     DI+G + ++ G      D+    P   +   D+++   K K  +D+++P  +             ++D+D+   +I+      KS      +       + +PD   +++G K KGD+DV  S P+++ D  G
Sbjct: 3122 VDIDAPSLDIEGPEGKVKGPKFKMPDMHFKTPKISMPDFDLNLKGPKMKGDVDMSV--PTLEGDLKGPDVDIKGPKLDIDAPD----VEFEGPEGKWKGPKFKMPEMNIKAPK------ISMPDVDFNLKGPKLKGDLDVSAPKLEGDFKGPEIDIKGPKFDIDAPDVDLHGPEGKLKMPKFKMPKFGMPSFKAEGPDVDISLPKADLDVSV--PKVDIEAPCLDIEGPEGKVKGPKFKMPDMHFKTPKISMPDFDLNLKGPKMKGDVDVSMPKLEGDLKGPDVDIKGPKLDVDMPDVDIEGPEGKWKSPKFKMPEMNIKAPKISMPDVDFNLKGPKLKGDLDV--SAPKLEGDFKG 3462          

HSP 17 Score: 63.5438 bits (153), Expect = 4.670e-7
Identity = 82/273 (30.04%), Postives = 117/273 (42.86%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-------------DIDIRGPEVDVDIHGNRAKGNVDV-----------------TFNKPDLEI---DITKPDMDIEIDGKKKKHGINIGLPSM-----------KGLKF------------EGKGKKPKSEV-DLGVKTPSI---DIDIDGKKHRISGDLSVDKP 711
            LDI  PD  L   EGKLK PK         A  +  PDID+++ G K KG  D  +  P ++ DF  P+IDI        K   LD + PD +L   EGKLK PK ++             D+D+  P+ DVDI G     N+D+                  F  P++      ++ PD+D  + G K K   ++  P +           KG K             EGK K PK ++ ++ +K P I   D+D + K  ++ GDL V  P
Sbjct: 1093 LDIEAPDLDLQGPEGKLKGPKFKMPEMHIKAPKISMPDIDLNLKGPKFKG--DAEISAPKLEGDFQGPEIDI--------KAPKLDIDTPDVELHGPEGKLKMPKLKMPKFGIPGFRGEAPDVDVSLPKADVDISGP----NIDIEGPHLDIEGPEGKLKGPRFKMPEMHFKAPKLSMPDVDWNLKGPKFKGDYDVSTPKLEGEWKGPDIDIKGPKLDAGVPEIDIEGPEGKWKSPKFKMPEMNIKAPKISMPDVDFNLKGPKLKGDLDVTAP 1351          

HSP 18 Score: 60.077 bits (144), Expect = 6.541e-6
Identity = 106/400 (26.50%), Postives = 176/400 (44.00%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--------GALDVEAPDIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKPDIDI-EVDIDGKKKKHGL-DFNLPDWKLPKFEGK-----LKKPKGELDI------------DIRGPE------------------------VDVDIHGNRAKGNVDVTFNK-------PDLEI-----DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKG---KKPKSEVDLGVKTPSIDI-----DIDGKKHRISGD------LSVDKPXXXXX-XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXX--IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDG 1035
            +DI  PD  +   EG +K P+         A  +  PD+D+++ G K +G+ID++V       K P +DI   K DI + +VD+ G + K  +  F +P + +P F+ +     +  PK ++DI            DI GPE                        +D+++ G + KG VDV   +       P L+I     DI+ PD D++  GK K   + +   SM G K EG       PK EVD  V  P ID+     DI+G + ++ G       L++  P   +  +D+++    +  G+DI +PN +      +      +  LDI  P++D  G   K K               + +PD  ++++G K KGD ++  S P+++ D  G
Sbjct:  764 VDIGGPDLDIEGPEGNIKGPRFKMPEMHIKAPKISMPDVDLNLKGPKLEGDIDVSVPKLEGDIKGPEMDIKGPKMDISVPDVDLHGPEGKLKMPKFKMPKFGMPGFKAEGPEVDVNLPKADVDISAPTLGIEAPGLDIEGPEGKIKGPKFKMPEMHFKTPKISMPDIDLNLKGPKLKGGVDVPVPRLEGELKGPALDIKGPTVDISGPDADLQSGGKLKMPKLKMPHFSMSGPKLEGPDIDVSLPKGEVD--VTGPKIDVQAPEFDIEGPEGKLKGSKFKMPKLNIKAPKVSMPDVDLNLKAPGRSGGMDITVPNIEGNLKGPQMDIKGPK--LDIEAPDLDLQGPEGKLKGPKFKMPEMHIKAPKISMPDIDLNLKGPKFKGDAEI--SAPKLEGDFQG 1157          

HSP 19 Score: 60.077 bits (144), Expect = 6.599e-6
Identity = 97/396 (24.49%), Postives = 161/396 (40.66%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKG----------ALDV-------------EAPDIDVDIHGKKPKGEIDLN--VKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGE-LDIDIRGPEV----------------------DVDIHGNRAKGNV----------------------------DVTFNKPDLEID---ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLG-----VKTPSIDIDI-DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            + I +PD  +  FEGKLK PK            LDV              APD DV++ G K KG++ ++  +K+P V +D   P++++E          G    LP  KLP+F       +G  LD++I GP++                      D+++ G   KGNV                            DV+   P L +    ++ PD+DI + G K K  ++IG+    G +F G    PK   DL      +K PS+ +++  G+    SG +S  K      +        ++ G+D++ P         ++    G V++++  P+I     +K    K    K K+  NV  P+ S  + G   +G++   L   E D++V
Sbjct: 4378 IGIGMPDADIGGFEGKLKMPKSQGLDVSLNAPGLDVKGPSVKMTSGGGISAPDFDVNLKGPKIKGDLGISGDIKSPKVAVDV--PNVNLE--------GSGGGIKLPSLKLPQFGISSSHGEGSNLDMNIAGPQIKGPEVGFKGPTISAPAVSTPDMDLNLKGPSFKGNVNIAGDMKGPKIDVPGVKISGMDLDAGAPDVSLRGPSLNVSAPKVSGPDLDINLKGPKVKGDLDIGMKGAGGFQFSG----PKVGGDLKGPQLEIKGPSVGVNVPQGRLESPSGKVSFPKMKIPKFVVTGQELTGREVGVDVDFPQA------PEASLHAGTVNVELEEPDIKL-KKSKIKMPKFAFSKSKVKGNVGSPEVSASVSG--GEGELKASLGSLEGDLEV 4750          

HSP 20 Score: 59.6918 bits (143), Expect = 8.911e-6
Identity = 99/362 (27.35%), Postives = 160/362 (44.20%), Query Frame = 1
Query:   94 GLDINL--PDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVD---IDFHKPDI---DIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPK------GELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK-----------KKHGINIGLPSMKGLKFEGKGKKPKSE-VDLGVKTPSIDI------------------DIDGKKHRISGDLSVDKPXXXXXXXXXVSN-KKKKHGIDINLPNWXXXXXXXXXXXXXGQ-VDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            G DI+L  P +KL      L  PK   D   P ID ++         D+++K P+V+   +D   P +   D ++++ G K K   D  LP  +L   E KLK PK      G+  + + GPEVD  + G     ++DV+   P+++ D+  P +D+ + G K           K   I IG+P      FEGK K PKS+ +D+ +  P +D+                  D++ K  +I GDL +        + +DV N   +  G  I LP+ K P+F   S   +G  +D++I  P+I       K    +          V  PD  ++++G   KG++++   +    IDV G K
Sbjct: 4212 GPDISLKKPTFKLSGGNVDLAGPKLEGDFRVPTIDANVSAP------DISLKGPSVNLPSVDISAPTLSAPDFDINLKGPKLKG--DVELPKGELQGPEAKLKFPKFGLPKIGKPGVKLGGPEVD--LQGQMPSASIDVS--APNIKGDVNVPAVDVNLKGPKLGGDLGLSGDIKGPMIGIGMPDADIGGFEGKLKMPKSQGLDVSLNAPGLDVKGPSVKMTSGGGISAPDFDVNLKGPKIKGDLGISGDIKSPKVAVDVPNVNLEGSGGGIKLPSLKLPQFGISSSHGEGSNLDMNIAGPQIKGPEVGFKGPTISAPA-------VSTPDMDLNLKGPSFKGNVNIAGDMKGPKIDVPGVK 4554          
BLAST of SMED30001359 vs. Ensembl Cavefish
Match: ENSAMXT00000039323.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:37004879:37011933:-1 gene:ENSAMXG00000030707.1 transcript:ENSAMXT00000039323.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 9.348e-14
Identity = 95/346 (27.46%), Postives = 162/346 (46.82%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL-----DINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V  P ++ D   P +DI   E+D++G +      F +P  K+P F  K  K          PKG+LD     ID++ PE+D++    + KG     F  P +    I+ PD+D+ + G K K G+++ +P     K EG  K PK +++        +IDI+G +  + G +     P   +        K +   +D+NLP               G +DL     D+ +PEID +G   K K             + +PD  ++++G K KG +DV  S+P+++ D+   K
Sbjct:  734 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSV--PKIEGDIKAPKVDIEGPEIDVEGPEG----GFKMPKIKMPSFGFKGPKVEGPDVDINLPKGDLDLKGPRIDVKSPEIDIEGPEGKIKGP---KFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVP-----KIEGDIKAPKVDIE------GPEIDIEGPEIDVEGPEGGFKMPKIKMPSFGFKGPKVEGPDVDVNLPK--------------GDLDLKGPRIDVKSPEIDIEGPEGKIKGPKFKMPTISGPKMSMPDVDLNLKGPKVKGGVDV--SVPKIEGDIKAPK 1043          

HSP 2 Score: 70.8626 bits (172), Expect = 6.532e-13
Identity = 93/345 (26.96%), Postives = 159/345 (46.09%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL-----DINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V  P ++ D   P +DI   E+D++G +      F +P  K+P F  K  K          PKG++D     ID++ PE+D++    + KG     F  P +    I+ PD+D+ + G K K G+++ +P     K EG  K PK EV+        +ID++G +           P   +        K +   +D+NLP               G +DL     D+ +PEID +G   K K             + +PD  ++++G K KG +D  +S+P+++ D+   K
Sbjct:  979 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKMSMPDVDLNLKGPKVKGGVDVSV--PKIEGDIKAPKVDIEGPEIDVEGPEG----GFKMPKIKMPSFGFKGPKVEGPDVDVNLPKGDIDLKGPRIDVKSPEIDIEGPEGKIKGP---KFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVP-----KVEGDIKAPKVEVE------GPEIDVEGPEG------GFKMPKIKMPSFGFKGPKVEGPDVDVNLPK--------------GDIDLKGPRIDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVD--MSVPKIEGDIKAPK 1281          

HSP 3 Score: 70.4774 bits (171), Expect = 8.944e-13
Identity = 103/362 (28.45%), Postives = 166/362 (45.86%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNV-------KNPNVD-----IDFHKPDIDI---EVDIDGKKKK-HGLDFNLPDWKLPKFEGKLKK----------PKGELDIDIRGPEVD-----VDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV---DLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL-----DINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V       K P VD     ID   P+IDI   E+DI+G + K  G  F +P  K+P F  K  K          PKG  DID++GPE+D     +D+ G          F  P +    I+ PD+D  I G K K  +++ +P     K E   K PK ++   ++ V+ P  +IDI+G +  + G +     P   +        K +   +D+NLP               G +DL     D+ +PEID +G   K K             + +PD  ++++G K KG +D  +S+P+++ D+   K
Sbjct:  234 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVPKIEGDIKAPKVDIEGPEIDIEGPEIDIEGPEIDIEGPEGKIKGPKFKMPKIKMPSFGFKGPKVEGPDVDVNLPKG--DIDLKGPEIDIEGPEIDVEGPEG------GFKMPTISGPKISMPDVDFNIGGPKVKGDVDVSVP-----KIECDIKPPKVDIAGPEIDVEGPE-EIDIEGPEIDVEGPEGGFKMPKIKMPSFGFKGPKVEGPDVDVNLPK--------------GDIDLKGPRIDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVD--MSVPKIEGDIKAPK 565          

HSP 4 Score: 66.6254 bits (161), Expect = 1.749e-11
Identity = 85/321 (26.48%), Postives = 148/321 (46.11%), Query Frame = 1
Query:  172 VEAPDIDVDIHGKKPKGEIDLN-------VKNPNVD-----IDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +  PD+D+++ G K KG +D++       +K P VD     ID   P+IDI   E+D++G +      F +P  K+P F  K  K          PKG++D     ID++ PE+D++    + KG     F  P +    I+ PD+D+ + G K K G+++ +P     K EG  K PK +++        +ID++G +           P   +        K +   +D+NLP                ++D+D+ +PEID +G   K K             + +PD  ++++G K KG +D  +S+P+++ D+   K
Sbjct:   11 ISMPDVDLNLKGPKVKGGVDMSIPKIEGDIKAPKVDIEGPEIDIEGPEIDIEGPEIDVEGPEG----GFKMPKIKMPSFGFKGPKVEGPDVDVNLPKGDIDLKGPKIDVKTPEIDIEGPEGKIKGP---KFKMPTISGPKISMPDVDLNLKGPKVKGGVDVSVP-----KIEGDIKAPKVDIE------GPEIDVEGPEG------GFKMPKIKMPSFGFKGPKVEGPDVDVNLPKGDIDLKGP-------KIDIDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVD--MSVPKIEGDIKAPK 298          

HSP 5 Score: 63.929 bits (154), Expect = 1.221e-10
Identity = 91/357 (25.49%), Postives = 157/357 (43.98%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V       K P VDI+   P+IDIE   +D++G +      F +P  K+P F  K  K          PKG+LD     ID++ PE+D++    + KG     F  P +    ++ PD+D+ + G K K G+++ +P     K EG  K PK +++        +ID++G +           P   +        K +   +D+NLP                  D+D+  P ID                   ++++E P+  I     K        +S+P+VD+++ G K K G  +++P
Sbjct:  853 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVPKIEGDIKAPKVDIE--GPEIDIEGPEIDVEGPEG----GFKMPKIKMPSFGFKGPKVEGPDVDVNLPKGDLDLKGPRIDVKSPEIDIEGPEGKIKGP---KFKMPTISGPKMSMPDVDLNLKGPKVKGGVDVSVP-----KIEGDIKAPKVDIE------GPEIDVEGPEG------GFKMPKIKMPSFGFKGPKVEGPDVDVNLPKG----------------DIDLKGPRIDVKSP---------------EIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVP 1152          

HSP 6 Score: 62.3882 bits (150), Expect = 3.515e-10
Identity = 104/366 (28.42%), Postives = 162/366 (44.26%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKG----------------EIDLNVKNPNV-----------DIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGE-------LDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEV---DLGVKTPSID-----IDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL-----DINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            D  LPK +  LK PK  +DV+ P+ID++    K KG                ++DLN+K P V           + D   P +DI   E+D++G +      F +P  K+P F  K  K          PKG+       +DID++ PE+D++    + KG     F  P +    I+ PD+D+ + G K K G+++ +P     K EG  K PK ++   ++ ++ P ID     IDI+G + +I G      P   +        K +   +D+NLP               G +DL     DI  PEID +G     K    S        + +PD   +I G K KGD+DV  S+P+++ D+
Sbjct:   98 DVNLPKGDIDLKGPK--IDVKTPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDVSVPKIEGDIKAPKVDIEGPEIDVEGPEG----GFKMPKIKMPSFGFKGPKVEGPDVDVNLPKGDIDLKGPKIDIDVKSPEIDIEGPEGKIKGP---KFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVP-----KIEGDIKAPKVDIEGPEIDIEGPEIDIEGPEIDIEGPEGKIKGP-KFKMPKIKMPSFGFKGPKVEGPDVDVNLPK--------------GDIDLKGPEIDIEGPEIDVEGPEGGFKMPTISGP-----KISMPDVDFNIGGPKVKGDVDV--SVPKIECDI 427          

HSP 7 Score: 59.6918 bits (143), Expect = 2.405e-9
Identity = 70/223 (31.39%), Postives = 117/223 (52.47%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGE-LDIDIRGPEVDVDIH--GNRAKGNVDVTFNKPDLEIDITKPDMDIE--------IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDG-----KKHRISGDL 696
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V  P ++ D   P +DIE  +I+ +  + GL   +P  K+P F   LK PK E  D+DI  P+ D+DI   G++ KG++D++ +  ++E DI  P +DIE         +G  K   I +    +K  K EG      +++D+ V+    D+DI G     K  +ISG +
Sbjct: 1217 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSV--PKIEGDIKAPKVDIEGPEINVEGPEGGL--KMPKIKMPSF--GLKGPKVEGPDVDINLPKGDIDIKVPGSKLKGDIDLSAS--NIEGDIKTPKVDIEGPGVNFEGPEGGLKMPKIKMPAFGLKAPKVEG------TDMDVQVQLSKPDVDIKGPSINTKAPKISGKI 1425          

HSP 8 Score: 58.9214 bits (141), Expect = 4.668e-9
Identity = 76/228 (33.33%), Postives = 110/228 (48.25%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVD---------------IHGKKPKGE-IDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE---IDGKKKKHGIN---IGLPS--MKGLKFEGKG---KKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDK 708
            D  +PK EG +K PK  ++VE P+IDV+                  K PK E  D++V  P  DID   P ID+   E+DI+G + K       P +K+P   G    PK      I  P+VD+++ G + KG VD++   P +E DI  P +DIE   I+ +  + G+    I +PS  +KG K EG       PK ++D+ V    +  DID     I GD+   K
Sbjct: 1148 DMSVPKVEGDIKAPK--VEVEGPEIDVEGPEGGFKMPKIKMPSFGFKGPKVEGPDVDVNLPKGDIDLKGPRIDVKSPEIDIEGPEGK----IKGPKFKMPTISG----PK------ISMPDVDLNLKGPKVKGGVDMSV--PKIEGDIKAPKVDIEGPEINVEGPEGGLKMPKIKMPSFGLKGPKVEGPDVDINLPKGDIDIKVPGSKLKGDIDLSASNIEGDIKTPK 1357          

HSP 9 Score: 56.9954 bits (136), Expect = 2.167e-8
Identity = 106/366 (28.96%), Postives = 162/366 (44.26%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE---IDGKKKKHGIN---IGLPSMKGLKFEGKGKK----------PKSEVDLG-----VKTPSIDIDIDGKKHRI------------------SGDLSVDKPXXXXXXXXXVSNKKKKHGIDIN---LPNWXXXXXXXXXXX-XXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
              +P  K+P F    K PK    VE PD+DV++    PKG+IDL  K P +D+    P+IDIE   +GK K  G  F +P    PK               I  P+VD+++ G + KG VD++   P +E DI  P +DIE   ID +  + G     I +P +K   F  KG K          PK ++DL      VK+P IDI+   +K R+                  +  L V K        +    K K H +D+    +PN K P +  +      G  D+D+N P+ D D    +   K+       ++++E P+  I     K        +S+P+VD+++ G K K G  +++P
Sbjct:  463 FKMPKIKMPSF--GFKGPK----VEGPDVDVNL----PKGDIDL--KGPRIDV--KSPEIDIE-GPEGKIK--GPKFKMPTISGPK---------------ISMPDVDLNLKGPKVKGGVDMSV--PKIEGDIKAPKVDIEGPEIDVEGPEGGFKMPKIKMPKIKMPSFGFKGPKVEGPDVDVNLPKGDLDLKGPRIDVKSPEIDIEGQKEKSRVPNSKCPLYQVQRSPCLMLTSTLKVQKLMWRDQRVVSKCPKSKCHHLDLKDQKVPNSKCPPYQVQRSPLKGGGPDVDVNLPKGDIDLKGPRIDVKSP------EIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVP 788          

HSP 10 Score: 51.6026 bits (122), Expect = 9.710e-7
Identity = 50/161 (31.06%), Postives = 85/161 (52.80%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGAL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGL-DFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKH 549
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V  P ++ D   P +DI   E+D++G +    +    +P  K+P F    K PK      + GP+VDV    N  KG++D+   +    ID+  P++DIE  G+K+K 
Sbjct:  501 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSV--PKIEGDIKAPKVDIEGPEIDVEGPEGGFKMPKIKMPKIKMPSF--GFKGPK------VEGPDVDV----NLPKGDLDLKGPR----IDVKSPEIDIE--GQKEKS 641          
BLAST of SMED30001359 vs. Ensembl Cavefish
Match: ENSAMXT00000036931.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:37013574:37019944:-1 gene:ENSAMXG00000030906.1 transcript:ENSAMXT00000036931.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 3.283e-12
Identity = 95/342 (27.78%), Postives = 151/342 (44.15%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALD------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
             +DI  P+  +   +GK+K PK  +       +  PD+D ++ G K KG +D++V  P ++ D   P +DIE   VDI+G +      F +P  K+P F  K  K          PK E+DI     DI+ PEVD++    + KG     F  P +    I+ PD+D  + G K K G+++ +P     K EG  K PK             +DI+G +  I G +     P   +        K +   +D+NLP  +                +DI  PE+D +G   K K             + +PD   +++G K KG +DV  S+P+++ D+   K
Sbjct:  378 AIDIKAPEVDIEGPDGKVKGPKFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSV--PKIEGDLKAPKVDIEGPEVDIEGPEG----GFKMPKIKMPSFGFKGPKVEGPDMDVNLPKAEVDIKGPAIDIKAPEVDIEGPDGKVKGP---KFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVP-----KIEGDLKAPK-------------VDIEGPEVDIEGPEGGFKMPKIKMPSFGFKGPKVEGPDMDVNLPKAEVDIKGPA---------IDIKAPEVDIEGPDGKVKGPKFKMPSISGPKISMPDVDFNLKGPKVKGGVDV--SVPKIEGDLKAPK 681          

HSP 2 Score: 68.1662 bits (165), Expect = 5.279e-12
Identity = 98/339 (28.91%), Postives = 152/339 (44.84%), Query Frame = 1
Query:   97 LDINLPDWKL--PKFE-GKLKKPK-GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +DI  PD K+  PKF+  K+K P      +  PD+D ++ G K KG +D++V  P ++ D   P +DI   EVDI+G +      F +P  K+P F  K  K          PK E+D     IDI+ PEVD++    + KG     F  P +    I+ PD+D  + G K K G+++ +P     K EG  K PK             +DI+G +  I G +     P   +        K +   +D+NLP  +                +DI  PE+D +G   K K             + +PD   +++G K KG +DV  S+P+++ D+   K
Sbjct:  262 VDIEGPDGKVKGPKFKMPKIKMPSISGPKISMPDVDFNLKGPKVKGGVDVSV--PKIEGDIKAPKVDIEGPEVDIEGPEG----GFKMPKIKMPSFGFKGPKVEGPDVDVNLPKAEVDIKGPAIDIKAPEVDIEGPDGKVKGP---KFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVP-----KIEGDLKAPK-------------VDIEGPEVDIEGPEGGFKMPKIKMPSFGFKGPKVEGPDMDVNLPKAEVDIKGPA---------IDIKAPEVDIEGPDGKVKGPKFKMPSISGPKISMPDVDFNLKGPKVKGGVDV--SVPKIEGDLKAPK 562          

HSP 3 Score: 65.4698 bits (158), Expect = 3.518e-11
Identity = 107/345 (31.01%), Postives = 163/345 (47.25%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDV---DIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKK-HGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKK----------PKSEVDLGVKTPSIDI-----DIDGKKHRISGD----LSVDKPXXXXX-XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-VDGKKKKHGF 1056
            D  LPK E  +K P  A+D++AP++D+   D   K PK +I ++V+    ++D   P IDI   EVDI+G   K  G  F +P  K+P   G    PK      I  P+VD ++ G + KG VDV+   P +E DI  P +DI   E+D +  + G    +P +K   F  KG K          PK+EVD  +K P+IDI     DI+G   ++ G      S+  P   +  +D ++   K K G+D+++P  +    + K      +VD++              S      K    D++V +P A +DI+G        + +  PEVDI+  DGK K   F
Sbjct:  200 DVNLPKAEVDIKGP--AIDIKAPEVDIEGPDGKVKGPKFKI-VDVRISKAEVDIKGPAIDIKAPEVDIEGPDGKVKGPKFKMPKIKMPSISG----PK------ISMPDVDFNLKGPKVKGGVDVSV--PKIEGDIKAPKVDIEGPEVDIEGPEGGFK--MPKIKMPSFGFKGPKVEGPDVDVNLPKAEVD--IKGPAIDIKAPEVDIEGPDGKVKGPKFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVPKIEGDLKAPKVDIEGPEVDIEGPEGGFKMPKIKMPSFGFKGPKVEGPDMDVNLPKAEVDIKGPA------IDIKAPEVDIEGPDGKVKGPKF 519          

HSP 4 Score: 63.5438 bits (153), Expect = 1.466e-10
Identity = 67/214 (31.31%), Postives = 105/214 (49.07%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALD------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGELD-----IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDID 660
             +DI  P+  +   +GK+K PK  +       +  PD+D ++ G K KG +D++V  P ++ D   P +DI   EVDI+G +      F +P  K+P F  K  K          PK E+D     IDI+ PEVD++    + KG     F  P +    I+ PD+D  + G K K G+++ +P     K EG  K PK +++     P +DI+
Sbjct:  874 AIDIKAPEVDIEGPDGKVKGPKFKMPSISGPKISMPDMDFNLKGPKVKGGVDVSV--PKIEGDIKAPKVDIEGPEVDIEGPEG----GFKMPKIKMPSFGFKGPKVEGPDMDVNLPKAEVDIKGPAIDIKAPEVDIEGPDGKVKGP---KFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVP-----KIEGDIKAPKVDIE----GPEVDIE 1069          

HSP 5 Score: 62.3882 bits (150), Expect = 3.095e-10
Identity = 96/343 (27.99%), Postives = 149/343 (43.44%), Query Frame = 1
Query:   97 LDINLPDWKL--PKFE-GKLKKPK-GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI------EVDIDGKKKKHGLD-FNLPDWKLPKFEGKLKK----------PKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKK 1041
            +DI  PD K+  PKF+  K+K P      +  PD+D ++ G K KG +D++V     +  F  P I +      EVDI+G +    +    +P  K+P F  K  K          PK E+DI     DI+ PEVD++    + KG     F  P +    I+ PDMD  + G K K G+++ +P     K EG  K PK             +DI+G +  I G +     P   +        K +   +D+NLP  +                +DI  PE+D +G   K K             + +PD   +++G K KG +DV  S+P+++ D+   K
Sbjct:  748 VDIEGPDGKVKGPKFKMPKIKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVDIEGPEGGFKMPKIKMPSISGPEVDIEGPEGGFKMPKIKMPKIKMPSFGFKGPKVEGPDMDVNLPKAEVDIKGPAIDIKAPEVDIEGPDGKVKGP---KFKMPSISGPKISMPDMDFNLKGPKVKGGVDVSVP-----KIEGDIKAPK-------------VDIEGPEVDIEGPEGGFKMPKIKMPSFGFKGPKVEGPDMDVNLPKAEVDIKGPA---------IDIKAPEVDIEGPDGKVKGPKFKMPSISGPKISMPDVDFNLKGPKVKGGVDV--SVPKIEGDIKAPK 1058          

HSP 6 Score: 62.3882 bits (150), Expect = 3.601e-10
Identity = 93/357 (26.05%), Postives = 154/357 (43.14%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALD------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKK----------PKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK-------GDIDVHLSIPEVDIDVDGKKKKHGFGINL 1068
             +DI  P+  +   +GK+K PK  +       +  PD+D ++ G K KG +D++V  P ++ D   P +DIE   VDI+G +      F +P  K+P F  K  K          PK E+DI     DI+ PEVD++    + KG     F  P +    I+ PD+D  + G K K G+++ +P     K EG  K PK +++     P +DI+      ++     +  P   +        K +   +D+NLP                + ++DI  P ID                   +V++E PD  +  +G K K             +S+P+VD ++ G K K G  +++
Sbjct:  497 AIDIKAPEVDIEGPDGKVKGPKFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSV--PKIEGDLKAPKVDIEGPEVDIEGPEG----GFKMPKIKMPSFGFKGPKVEGPDMDVNLPKAEVDIKGPAIDIKAPEVDIEGPDGKVKGP---KFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVP-----KIEGDLKAPKVDIE----GPEVDIEGPEGGFKMP---KIKMPKIKMPSFGFKGPKVEGPDMDVNLP----------------KAEVDIKGPAIDIKAP---------------EVDIEGPDGKV--KGPKFKMPKIKMPSISGPKISMPDVDFNLKGPKVKGGVDVSV 799          

HSP 7 Score: 62.003 bits (149), Expect = 4.497e-10
Identity = 89/341 (26.10%), Postives = 145/341 (42.52%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK-----GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKK-HGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID------ITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DI   D  +   +GK+K  K        ++  P +D+++ G   KG  D++V  P  ++D   P IDI   EVDI+G   K  G  F + D ++ K E  +K P     IDI+ PEVD++    + KG     F  P +++       I+ PD+D  + G K K G+++ +P     K EG  K PK             +DI+G +  I G +     P   +        K +   +D+NLP                + ++DI  P ID                   +V++E PD  +     K        +S+P+VD ++ G K K G  +++P
Sbjct:  150 VDIKTADSGIKGLDGKVKSTKDTSFISGPNISMPTVDINLKGSNVKGP-DMDVNLPKAEVDIKGPAIDIKAPEVDIEGPDGKVKGPKFKIVDVRISKAEVDIKGPA----IDIKAPEVDIEGPDGKVKGP---KFKMPKIKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVP-----KIEGDIKAPK-------------VDIEGPEVDIEGPEGGFKMPKIKMPSFGFKGPKVEGPDVDVNLP----------------KAEVDIKGPAIDIKAP---------------EVDIEGPDGKVKGPKFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVP 433          
BLAST of SMED30001359 vs. Ensembl Cavefish
Match: ENSAMXT00000011221.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:12572741:12578865:1 gene:ENSAMXG00000010932.2 transcript:ENSAMXT00000011221.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.740e-9
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query:  109 LPDWKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKG------EIDLNVKNPNVDIDFHKPDIDIEVD-IDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL---DIDIRGPEVDV---------------DIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSM--KGLKFEGKGKKPKSEVDLG---VKTPSIDIDIDGKKHRISG---DLSVDK 708
            LP  K+PKF     ++K PK + +++ PD +V++   + KG        DLNV  P++      P +D+++   D K     L+ N PD KL   +  L  PKG +   D+D+  P+VDV               ++ G + KG   +V    N PD  +D+  P  DI       KH +NI  P M     K EG    P  ++DL    +K P ++++ +    ++S    DLS+ K
Sbjct:  744 LPHIKMPKFGLSAPRVKGPKVSGNLQTPDANVNLPSAELKGPDLDLKAPDLNVSTPDMKGSISAPAVDVDLAKADLKAPGLNLEANTPDLKLSAPDVDLSLPKGSIEVPDVDLNVPDVDVPSAKLKTPNLKFPKINLAGPKVKGPKVDVGADLNAPD--VDVNLPSADIRGPNLTSKH-LNIKAPEMDLSVPKIEGYVAAPAVDLDLPKADLKAPGLNLEANTPDLKLSAPDVDLSLPK 979          

HSP 2 Score: 50.0618 bits (118), Expect = 3.059e-6
Identity = 45/142 (31.69%), Postives = 73/142 (51.41%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID 498
            G+ +N P+ K P     +  PK  +D++AP +DV++    PK E    VK PN+  +   PD+D++    GK K     +NL  P  K P  + ++K P+ EL +     DI+ P V +D+  N    + +   N P+L+ID
Sbjct:  250 GVAVNTPELKSPDMS--VSVPKADVDLKAPQVDVNL----PKAE----VKGPNLKAEV--PDVDVKAP-SGKFKLQKPKWNLGKPKVKAPNVDAEMKTPEAELSVPDLKADIKAPGVKMDLP-NAELSSPEADINTPNLDID 377          

HSP 3 Score: 50.0618 bits (118), Expect = 3.085e-6
Identity = 70/238 (29.41%), Postives = 109/238 (45.80%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDI-----DVDIHGKKPKG------EIDLN---VKNPNVDI--DFHKPDIDI---EVDIDGK--KKKHGLDFNLP--DWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNV-DVTFNKPDLEIDITK-----PDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPK-----SEVDLGVKTPSI-------DIDIDGKKHRIS 687
            L+ N PD KL   +  L  PKG+  +E PD+     DVD+   K K       +I+L    VK P VD+  D + PD+D+     DI G     KH L+   P  D  +PK EG +  P  +LD+    P+ D+   G   + N  D+  + PD+++ + K     PD+D+ +   +   G  + +P +K  KF   G K +     ++  L V  P I       D+D+   K  +S
Sbjct:  826 LEANTPDLKLSAPDVDLSLPKGS--IEVPDVDLNVPDVDVPSAKLKTPNLKFPKINLAGPKVKGPKVDVGADLNAPDVDVNLPSADIRGPNLTSKH-LNIKAPEMDLSVPKIEGYVAAPAVDLDL----PKADLKAPGLNLEANTPDLKLSAPDVDLSLPKGNIEGPDVDLNVPEVEVPSG-KLKMPHLKFPKFNLTGPKVQEPNLDAKAGLDVSVPKIQGEINTPDVDLSLPKAEVS 1055          
BLAST of SMED30001359 vs. Ensembl Cavefish
Match: ENSAMXT00000011223.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:12573889:12578865:1 gene:ENSAMXG00000010932.2 transcript:ENSAMXT00000011223.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 2.152e-9
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query:  109 LPDWKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKG------EIDLNVKNPNVDIDFHKPDIDIEVD-IDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL---DIDIRGPEVDV---------------DIHGNRAKG---NVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSM--KGLKFEGKGKKPKSEVDLG---VKTPSIDIDIDGKKHRISG---DLSVDK 708
            LP  K+PKF     ++K PK + +++ PD +V++   + KG        DLNV  P++      P +D+++   D K     L+ N PD KL   +  L  PKG +   D+D+  P+VDV               ++ G + KG   +V    N PD  +D+  P  DI       KH +NI  P M     K EG    P  ++DL    +K P ++++ +    ++S    DLS+ K
Sbjct:  743 LPHIKMPKFGLSAPRVKGPKVSGNLQTPDANVNLPSAELKGPDLDLKAPDLNVSTPDMKGSISAPAVDVDLAKADLKAPGLNLEANTPDLKLSAPDVDLSLPKGSIEVPDVDLNVPDVDVPSAKLKTPNLKFPKINLAGPKVKGPKVDVGADLNAPD--VDVNLPSADIRGPNLTSKH-LNIKAPEMDLSVPKIEGYVAAPAVDLDLPKADLKAPGLNLEANTPDLKLSAPDVDLSLPK 978          

HSP 2 Score: 50.0618 bits (118), Expect = 3.457e-6
Identity = 70/238 (29.41%), Postives = 109/238 (45.80%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDI-----DVDIHGKKPKG------EIDLN---VKNPNVDI--DFHKPDIDI---EVDIDGK--KKKHGLDFNLP--DWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNV-DVTFNKPDLEIDITK-----PDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPK-----SEVDLGVKTPSI-------DIDIDGKKHRIS 687
            L+ N PD KL   +  L  PKG+  +E PD+     DVD+   K K       +I+L    VK P VD+  D + PD+D+     DI G     KH L+   P  D  +PK EG +  P  +LD+    P+ D+   G   + N  D+  + PD+++ + K     PD+D+ +   +   G  + +P +K  KF   G K +     ++  L V  P I       D+D+   K  +S
Sbjct:  825 LEANTPDLKLSAPDVDLSLPKGS--IEVPDVDLNVPDVDVPSAKLKTPNLKFPKINLAGPKVKGPKVDVGADLNAPDVDVNLPSADIRGPNLTSKH-LNIKAPEMDLSVPKIEGYVAAPAVDLDL----PKADLKAPGLNLEANTPDLKLSAPDVDLSLPKGNIEGPDVDLNVPEVEVPSG-KLKMPHLKFPKFNLTGPKVQEPNLDAKAGLDVSVPKIQGEINTPDVDLSLPKAEVS 1054          

HSP 3 Score: 49.6766 bits (117), Expect = 3.839e-6
Identity = 45/142 (31.69%), Postives = 73/142 (51.41%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKGELDI-----DIRGPEVDVDIHGNRAKGNVDVTFNKPDLEID 498
            G+ +N P+ K P     +  PK  +D++AP +DV++    PK E    VK PN+  +   PD+D++    GK K     +NL  P  K P  + ++K P+ EL +     DI+ P V +D+  N    + +   N P+L+ID
Sbjct:  249 GVAVNTPELKSPDMS--VSVPKADVDLKAPQVDVNL----PKAE----VKGPNLKAEV--PDVDVKAP-SGKFKLQKPKWNLGKPKVKAPNVDAEMKTPEAELSVPDLKADIKAPGVKMDLP-NAELSSPEADINTPNLDID 376          
BLAST of SMED30001359 vs. Ensembl Cavefish
Match: ENSAMXT00000033698.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:14895176:14901075:-1 gene:ENSAMXG00000039084.1 transcript:ENSAMXT00000033698.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 1.760e-8
Identity = 71/218 (32.57%), Postives = 108/218 (49.54%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDL-NVKNPNVDID-FHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEV---DVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKH----GINIGLPSMKGLKFEGKG---------KKPKSEVDLGVKTPSIDIDIDGKKHRISG---DLSV 702
            D   PK +G+   P+  LD+ +PDID+D     P G++ +  +K P + I     P++D++ D DG K     DF++P+  LP   GK+  PK ++ +  I GP+V   D+D    + KG V    N P L  D+  PD+DI+    K K        I +P +KG + + KG           PK  ++ G+ TP  DIDI+G    + G   D SV
Sbjct:  471 DLSPPKTKGEFNSPQ--LDLNSPDIDID----GPSGKLKMPTLKAPKISIPKLKGPEMDVKGDWDGLKGPK-TDFSVPNVNLP--SGKMSMPKFKMPEFGISGPKVKAPDMDFSAPKIKGEV----NAPGL--DLNSPDIDIDGPSGKLKMPTLKAPKISIPKLKGPEMDVKGDWDGPDFNLSSPK--LNAGITTP--DIDINGPNANLKGPKTDFSV 669          

HSP 2 Score: 55.0694 bits (131), Expect = 7.200e-8
Identity = 66/224 (29.46%), Postives = 101/224 (45.09%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVDIHG--------KKPKGEI-----------------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEV---DVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKH----GINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRIS 687
            D   PK +G+L  P+  LD+ +PDID+D           K PK  I                 D N+ +P ++     PD DI    +   K    DF++PD  LP   GK+KKPK  + D  + GP+V   ++D+   + KG +    N P  ++D+  PD+DI+    K K        I +P +KG   + KG     +++L     + DID DG    +S
Sbjct:  207 DLSAPKIKGELNSPQ--LDLNSPDIDIDGPSGKLKMPTLKAPKMTIPKLKGPDMDVKGDWDGPDFNLSSPKLNARITTPDTDIN-GPNASLKGPNTDFSVPDVNLP--SGKIKKPKFRMPDFGLSGPKVKAPEMDLSAPKIKGEI----NSP--KLDLKSPDIDIDGPSGKLKMPTLKAPKISIPKLKGPDMDVKGDWDGPDLNLSSPKLNADIDWDGPDFNLS 419          

HSP 3 Score: 49.2914 bits (116), Expect = 6.119e-6
Identity = 63/186 (33.87%), Postives = 88/186 (47.31%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALDVEAPDI--------DVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGPEV---DVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKH----GINIGLPSMKGLKFEGKG 603
            GLD+N PD  +    GKLK P     ++AP I        D+D+ G       DLN+ +P ++ D   PDIDI    +   K    DF +PD  LP   GK+  PK ++ D  I GP+V   D+D    + KG V    N P L  D+  P++DI+    K K        I +P +KG   + KG
Sbjct: 1222 GLDLNSPDIDIDGPSGKLKMPT----LKAPKISIPKLKGQDMDVKGDW--DGPDLNLSSPKLNADIGSPDIDIN-GPNASLKGPKTDFLVPDVNLP--SGKMSMPKFKVPDFGISGPKVKAPDMDFSAPKIKGEV----NAPGL--DLNSPNIDIDGPSGKLKMPTLKAPKISIPKLKGPGIDVKG 1392          

HSP 4 Score: 48.521 bits (114), Expect = 9.804e-6
Identity = 71/232 (30.60%), Postives = 105/232 (45.26%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEI-------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEV---DVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKH----GINIGLPSMKGLKFEGKG---------KKPKSEVDLGVKTPSIDIDIDGKKHRISG---DLSV 702
            GLD+N PD  +    GKLK P     ++AP I +    K P+ ++       D N+ +P ++     PDIDI     ++ G K     DF++PD  LP  + K  K     D  + GP+V   ++D+   + KG     FN P  ++D+  PD+DI+    K K        I +P +KG   + KG           PK   D+G    S DIDI+G    + G   D SV
Sbjct:  587 GLDLNSPDIDIDGPSGKLKMPT----LKAPKISIP-KLKGPEMDVKGDWDGPDFNLSSPKLNAGITTPDIDINGPNANLKGPKT----DFSVPDVNLPSGKMKKPK-FKMPDFGLSGPKVKAPEMDLSAPKTKGE----FNSP--QLDLNSPDIDIDGPSGKLKMPTLKAPKISIPKLKGPDMDVKGDWDGPNLNLSLPKLNADIG----SPDIDINGPNASLKGPKTDFSV 798          
BLAST of SMED30001359 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002063.1 (pep scaffold:Pmarinus_7.0:GL491826:26:5749:-1 gene:ENSPMAG00000001868.1 transcript:ENSPMAT00000002063.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 2.346e-13
Identity = 104/358 (29.05%), Postives = 156/358 (43.58%), Query Frame = 1
Query:  103 INLPDWKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKF-EGKGKKPKSEVDLGVKTPSIDIDIDG-------KKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKG---DIDVH----------LSIPEV--------DIDVDGKKKKHGFGINLP 1071
             N+PD K+P F   + K+  P G  DV  PD D++I G K  G I    K P  + D   PDID++    G K K    FN+PD K+P F   + K+  P G+ D+++  P+ D++I G +  G +      P L  D+  PD+D++  G K K      +P +K   F   K K    + D  V  P  D++I G       K  + + DL  D PD D+        K K +  D+ +P++             G    +I+ P+ DF                    +V +PDA ++I G K  G   DID+H           S+P++        D+DVD K  K  F I+ P
Sbjct:   56 FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGI----KAPKFNADLDAPDIDLK----GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGGGIKA----PKLNADLDAPDIDLK--GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGIKAPKFNADL--DAPDIDLK-----GPKGKFNMPDLKMPSF-------------GMSKPNISGPDGDF--------------------DVNLPDADLNISGPKLGGDAPDIDLHGPDLKLKKPTFSMPKMSGPKLNAPDLDVDLKAPKGDFDISAP 349          

HSP 2 Score: 67.0106 bits (162), Expect = 2.388e-12
Identity = 65/198 (32.83%), Postives = 96/198 (48.48%), Query Frame = 1
Query:  103 INLPDWKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKF-EGKGKKPKSEVDLGVKTPSIDIDIDGKK 675
             N+PD K+P F   + K+  P G  DV  PD D++I G K  G I    K P  + D   PDID++    G K K    FN+PD K+P F   + K+  P G+ D+++  P+ D++I G +  G +      P    D+  PD+D++  G K K      +P +K   F   K K    + D  V  P  D++I G K
Sbjct:  390 FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGI----KAPKFNADLDAPDIDLK----GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGGGIKA----PKFNADLDAPDIDLK--GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPK 563          

HSP 3 Score: 65.4698 bits (158), Expect = 7.623e-12
Identity = 64/198 (32.32%), Postives = 97/198 (48.99%), Query Frame = 1
Query:  103 INLPDWKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGI-NIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKK 675
             N+PD K+P F   + K+  P G  DV  PD D++I G K  G I    K P  + D   PDID++    G K K    FN+PD K+P F   + K+  P G+ D+++  P+ D++I G +  G +      P    D+  PD+D++  G K K  + ++ +PS    K    G     + D  V  P  D++I G K
Sbjct:  658 FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGI----KGPKFNADVDAPDIDLK----GPKGK----FNVPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGGGIKA----PKFNADLDAPDIDLK--GPKGKFNMPDLKMPSFGMSKPNISG----PDGDFDVNLPDADLNISGPK 831          

HSP 4 Score: 60.077 bits (144), Expect = 3.704e-10
Identity = 71/236 (30.08%), Postives = 108/236 (45.76%), Query Frame = 1
Query:   97 LDINLPDWKL----PKFEG------------KLKKPKGALD------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI-----------------EVDIDGKKKKHGLDFNLPDWKLPKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKF-EGKGKKPKSEVDLGVKTPSIDIDIDGKK 675
             D+NLPD  L    PK  G            KLKKP  ++       + APD+DVD+  K PKG+ D++   PN+   F  P+ID+                 ++D+ G K K    FN+PD K+P F   + K+  P G+ D+++  P+ D++I G +  G +      P    D+  PD+D++  G K K      +P +K   F   K K    + D  V  P  D++I G K
Sbjct:  281 FDVNLPDADLNISGPKLGGDAPDIDLHGPDLKLKKPTFSMPKMSGPKLNAPDLDVDL--KAPKGDFDISA--PNIGGKFSAPNIDLDGPDLKAPKLNADLDVPDIDLKGPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGGGIKA----PKFNADLDAPDIDLK--GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPK 496          

HSP 5 Score: 60.077 bits (144), Expect = 3.941e-10
Identity = 60/172 (34.88%), Postives = 82/172 (47.67%), Query Frame = 1
Query:  103 INLPDWKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE-VDIDGKKKKHGLD-FNLPDWKLPKFEGKLKKPKGELDIDIRGPEV-----DVDIHGNRAKGNVD-----------VTFNKPDLEIDITKPDMDIEIDGKKKKHGI 555
             N+PD K+P F   + K+  P G  DV  PD D++I G K  G I    K P VD+    P+ID+E  DI+ KK K  +   + P    P  +  LK PKG  DIDI  P +     D+D+ G + K N+               + PD + D+  PD D+ I G K   GI
Sbjct: 1180 FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGI----KTPKVDL--KAPNIDLEGPDINLKKPKFSMPKISGPKLHAPNLDVDLKAPKG--DIDISAPNIDLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGI 1343          

HSP 6 Score: 59.6918 bits (143), Expect = 5.278e-10
Identity = 86/274 (31.39%), Postives = 122/274 (44.53%), Query Frame = 1
Query:    4 VNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINL--PDWKLPKFEGK----------LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI-EVDIDGKKKKHGLDFNLPDWKLPKF---EGKLKKPKGELDI-------DIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLEI---DITKP------DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKP 711
            V+LK PNID+                    G DINL  P + +PK  G           LK PKG +D+ AP+I   I G             PN+D+D   PD+D  ++D+ G K K    FN+PD K+P F   + K+  P G+ D+       +I GP++     D+D+ G + K      FN PDL++    ++KP      D D+ I G K   GI                KKPK  VDL  K P+I +++D     + G DL + KP
Sbjct:  841 VDLKAPNIDL-------------------EGPDINLKKPKFSMPKISGPKLHAPNLDVDLKAPKGDIDISAPNIGGKISG-------------PNIDLD--APDLDAPDIDLKGPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLDLDAPDIDLKGPKGK------FNMPDLKMPSFGMSKPNISGPDDADLNISGPKLGGGI----------------KKPK--VDL--KAPNIGLNVDAPDIDLHGPDLKLKKP 1050          

HSP 7 Score: 57.3806 bits (137), Expect = 3.257e-9
Identity = 60/211 (28.44%), Postives = 106/211 (50.24%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKL-------KKPKGALDVEAPDIDVDIHGKK------PKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE---IDGKKKKHGI-NIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDID 660
            +D++ PD K PK    L       K PKG  ++  PD+ +   G        P G+ D+N+  P+ D++   P +D+   ++D+ G K K    FN+PD K+P F   + K+  P G+ D+++  P+ D++I G +  G +         ++D+  P++D+E   I+ KK K  +  I  P +     +   K PK ++D  +  P+ID+D
Sbjct: 1094 IDLDGPDLKAPKLNADLDAPDIDLKGPKGKFNM--PDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLDLDAPDIDLKGPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGGGIKTP------KVDLKAPNIDLEGPDINLKKPKFSMPKISGPKLHAPNLDVDLKAPKGDID--ISAPNIDLD 1286          

HSP 8 Score: 56.6102 bits (135), Expect = 5.335e-9
Identity = 78/282 (27.66%), Postives = 119/282 (42.20%), Query Frame = 1
Query:    4 VNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINL--PDWKLPKFEGK----------LKKPKGALDVEAPDIDV---DIHGKKPKGEIDL-------------NVKNPNVDIDFHKPDIDIEVD-------IDGKKKKHGLD------------FNLPDWKLPKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG 690
            V+LK PNID+                    G DINL  P + +PK  G           LK PKG +D+ AP+ID+   DI  K PKG+ ++              +  P+ D D + PD D+ +        I   K    LD            FN+PD K+P F   +  +  P G+ D+++  P+ D++I G +  G +         ++D+  P++D+   +I+ KK K      +P + G K       P  +VDL  K P  DI       +ISG
Sbjct: 1229 VDLKAPNIDL-------------------EGPDINLKKPKFSMPKISGPKLHAPNLDVDLKAPKGDIDISAPNIDLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGIKAPKFNANLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPNISGPDGDFDVNL--PDADLNISGPKLGGGIKTP------KVDLKAPNIDLDGPDINLKKPK----FSMPKISGPKLHA----PNLDVDL--KAPKGDISAPNIGGKISG 1473          

HSP 9 Score: 47.7506 bits (112), Expect = 3.204e-6
Identity = 59/198 (29.80%), Postives = 90/198 (45.45%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKF-EGKGKKPKSEVDLGVKTPSIDIDIDGKK 675
            G  I  P  K+PKF   L  PK    +  PD+D              ++K P ++ D   PDID++    G K K    FN+PD K+P F   + K+  P G+ D+++  P+ D++I G +  G +      P    D+  PD+D++  G K K      +P +K   F   K K    + D  V  P  D++I G K
Sbjct:    5 GGSIKGPHLKMPKFN--LSGPK----LSGPDLD--------------DLKAPKLNADLDVPDIDLK----GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGGGIKA----PKFNADLDAPDIDLK--GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPK 162          
BLAST of SMED30001359 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001909.1 (pep scaffold:Pmarinus_7.0:GL476451:21233:28988:1 gene:ENSPMAG00000001734.1 transcript:ENSPMAT00000001909.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 3.438e-13
Identity = 75/224 (33.48%), Postives = 104/224 (46.43%), Query Frame = 1
Query:   91 HGLDINL--PDWKLPKFE---GKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVT-------FNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKK---PKSEVDLGVKTPSIDI-----DIDGKKHRISGDLSV 702
            HG D  L  P  K+PKF     KL  P    D+  P  DVDI G K    +DL+VK P +  D   P+I+IE          G     P +K+P F G    PK      I GP+++VDI   + KG VD++        N P++++D+  PD+D+     K K       P MK  KF   G K   P  ++DL +     DI     DID K  ++ GD+S+
Sbjct: 1687 HGPDAKLKFPKMKMPKFGFSGPKLHGPDVDFDLSLPKADVDIAGPK----VDLDVKGPKIAGDIEAPNINIE--------GSGGKIKSPKFKMPSFSG----PK------ISGPDLNVDIKSPKLKGGVDMSGPKVEGDINIPNVDLDVEAPDVDLHGPDAKFK------FPKMKMPKFGFSGPKLHGPDVDLDLSLPKADFDIAAPKVDIDVKGPKLQGDMSL 1882          

HSP 2 Score: 67.781 bits (164), Expect = 1.353e-12
Identity = 101/351 (28.77%), Postives = 158/351 (45.01%), Query Frame = 1
Query:  100 DINLPDWKLPKFEGKLKKPKGALD------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEV---DIDGKKKKHGLDFNL--PDWKLPKFEGKLKKPKG-ELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEG-------KGKKPKSEVDLG-------VKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHG----IDINLP--NWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVH-------LSIPEVDIDVDG 1035
            D+++P   +   EGK+K P   L       V APD+D++I   K KG +D  V  P ++ D H PD+D++V   D+D     HG D  L  P  K+PKF     K  G ++D D+  P+ DVDI G +    VD+    P +  DI  P+++IE  G K K      +PS  G K  G       K  K K  VD+        +  P++D+D++     + G  +  K           S  K  HG    +D++LP  ++              ++  D++ P++D DG   K K             +  PD ++DI+  K KG +DV        + +P+VD+DV+ 
Sbjct: 1611 DVDIPHLDIEGPEGKIKGPNMKLPSISGPKVSAPDLDMNIKMPKFKGGVD--VSGPKLEGDVHVPDVDLDVEAPDVD----LHGPDAKLKFPKMKMPKFGFSGPKLHGPDVDFDLSLPKADVDIAGPK----VDLDVKGPKIAGDIEAPNINIEGSGGKIKS-PKFKMPSFSGPKISGPDLNVDIKSPKLKGGVDMSGPKVEGDINIPNVDLDVEAPDVDLHGPDAKFKFPKMKMPKFGFSGPKL-HGPDVDLDLSLPKADFDIAAPKVDIDVKGPKLQGDMSLPDVDIDGPEGKIKGPKIKMPDITGPQISAPDLNLDIKMPKFKGGVDVSGPKLEGDVHVPDVDLDVEA 1949          

HSP 3 Score: 65.0846 bits (157), Expect = 1.205e-11
Identity = 77/211 (36.49%), Postives = 102/211 (48.34%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVDIHG----------KKPK-GEIDLNVKNPNVDIDFHKPDIDIE-----VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEV-----DVDIHGNRAKGNVDVTFNK-------PDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKS-EVDLGVKTPSIDID 660
            D   PK EG +  P   LDVEAP  DVD+HG          K PK G     +  P+VD+D   P  D +     VDID K  K   D +LPD  +   EGK+K PK ++  DI GP++     ++DI   + KG VDV+  K       PD+++D+  PD+D+     K K       P MK  KF   G K    +VDL +  P  DID
Sbjct: 1794 DMSGPKVEGDINIPNVDLDVEAP--DVDLHGPDAKFKFPKMKMPKFGFSGPKLHGPDVDLDLSLPKADFDIAAPKVDIDVKGPKLQGDMSLPDVDIDGPEGKIKGPKIKMP-DITGPQISAPDLNLDIKMPKFKGGVDVSGPKLEGDVHVPDVDLDVEAPDLDLHGPDAKFK------FPKMKMPKFGFSGPKLHGPDVDLDLSLPKGDID 1995          

HSP 4 Score: 63.1586 bits (152), Expect = 4.538e-11
Identity = 107/393 (27.23%), Postives = 161/393 (40.97%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLK------------------------KPKGALDVEAPDIDVDIHGKKPKGEI----------DLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPK------GELDIDIRGPEVDVDIHGNRAKGNVDVTFNK-------PDLEIDITKPDMDIE-IDGKKKKHGINIGLPSMKGLKFEGKGKKPKS-EVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQ------VDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQG--------------------KKHKGDIDVHLSIPEVDIDVDGKK 1041
            LD+  PD  L   EGK K                         PKG L+V  P ++VD+ G K +G++          D  +K PN+ +   K  +D+    V+ D K     LD   PD  L   +GK K PK      G     + GP+VD D++  + KG V+V+  K       PD+++D+  PD+D++  DGK K        P MK  KF   G K    +VD  V  P  D DI G K  + GD+S+                     +D+  P+WK    + K     G       ++LD+  P+     +    K +   K   +D++VE PD  +D+QG                    K H  D+D  +++P+ D D+ G K
Sbjct:  300 LDVEAPDVNLQGPEGKFKLPKVTMPSFGFSGPNVHGSDVDVSLPKGGLNVSVPKVNVDVKGPKVQGDMSVPDVDIEGPDCKIKGPNIKMPQFKGGVDVSGPKVEGDVKVPDVDLDVEAPDVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKVKGGVEVSGPKVEGDVKVPDVDLDVEAPDVDLQGPDGKFK-------FPKMKMPKFGFSGPKLHGPDVDFDVNLPKGDGDIKGPK--LEGDMSLPD-------------------VDMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKMPKFKGGVDVSGPKVEGDVKVPDVDLDVEAPD--VDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKGDGDIKGPK 662          

HSP 5 Score: 62.3882 bits (150), Expect = 8.227e-11
Identity = 115/404 (28.47%), Postives = 164/404 (40.59%), Query Frame = 1
Query:  103 INLPDWKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLN-------VKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLP-------KFEGK-----LKKPKGELDID-------------------------------------IRGPEVDVDIHGNRAKGNVDVT-------FNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRI---SGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXID-----VNVEVPDASIDIQGKK-----------HKGDIDVHLSIPEV--DIDVDGKKKKHG 1053
               P +K+PKF     K   P    DV  P  D+++   K KG ID++       +  P+VD+ F+ PD+DIE    GK  K    F LP  K+P       KF G      L  PKG+LD+                                      I  P+VD+D+   + KG +DV+        N PD ++DI  PD++IE  G + K    I LP MK  K       P  +VDL +  P  D+ I   K  I   S D++++ P+  I        K    G  I  P+                 ++D+N P  D D ++ K K   K   G +D     VN+E PDA + +   K           H  D+D+ LS+P+V   IDV G K + G
Sbjct: 1175 FKFPKFKMPKFGFSSPKFHGPDVDFDVSLPKGDIEVKSPKVKGGIDVSGPKVEGEMNVPDVDLSFNSPDVDIE----GKDAK----FKLPKMKMPSFGISGPKFHGPDVDLDLSLPKGDLDVSAPKVDIDPSPDMNIEGADAKFKLPKMKMPDLSFSGPKIHAPDVDMDLSLTKVKGGIDVSGPKVEGDINVPDFDVDIEAPDVNIE--GPEGK----IKLPKMKKPKI--GFASPNIDVDLNI--PKADVSIASPKLGIDVSSPDVNIEGPEMKIKKPKFKMPKFGFSGPKIQSPDI--------------DANVDVNPPTADVDISSPKFKGDIKGSAGGLDIQTPDVNIEGPDAKLKMPKMKMPKIGFSGPKLHGPDVDLDLSLPKVKGGIDVSGPKIEGG 1546          

HSP 6 Score: 61.2326 bits (147), Expect = 1.893e-10
Identity = 68/229 (29.69%), Postives = 109/229 (47.60%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLN-------VKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNL--PDWKLPKFEGKLKK----------PKGELDI-----DIRGPEVDVDIHGNRAK---------GNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRI 684
            +D+  PDWK+     K+    G   + APD+++D+   K KG +D++       +K P+VD+D   PD+D+          HG D  L  P  K+PKF     K          PKG++DI     D + P ++++   ++ K         G     F+ PD++ D++ P  DIE+   K K GI++      G K EG+   P  +VDL   +P  D+DI+GK  + 
Sbjct: 1045 VDMQGPDWKIKGPNIKMPHISGP-KISAPDLNLDVKMPKFKGGVDVSGPKVEGDLKVPDVDMDVEAPDVDL----------HGPDAKLKFPKMKMPKFGFSGPKLHGPDVDVDLPKGDIDISVPKIDAKAPNLNIEGSDSKFKFPKFKMPKFGFSSPKFHGPDVDFDVSLPKGDIEVKSPKVKGGIDV-----SGPKVEGEMNVP--DVDLSFNSP--DVDIEGKDAKF 1253          

HSP 7 Score: 61.2326 bits (147), Expect = 1.979e-10
Identity = 64/219 (29.22%), Postives = 103/219 (47.03%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALD--------VEAPDIDVDIHGKKPKGEIDLN-------VKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG-ELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            GLDI  PD  +   + KLK PK  +         +  PD+D+D+   K KG ID++       VK PNVD++   PDI++E          G +  L   K+PKF        G ++D DI  P++D+++ G + +G+VD+        +DI  P+  I+        G N+ LPS+ G K          ++D+ +K P     +D    ++ GD+ V
Sbjct: 1484 GLDIQTPDVNIEGPDAKLKMPKMKMPKIGFSGPKLHGPDVDLDLSLPKVKGGIDVSGPKIEGGVKVPNVDVNVDSPDINLE----------GPESKLKFPKMPKFGFSGPNIHGPDVDFDIAAPKLDINVKGLKMEGDVDIP------HLDIEGPEGKIK--------GPNMKLPSISGPKVSA------PDLDMNIKMPKFKGGVDVSGPKLEGDVHV 1672          

HSP 8 Score: 61.2326 bits (147), Expect = 2.087e-10
Identity = 87/334 (26.05%), Postives = 144/334 (43.11%), Query Frame = 1
Query:   97 LDINLP----DWKLPKFEGKLKKPKGALDVEAPDIDV---DIHGKKPKGEIDLNVKNPNVDID---FHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL-----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQG----KKHKGDIDVHLSIPEVDIDVDGKK 1041
            +D+N P    D   PKF+G +K   G LD++ PD+++   D   K PK      +K P +       H PD+D+++ +   K K G+D + P     K EG +K P  ++     DI++ GPE  +        G      + PD++ DI  P +DI + G K +  ++I    ++G + + KG   K     G K  + D+D++ K  +  G + V  P              K  G D+++P+                VDLD+  P++D  G                D  ++ P   +   G    K H  D+D  LS+P+ D+D+ G K
Sbjct: 1458 VDVNPPTADVDISSPKFKGDIKGSAGGLDIQTPDVNIEGPDAKLKMPK------MKMPKIGFSGPKLHGPDVDLDLSL--PKVKGGIDVSGP-----KIEGGVKVPNVDVNVDSPDINLEGPESKLKFPKMPKFGFSGPNIHGPDVDFDIAAPKLDINVKGLKMEGDVDIPHLDIEGPEGKIKGPNMKLPSISGPKVSAPDLDMNIKMPKFKGGVDVSGP--------------KLEG-DVHVPD----------------VDLDVEAPDVDLHGP---------------DAKLKFPKMKMPKFGFSGPKLHGPDVDFDLSLPKADVDIAGPK 1732          

HSP 9 Score: 54.299 bits (129), Expect = 2.715e-8
Identity = 91/354 (25.71%), Postives = 148/354 (41.81%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGA---LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEG-----KLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVD-------LGVKTPSIDIDIDGKKHRISGDLSVD----KPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXX-------------IDVNVEVPDASIDIQGKKHKGDI---DVHLSIPEVDIDVDGKKKKHGF 1056
              +P +KLPKF     +  G+   LD++ P  DV+I   K    +D+NVK PN+  D   PD+D+E          G   N+P+   PK  G     + KKP G+  + + GP         + K NV V    P +++D+  PD++++  +GK K   + +      G    G      S+VD       L V  P +++D+ G K  + GD+SV     +         ++   + K G+D++ P  +              VDLD+  P++D  G   K K                       DVN+      +++ G K +GD+   DV L +   D+D+ G   K  F
Sbjct:  182 FQMPKFKLPKFGISGPQIHGSDANLDIDIPKGDVNISAPK----MDMNVKGPNLQGDISVPDVDVE---GPDWNIKGPTINMPNISGPKISGSDVNLEFKKPSGKGALGVSGP---------KFKDNVKV----PGVDLDVEAPDVNLQGPEGKFKLPKVTMPSFGFSGPNVHG------SDVDVSLPKGGLNVSVPKVNVDVKGPK--VQGDMSVPDVDIEGPDCKIKGPNIKMPQFKGGVDVSGPKVEGDVKVP-------DVDLDVEAPDVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKVKGGVEVSGPKVEGDVKVPDVDLDVEAPDVDLQGPDGKFKF 500          

HSP 10 Score: 50.8322 bits (120), Expect = 3.929e-7
Identity = 92/342 (26.90%), Postives = 147/342 (42.98%), Query Frame = 1
Query:   94 GLDINLPDWKL------PKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDL-NVKNPNVDID---FHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAK-----------GNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXX-----------IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            G +I +P +K       PK EG +K P   LDVEAPD+D+    + P G+     +K P         H PD+D +V++   K K G++ + P     K EG +K P  ++D+D+  P  DVD+ G   K           G      + PD++ D+  P  D +I G K +  +++    M+G  ++ KG   K     G K  + D+++D K  +  G + V  P              K  G D+ +P+                VDLD+  P++D  G   K K                    +D +V +P    DI+G K +GD    +S+P+VD+
Sbjct:  383 GPNIKMPQFKGGVDVSGPKVEGDVKVPDVDLDVEAPDVDL----QGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNL--PKVKGGVEVSGP-----KVEGDVKVP--DVDLDVEAP--DVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKMPKFKGGVDVSGP--------------KVEG-DVKVPD----------------VDLDVEAPDVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKGDGDIKGPKLEGD----MSLPDVDM 674          

HSP 11 Score: 48.521 bits (114), Expect = 1.942e-6
Identity = 101/369 (27.37%), Postives = 153/369 (41.46%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVD-IDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAK-----------GNVDVTFNKPDLEIDITKPDMDIEIDGKK-----------------KKHGINIGLPSMKGLKFEG-------KGKKPKSEVDLG-------VKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHG----IDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVH-------LSIPEVDIDVDG 1035
            HG D++  D  LPK +G +K PK   D+  PD+D+     K KG    N+K P++       PD++++V +   K K G+D + P     K EG +K P  ++D+D+  P  DVD+ G   K           G      + PD++ D+  P  D +I G K                 K  G NI +P + G K          K  K K  VD+        VK P +D+D++     + G     K           S   K HG     D+NLP       + K         +DI+ P++D  G   K K  N          +  PD ++D++  K KG +DV        L +P+VD+DV+ 
Sbjct:  766 HGPDVDF-DVNLPKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGP---NIKMPHISGPKISAPDLNLDVKM--PKFKGGVDVSGP-----KVEGDVKVP--DVDLDVEAP--DVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKMPKFKGGVDVSGPKVEGDVKVPDVDLDVEAPDVDLQGPDGKFKFPKMKMPKFGFSG-PKLHGPDVDFDVNLPKGDVNVSAPK---------VDIDLPDVDMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKMPKFKGGVDVSGPKVEGDLKVPDVDMDVEA 1109          

HSP 12 Score: 48.521 bits (114), Expect = 2.233e-6
Identity = 90/334 (26.95%), Postives = 146/334 (43.71%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVD-IDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAK-----------GNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXX-----------IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            HG D++  D  LPK +G +K PK   D+  PD+D+     K KG    N+K P++       PD++++V +   K K G+D + P     K EG +K P  ++D+D+  P  DVD+ G   K           G      + PD++ D+  P  D +I G K +  +++    M+G  ++ KG   K     G K  + D+++D K  +  G + V  P              K  G D+ +P+                VDLD+  P++D  G   K K                    +D +V +P    DI+G K +GD    +S+P+VD+
Sbjct:  516 HGPDVDF-DVNLPKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGP---NIKMPHISGPKISAPDLNLDVKM--PKFKGGVDVSGP-----KVEGDVKVP--DVDLDVEAP--DVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKMPKFKGGVDVSGP--------------KVEG-DVKVPD----------------VDLDVEAPDVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKGDGDIKGPKLEGD----MSLPDVDM 799          

HSP 13 Score: 48.521 bits (114), Expect = 2.233e-6
Identity = 90/334 (26.95%), Postives = 146/334 (43.71%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVD-IDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAK-----------GNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXX-----------IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            HG D++  D  LPK +G +K PK   D+  PD+D+     K KG    N+K P++       PD++++V +   K K G+D + P     K EG +K P  ++D+D+  P  DVD+ G   K           G      + PD++ D+  P  D +I G K +  +++    M+G  ++ KG   K     G K  + D+++D K  +  G + V  P              K  G D+ +P+                VDLD+  P++D  G   K K                    +D +V +P    DI+G K +GD    +S+P+VD+
Sbjct:  641 HGPDVDF-DVNLPKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGP---NIKMPHISGPKISAPDLNLDVKM--PKFKGGVDVSGP-----KVEGDVKVP--DVDLDVEAP--DVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKMPKFKGGVDVSGP--------------KVEG-DVKVPD----------------VDLDVEAPDVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKGDGDIKGPKLEGD----MSLPDVDM 924          
BLAST of SMED30001359 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004925.1 (pep scaffold:Pmarinus_7.0:GL480373:16762:23670:1 gene:ENSPMAG00000004465.1 transcript:ENSPMAT00000004925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.683e-10
Identity = 74/257 (28.79%), Postives = 115/257 (44.75%), Query Frame = 1
Query:   91 HGLDINL--PDWKLPKFEGK----------LKKPKGALDVEAPDIDVDIHGKKPKGEIDL---NVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKF---EGKLKKPKGELDI-------DIRGPEV-----DVDIHGNRAKGNVD-----------VTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKG-----KKPKSEV----DLGVKTPSIDIDIDGKKHRISGDLSVDKP 711
            HG D+ L  P + +PK  G           LK PKG  D+ AP+I  ++ G      IDL   ++K P ++ D   PDID++    G K K    FN+PD K+P F   + K+  P G+ D+       +I GP++     D+D+ G + K N+               + PD + D+  PD D+ I G K   GI      +K    + +G     KKPK  +       +  P++D+D+   K    GD+ +  P
Sbjct:  581 HGPDLKLKKPTFSMPKMSGPKLNAPDLDVDLKAPKGDFDISAPNIGGNVSGP----NIDLDGPDLKAPKLNADLDAPDIDLK----GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLDLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGIKTPKVDLKAPNIDLEGPDINLKKPKFSMPKISGPKLHAPNLDVDLKAPK----GDIEISAP 821          

HSP 2 Score: 60.077 bits (144), Expect = 3.974e-10
Identity = 68/216 (31.48%), Postives = 105/216 (48.61%), Query Frame = 1
Query:   94 GLDINLPDWKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKP 711
            G +I  P  K+PKF   + KL  P G  DV  PD D++I G K  G I    K P  + +   PDID++    G K K    FN+PD K+P F   +  +  P G+ D+++  P+ D++I G +  G +         ++D+  P++D+   +I+ KK K      +P + G K       P  +VDL  K P  DI       +ISG ++ +D P
Sbjct:  838 GGNIKGPHLKMPKFNISKPKLSGPDGDFDVNLPDADLNISGPKLGGGI----KAPKFNANLDAPDIDLK----GPKGK----FNMPDLKMPSFGMSKPNISGPDGDFDVNL--PDADLNISGPKLGGGIKTP------KVDLKAPNIDLDGPDINLKKPK----FSMPKISGPKLHA----PNLDVDL--KAPKGDISAPNIGGKISGPNIDLDAP 1023          

HSP 3 Score: 59.6918 bits (143), Expect = 5.711e-10
Identity = 70/220 (31.82%), Postives = 100/220 (45.45%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALD--------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFE---GKLKKPKGELDIDIRGPEVDVDIHGNRAKGNV---DVTFNKPDLEIDITKPDMDI-EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLS 699
            GLDI+ P+  +   E KLKKPK  +         V  PD+DVD+  K PKG ++L+   P V      PD D+   E  I G K            K+PKF     KL  P+G+ D+++  P+ ++DI      G +    V    P + +D+  PD+DI   D K KK   ++    M G K  G        VD+ +K P  D+DI      I G+ S
Sbjct:  154 GLDIDAPNIDVNAPEAKLKKPKLTMPKFSLSGSKVHGPDVDVDL--KSPKGNVNLSA--PKVGGKVSGPDFDLDGPEGSIKGTK-----------LKMPKFSMSKPKLSGPEGDFDVNL--PDANLDISSPNFGGKIKSPKVDLKAPKMGLDVDAPDIDIHSPDAKFKKSKFSMPKFGMSGPKIHG------PNVDVDLKAPKGDLDI--SAPNIGGNFS 348          

HSP 4 Score: 56.9954 bits (136), Expect = 4.587e-9
Identity = 77/264 (29.17%), Postives = 110/264 (41.67%), Query Frame = 1
Query:   97 LDINLPDWKL----PKFEGK-------LKKPKGALDVEAPDIDV----------------------DIHG-------KKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKH--GLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAK------GNVDVTFNKPDLEIDITKPDMDIEIDGKK--------KKHGINI-------GLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLS 699
             D+NLPD  L    P F GK       LK PK  LDV+APDID+                       IHG       K PKG++D++   PN+  +F  P+ID++      K  H     FN+   KL   +  LK PK  ++ D+  P  D+D+ G + K      G      + PD + D+  PD D+ + G K          HG ++        +P M G K          ++D+ +K P  D DI      I G+LS
Sbjct:  253 FDVNLPDANLDISSPNFGGKIKSPKVDLKAPKMGLDVDAPDIDIHSPDAKFKKSKFSMPKFGMSGPKIHGPNVDVDLKAPKGDLDISA--PNIGGNFSGPNIDLDGPGGSIKGPHLKMPKFNVAGPKLSGPDANLKAPK--MNADLEAP--DIDVKGPKGKFHMPSFGLSKPKISGPDGDFDVNLPDADLNLSGPKLDVDEPNIDLHGPDVKLKKPTFSMPKMSGPKLHA------PDLDVDLKAPKGDFDI--SAPNIGGNLS 502          

HSP 5 Score: 56.6102 bits (135), Expect = 5.767e-9
Identity = 107/403 (26.55%), Postives = 157/403 (38.96%), Query Frame = 1
Query:  118 WKLPKFE---GKLKKPKGALDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKL--PKFEGK-----LKKPKGELDI-------DIRGPEVDVDIHGNRAKG--------NV--------DVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRI--------SGDLSVDKPXXXXXXXXX---------VSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFX-----------XXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKK---HKGDIDVH----------LSIPEV--------DIDVDGKKKKHGFGINLP 1071
             K+PKF     KL  P+G  DV  PD ++DI      G+I    +++K P + +D   PDIDI    D K KK    F++P + +  PK  G      LK PKG+LDI       +  GP +D+D  G   KG        NV        D     P +  D+  PD+D++   K K H  + GL          K K    + D  V  P  D+++ G K  +          D+ + KP   +              V  K  K   DI+ PN               +++ D++ P+ID                     K K      D +V +PDA  ++ G K   +  DID+H           S+P++        D+DVD K  K  F I+ P
Sbjct:  234 LKMPKFSMSKPKLSGPEGDFDVNLPDANLDISSPNFGGKIKSPKVDLKAPKMGLDVDAPDIDIH-SPDAKFKKS--KFSMPKFGMSGPKIHGPNVDVDLKAPKGDLDISAPNIGGNFSGPNIDLDGPGGSIKGPHLKMPKFNVAGPKLSGPDANLKAPKMNADLEAPDIDVK-GPKGKFHMPSFGL---------SKPKISGPDGDFDVNLPDADLNLSGPKLDVDEPNIDLHGPDVKLKKPTFSMPKMSGPKLHAPDLDVDLKAPKGDFDISAPNIGGNLSGPNIDLDGPELNADLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPDSDFDVNLPDADFNLSGPKLGVNAPDIDLHGPDLKLKKPTFSMPKMSGPKLNAPDLDVDLKAPKGDFDISAP 623          

HSP 6 Score: 52.373 bits (124), Expect = 1.103e-7
Identity = 67/230 (29.13%), Postives = 107/230 (46.52%), Query Frame = 1
Query:    4 VNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINL--PDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKF---EGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGI-NIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKK 675
            V+LK PNID+                    G DINL  P + +PK  G    PK    + AP++DVD+  K PKG+I+++   PN+      P+ID++          G +   P  K+PKF   + KL  P G+ D+++  P+ D++I G +  G +      P    ++  PD+D++  G K K  + ++ +PS    K    G     + D  V  P  D++I G K
Sbjct:  769 VDLKAPNIDL-------------------EGPDINLKKPKFSMPKISG----PK----LHAPNLDVDL--KAPKGDIEISA--PNIGGKISGPNIDLDA--------PGGNIKGPHLKMPKFNISKPKLSGPDGDFDVNL--PDADLNISGPKLGGGIKA----PKFNANLDAPDIDLK--GPKGKFNMPDLKMPSFGMSKPNISG----PDGDFDVNLPDADLNISGPK 947          

HSP 7 Score: 51.2174 bits (121), Expect = 2.672e-7
Identity = 59/240 (24.58%), Postives = 100/240 (41.67%), Query Frame = 1
Query:  118 WKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEI------------DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG-ELDIDIRGPEVDVDIHGNRAKGNV-------------------DVTFNKPDLEIDITKP-----------DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLS 699
            + +P F   + K+  P G  DV+ PD D++I G K  G +            D+++K PN+  +   P+ID +          G +  +P  K+PKF   L K  G + D D      +V++ G + K N+                    + ++ P++E D+  P           D+D ++D K  K   +   P MK   F   G K        ++TP  +ID+DG   ++ G+ S
Sbjct: 1563 FHMPSFGMSKPKISGPDGDFDVDLPDADLNISGPKLGGGMKAPKLNSNLDTPDVHLKGPNIGGNISGPNIDFD--------GPGGNMKVPHLKMPKFNVSLPKASGPDFDADFDAESPNVNLKGPKVKTNMPNLKTPSFDVDANVPNMGGRLNYSGPNMEGDLHAPDINFRAPKGSIDLDTDLDVKGPKG--HFKGPDMKTPTFGFSGPK--------IRTPEANIDLDGSSPQVKGNYS 1784          

HSP 8 Score: 50.0618 bits (118), Expect = 5.718e-7
Identity = 75/227 (33.04%), Postives = 103/227 (45.37%), Query Frame = 1
Query:  112 PDWKLPKFEGKLKK---PKGALDVEAPDI-------DVDIHG--KKPKG-EIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPK--FEG-KLKKPKGELDIDIRGPEVDVDIHGNRAKGNVD-----VTFNKPDLEIDITKPDMDIE-IDGKKKKHGIN-----IGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISG 690
            P +KLPKF    KK   P   +D+  P+I       DV+I G  K PK   +D+N+++PN+DI              G  KK         +K PK  F G K K P  +LD+    P  ++D+     KGN+D     V F  PD+ +D   PD DI+  D K KK  I+     I  P + G  F+   K PK   D  V TP I       ++D+DG +  I G
Sbjct: 1094 PKFKLPKFGTAGKKISVPDLNVDLNTPNIKGAASIPDVNIEGGLKTPKTPALDINMESPNIDI----------TGPHGTLKKS-------KFKFPKVGFSGSKAKAPTADLDM----PNPNLDMKMPNMKGNIDLKSPNVDFKAPDIGLDANAPDFDIQGPDLKLKKPKISMPKFGISGPKLHGPDFDVDLKAPKGNFD--VSTPKIGGKLSGPNLDLDGPEAGIKG 1297          

HSP 9 Score: 50.0618 bits (118), Expect = 6.518e-7
Identity = 77/242 (31.82%), Postives = 112/242 (46.28%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPK--FEG-KLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPK------GELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKK-HGINIGLPSMK-GLKFEG-----KGKK-PKSEVDLGVKTPSIDIDIDGKK 675
            D+N++ PNID+                   HG  +    +K PK  F G K K P   LD+  P++D+ +   K  G IDL  K+PNVD  F  PDI             GLD N PD+ +   + KLKKPK      G     + GP+ DVD+     KGN DV+   P +   ++ P++D  +DG +    G N+ +P+      F+      KG K P  + D+G+  P  D++I G K
Sbjct: 1146 DINMESPNIDITGP----------------HGT-LKKSKFKFPKVGFSGSKAKAPTADLDMPNPNLDMKMPNMK--GNIDL--KSPNVD--FKAPDI-------------GLDANAPDFDIQGPDLKLKKPKISMPKFGISGPKLHGPDFDVDLK--APKGNFDVS--TPKIGGKLSGPNLD--LDGPEAGIKGPNLKMPTFNVNANFDAPDVDLKGPKGPDGDFDVGL--PDADLNISGPK 1343          

HSP 10 Score: 48.9062 bits (115), Expect = 1.659e-6
Identity = 52/177 (29.38%), Postives = 78/177 (44.07%), Query Frame = 1
Query:  118 WKLPKF---EGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKL------------PKFEGKLKKPKGEL-----DIDIRGPEV-----DVDIHGNRAK------GNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGI 555
            + +P F   + K+  P G  D + PD D++I G K  G++    K P V+ +F  PD+D++     K K H   F +   K+            PK  G LK PK        D+D++GP+      DVD+ G + K      G      + PD + D   PD D+ I G K   G+
Sbjct: 1371 FHMPSFGMSKPKISGPDGDFDADLPDADLNISGPKLGGDL----KAPKVNANFDAPDVDLKGP---KGKFHMPSFGMSKPKISGPDDADLNISGPKLGGDLKAPKVNANFDAPDVDLKGPKANFDAPDVDLKGPKGKFHMPSFGMSKPKISGPDGDFDADLPDADLNISGPKLGGGM 1540          
BLAST of SMED30001359 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010813.1 (pep scaffold:Pmarinus_7.0:GL477610:65266:75627:1 gene:ENSPMAG00000009796.1 transcript:ENSPMAT00000010813.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 1.168e-9
Identity = 66/257 (25.68%), Postives = 104/257 (40.47%), Query Frame = 1
Query:  121 KLPKFEGKLKKPKGALDVEAPDIDVD------IHGKKPKGEID-------LNVKNPNVDIDFHKPDIDIE-VDIDGK-------------KKKHG----LDFNLPDWK------LPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG-------------NVDVTFNKPDLEIDITKPDMDIEIDG---------------KKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDL 696
             LPK EG+ K P   + VE PD++        ++   PK +ID       L+V  P V +D   PD+++   D  GK              K H     LDF  P +K       PK EG ++ P    D+D +GP+VDV + G   +G               D+  + PD ++D++ P++ +++D                K K    +I  P M         K P  +   G+ TP ++ DI G    + G+ 
Sbjct:  603 SLPKLEGEFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPDAQLDVSAPEVKVDLDAPDLNVSGPDAHGKGFKLKMPDFHISGPKMHAPDVSLDFKAPHFKTKGGIATPKLEGDIQGP----DLDFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPDAQLDVSAPEVKVDLDAPDLNVSGPDAHGKGFKLKMPDFHISGPKMHAPDVSLDFKAPHFKTKGGISTPKLEGDIQGPDVDLEGEF 855          

HSP 2 Score: 56.9954 bits (136), Expect = 3.810e-9
Identity = 107/408 (26.23%), Postives = 172/408 (42.16%), Query Frame = 1
Query:   97 LDINLPDWKL------PKFEGKLKKPKGALDVEAPDIDVD------IHGKKPKGEID-------LNVKNPNVDIDFHKPDIDIE-VDIDGK-------------KKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEG----------------------KGKKPKSEVD-------LGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASID------IQGKKHKGDIDVHL-------SIPEVDIDVDGK--------KKKHGFGINLP 1071
            LD   P +K       PK EG+ K P   + VE PD++        ++   PK +ID       L+V  P V +D   PD+++   D  GK              K H  D +L D+K P F+ K      +L+ DI+GP++D+D+  +  KG++ V  ++ D ++ +  P++D+ + G  K  G    LP ++G +F+G                          PK+++D       L V  P + +D+D     ISG  +  K       D  +S   K H  D++L ++K P F  K   S  +++ DI  P++D            + K   +DV+VE PD          +     K DIDV L       S PEV +D++           +  GF + LP
Sbjct: 1190 LDFKAPHFKTKGGIATPKLEGEFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPDAQLDVSAPEVKVDLDAPDLNVSGSDAHGKGFKLKMPDFHISGPKMHAPDVSL-DFKAPHFKTKGGISTPKLEGDIQGPDLDLDV--SLPKGDIGVPTSEFDAKVKV--PEVDLNLTGPDKLKGKGDSLPKLEG-EFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKTDIDVSLPDAQLDVSAPEVKVDLDAPDLNISGPDAHGKGFKLKMPDFHISG-PKMHAPDVSL-DFKAPHFKTKGGISTPKLEGDIQGPDLDL----------GEFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPDAQLDVSAPEVKVDLEAPDLNLSGPDARGKGFKLKLP 1579          

HSP 3 Score: 56.6102 bits (135), Expect = 5.278e-9
Identity = 69/223 (30.94%), Postives = 109/223 (48.88%), Query Frame = 1
Query:  103 INLPDWKLPKFE---GKLKKPKGALDVEAPDIDVDI----HGKKPKGEIDLNVKNPNVD------IDFHKPDIDIEV-DIDGKKKKHGLDF--NLPDWKLPKFEGKLKKPK------GELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGL-PSMKGLKFEGKGKKPKSEVDLG-VKTPSIDIDIDGKKHRISGDLS 699
             ++P+ K+PK +    KLK     +DV+ P  DVDI    H K+   + D+NV++P+V       +DF +P+ DI V  ++G KK   ++F  ++P+  +   EGK K PK      G      +G ++D D   ++     ++  N+PDLEI    PD+D+         G+++ L    KGLKF    KKPK  +    V TP + ID      +   D S
Sbjct:  265 FHMPNIKMPKIDISAPKLKSTDTNIDVKVPLTDVDISPIPHLKEKVPKADINVESPHVSQTPYVSLDFKEPETDISVPTLEGDKKGPYVEFGTDIPNVDVEGPEGKFKMPKFKMPKFGMSGQKFKGSDIDEDAMLSKP----EIEINEPDLEISANPPDVDV--------GGLDVELDMEHKGLKF----KKPKFNISAPKVNTPHVGIDFKPPHFKTKDDFS 471          

HSP 4 Score: 56.6102 bits (135), Expect = 5.278e-9
Identity = 91/368 (24.73%), Postives = 154/368 (41.85%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDV---DIHGKKPKGEI-DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG-------------NVDVTFNKPDLEIDITKPDMDIEIDG---------------KKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG---DLSVDKPXXXXX--XXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDI-DVHLS-----IPEVDIDVDGKKKKHGFGINLP 1071
            +D++LPD +L      +  P+  +D++APD++V   D HGK  K ++ D ++  P +    H PD+ ++      K K G+         PK EG ++ P  +L+ + +GP+VDV + G   +G               D+  + PD ++D++ P++ +++D                K K    +I  P M         K P  +   G+ TP ++ D  G      G   D+SV+ PD +        ++    K  ID++LP+                  LD++ PE+  D +A              D+NV  PDA     GK  K  + D H+S      P+V +D      K   GI+ P
Sbjct:  764 IDVSLPDAQL-----DVSAPEVKVDLDAPDLNVSGPDAHGKGFKLKMPDFHISGPKM----HAPDVSLDFKAPHFKTKGGI-------STPKLEGDIQGPDVDLEGEFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPDAQLDVSAPEVKVDLDAPDLNVSGPDAHGKGFKLKMPDFHISGPKMHAPDVSLDFKAPHFKTKGGIATPKLEGDNQGPDLDFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPD----------------AQLDVSAPEVKVDLDAP-------------DLNVSGPDA----HGKGFKLKMPDFHISGPKMHAPDVSLDFKAPHFKTKGGISTP 1082          

HSP 5 Score: 55.8398 bits (133), Expect = 9.860e-9
Identity = 69/236 (29.24%), Postives = 109/236 (46.19%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFE--GKLKKPK--GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFE--GKLKKPKGE--------LDIDIRGPEVDVDIHGNRAKG--------------NVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKT--PSIDIDIDGKKHRISGDLSVDK 708
            HG D++L D+K P F+  G +  PK  GA    APD+ VD+         DLN+  P+      K  +  E  I G K  HG D +L D+K P F+  G +  PK E         D+D+ GP+VDV + G   +G                D+  + P++++D++ PD+ +++D       +N+  P  +G  F  K K P+  +  G K   P + +D      +  GD+S  K
Sbjct: 1589 HGPDVSL-DFKAPHFKTKGGISTPKLEGATVPNAPDVKVDLDAP------DLNLSGPDARGKGFKLKMP-EFHISGPKM-HGPDISL-DFKAPHFKTKGGISPPKLEELDLNLTGPDVDLEGPDVDVSVEGPDVEGPDGKLKMHLNATVPKADIDVSLPEVQLDVSAPDVKVDLDAPD----LNLSGPDARGKGF--KLKMPEFHIS-GPKMHGPDVSLDFKAPHFKTKGDISTPK 1807          

HSP 6 Score: 55.0694 bits (131), Expect = 1.890e-8
Identity = 48/185 (25.95%), Postives = 91/185 (49.19%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDV---DIHGKKPKGEI-DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKG-------------NVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK 600
            +D++LPD +L      +  P+  +D++APD++V   D HGK  K ++ D ++  P +    H PD+ ++      K K G+         PK EG ++ P  +L+ + +GP+VDV + G   +G               D+  + PD ++D++ P++ +++D       +N+  P   G  F+ K
Sbjct: 1008 IDVSLPDAQL-----DVSAPEVKVDLDAPDLNVSGPDAHGKGFKLKMPDFHISGPKM----HAPDVSLDFKAPHFKTKGGI-------STPKLEGDIQGPDVDLEGEFKGPDVDVSVEGPDVEGPDGKLKMLNAPVPKADIDVSLPDAQLDVSAPEVKVDLDAPD----LNVSGPDAHGKGFKLK 1172          
BLAST of SMED30001359 vs. Ensembl Nematostella
Match: EDO33569 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRT1])

HSP 1 Score: 62.3882 bits (150), Expect = 1.013e-10
Identity = 99/344 (28.78%), Postives = 143/344 (41.57%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKL---KKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDW-----KLPKFEGKLKKPKGELD-IDIRGPEVDVDIHGNRAKGNVDVT-------FNKPDLEI--DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVD---------LGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXG------QVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            H    ++P +K+PKF+G     K   G +DVE PD       K PK E D++  + NV  D   PD +++ DI+G       D + P W     K+PKF+G   + KG+   IDI GP+ D    G   KG++D          + PD+ +  DI  PD D+   G K K      +P  KG  F GKGK    + D            K P ++ D+D     + GD+           D +V         DI+ P WKF        K           D+D + P+ D                 K+  NVEVPDAS  I+G    G     +++P+ +I
Sbjct:  132 HSHGFSMPKFKMPKFKGPSFGGKGKSGDIDVEGPDF------KGPKVEGDVDTPDINVKGDIDTPDFNVKGDIEGPD----ADIDSPGWKFKGPKMPKFKGPSFEGKGKSGHIDIEGPDFD----GPNVKGDIDTPDINLKGDIDTPDVNVKGDIDGPDADVHGPGWKFK---GPKMPKFKGPSFGGKGKSGDIDYDGPDFDGPKGPDFKGPKVEGDVDTPDINVKGDIDT--------PDFNVKGDIDGPDADIDSPGWKFKGPKMPKFKGPSFGGKGKSGDIDYDGPDFD---------------GPKVKANVEVPDAS--IKGPDIDGSAGGRINLPDANI 433          

HSP 2 Score: 61.2326 bits (147), Expect = 2.721e-10
Identity = 69/206 (33.50%), Postives = 99/206 (48.06%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKL---KKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDG-----KKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVT-------FNKPDLEI--DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVD-LGVKTPSIDIDID 666
             ++P +K+PKF+G     +   G +DVE PD       K PK + D++  + N+  D   PD +++ DIDG       K   +D   PD+K PK +G +  P    DI+++GP+ D    G   KGN+D          + PD+ +  DI  PD DI   G K K      +P  KG  F GKGK    EV+    K P +  DID
Sbjct:  459 FSMPKFKMPKFKGPSFGGQGKSGDIDVEGPDF------KGPKVKGDVDTPDINLKGDIDTPDFNVKGDIDGPDADINGKSADIDVEGPDFKGPKVKGDVDIP----DINLKGPDFD----GPNVKGNIDTPNIISTGDIDTPDVNVKGDIDGPDADIHGPGWKFK---GPKMPKFKGPSFGGKGKSGDIEVEGPEFKGPKVKGDID 647          

HSP 3 Score: 56.9954 bits (136), Expect = 7.056e-9
Identity = 74/221 (33.48%), Postives = 95/221 (42.99%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKP----KGAL---------DVEAPDIDVDIHGKKPKGEIDLNVKNPNV-------DIDFHKPDID-------IEV--------DIDGKKKK-----HGLDFNLPDWKLPKFEGKLKKPKGEL-DIDIRGP-------EVDVDIHGNRAKGNVDVTFNKPDLEI--DITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKK 609
            +DI  PD+  P  +G +  P    KG +         D++ PD DV   G K KG      K P         DID+  PD D       +EV        DIDG         H   F++P +K+PKF+G     KG+  DID+ GP       E DVD      KG++D     PD  +  DI  PD DI+  G K K      +P  KG  FEGKGK 
Sbjct:   18 IDIEGPDFDGPNVKGDIDTPDINLKGDIDTPDVNVKGDIDGPDADVHGPGWKFKGPKMPKFKGPTFGGKGKSGDIDYDGPDFDGPKVKANVEVPDASIKGPDIDGSAGGDSDDDHSHGFSMPKFKMPKFKGPSFGGKGKSGDIDVEGPDFKGPKVEGDVDTPDINVKGDIDT----PDFNVKGDIEGPDADIDSPGWKFK---GPKMPKFKGPSFEGKGKS 231          

HSP 4 Score: 51.9878 bits (123), Expect = 2.181e-7
Identity = 69/218 (31.65%), Postives = 94/218 (43.12%), Query Frame = 1
Query:  109 LPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDID-------GKKKKHGLDFNLPDW-----KLPKFEGKLKKPKGEL-DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKK---KKHGINIG---LPSMKGLKFEGKGKKPKSEVD-LGVKTPSIDIDIDGKKHRISGDLSV 702
            +P +K P FE K K   G +D+E PD D                  PNV  D   PDI+++ DID       G       D + P W     K+PKF+G     KG+  DID  GP+ D    G + K NV+V    PD    I  PD+D    G       HG ++    +P  KG  F GKGK    +V+    K P ++ D+D     + GD+  
Sbjct:    1 MPKFKGPSFERKGKS--GHIDIEGPDFD-----------------GPNVKGDIDTPDINLKGDIDTPDVNVKGDIDGPDADVHGPGWKFKGPKMPKFKGPTFGGKGKSGDIDYDGPDFD----GPKVKANVEV----PDAS--IKGPDIDGSAGGDSDDDHSHGFSMPKFKMPKFKGPSFGGKGKSGDIDVEGPDFKGPKVEGDVDTPDINVKGDIDT 189          

HSP 5 Score: 50.447 bits (119), Expect = 6.838e-7
Identity = 62/175 (35.43%), Postives = 85/175 (48.57%), Query Frame = 1
Query:  109 LPDWKLPKFEGKLKKPKGALDVEAPDID----VDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDW-----KLPKFEGKLKKPKGEL-DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKG 603
            +P +K P F GK K   G +D + PD D     D  G  PK E D++  + NV  D   PD +++ DIDG       D + P W     K+PKF+G     KG+  DID  GP+ D    G + K NV+V    PD    I  PD+D    G+     IN+   ++KG  F+ KG
Sbjct:  291 MPKFKGPSFGGKGKS--GDIDYDGPDFDGPKGPDFKG--PKVEGDVDTPDINVKGDIDTPDFNVKGDIDGPD----ADIDSPGWKFKGPKMPKFKGPSFGGKGKSGDIDYDGPDFD----GPKVKANVEV----PDAS--IKGPDIDGSAGGR-----INLPDANIKGPGFKIKG 442          
BLAST of SMED30001359 vs. Ensembl Medaka
Match: AHNAK (AHNAK nucleoprotein [Source:NCBI gene;Acc:101161979])

HSP 1 Score: 84.7297 bits (208), Expect = 2.136e-17
Identity = 104/339 (30.68%), Postives = 160/339 (47.20%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLD--FNLPDWKLPKFEGKLKKPKG---------------ELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K    LD  F +P +K+P F  K  K +G                 D+DI  P+V ++   ++ KG     FN P +  ++++ PD+D  + G K K  IN  LP     K EG  K P    DL +K P  D++IDG K  I G     K P   +       +K +   +D+NLP+      +          D+DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct:  604 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKVGGDLDGGFKMPKFKMPTFGSKSHKLEGPDVDVNLPSKNIEVKTPDMDIALPDVGIEGPDSKFKGP---KFNMPKMPGMNVSMPDVDFNLKGPKLKGDINASLP-----KIEGDIKAP----DLDIKGP--DVNIDGTKLDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 915          

HSP 2 Score: 82.4185 bits (202), Expect = 9.906e-17
Identity = 102/331 (30.82%), Postives = 156/331 (47.13%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDL--SVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI+V +     K      +P +K+P F  K  K +G          DID++ P+V     DVDI G+ AK      FN P +  ++++ PD+D  + G K K  I+  LP     K EG  K P    DL +K P  D++IDG K  + GDL      P   +      S+K +   +D+NLP+      +          D+DI  P++  +G   K K    +      +NV +PD   +++G K KGDI+  L   E DI
Sbjct:  484 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVKMPSLNIKGPKMEKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP-----KIEGDMKTP----DLDIKGP--DVNIDGTK--VGGDLDGGFKMPKFKMPTFGSKSHKLEGPDVDVNLPSKNIEVKTP---------DMDIALPDVGIEGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKLKGDINASLPKIEGDI 789          

HSP 3 Score: 81.6481 bits (200), Expect = 2.150e-16
Identity = 101/338 (29.88%), Postives = 161/338 (47.63%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFN----LPDWKLPKFEGKLKKPKG--------ELDIDIRGPEV-----DVDIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG   K G +      +P +K+P F  K  K +G          DID++ P+V     DVDI G+ AK      FN P +  ++++ PD+D  + G K K  I+  LP     K EG  K P  ++D+ VK PS++         I G      P   +       +K +   +D+NLP+                 D+DI  P++D  G+  K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct:  359 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDG--TKAGFEMPKVKIMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP-----KIEGDMKTP--DLDIKVKMPSLN---------IKGPKMEKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVP---------DVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 664          

HSP 4 Score: 73.1738 bits (178), Expect = 1.172e-13
Identity = 101/369 (27.37%), Postives = 157/369 (42.55%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEID--------------LNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV-----DIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD-------IDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID              L++K P+++ D   PD+DI   E+DI+G K      F +P +K+P F  K  K +G          DI+++ P+VD+     DI G  AK      FN P +  ++++ PD+D  + G K K  I+  LP     K EG  K P    DL +K P  D++IDG K           P   +       +K +   +D+NLP+                 D+D+  P                      DV++  PD  I     K KG          +++S+P+VD ++ G K K     +LP
Sbjct:  224 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKGPDIEGDIKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP-----KIEGDMKTP----DLDIKGP--DVNIDGTKAGFEMPKVKIMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIDVKVP----------------------DVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 538          

HSP 5 Score: 63.929 bits (154), Expect = 1.262e-10
Identity = 95/348 (27.30%), Postives = 150/348 (43.10%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV-----DIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
              +P  K+P     +K PK    +E P+ D+ + G K  G  DL+VK P ++ D   PD+DI   E+DI+G K      F +P +K+P F     K +G          DI+++ P+VD+     DI G  AK      FN P +  ++++ PD+D  + G K K  I+  LP     K EG  K P    DL +K P I       D+DI G +  I G     K P   +       +K +   +D+NLP+                 D+++  P++D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct:  119 FEMPKVKMPSLN--IKGPK----MEKPEFDLKLKGPKVGG--DLDVKVPKIEGDLKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP-----KIEGDMKTP----DLDIKGPDIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPDVDITAP---------------DFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 413          

HSP 6 Score: 63.5438 bits (153), Expect = 1.320e-10
Identity = 87/314 (27.71%), Postives = 137/314 (43.63%), Query Frame = 1
Query:  172 VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGK---LKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +E P  D+ + G K  G  DL+VK P ++ D   PD+DI   E+DI+G K      F +P +K+P F  K   L+ P  + DID   P+++ D+         D+    PD+ ID TK   ++    K K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+                 D+++  P++D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct:   11 MEKPQFDLKLKGPKVGG--DLDVKAPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVKGDIDASLPKIEGDMK------TPDLDIKGPDVNIDGTKAGFEMP---KVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPS----------------TDIEVKAPDVDITAP---------------DFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 278          

HSP 7 Score: 61.2326 bits (147), Expect = 9.328e-10
Identity = 120/428 (28.04%), Postives = 175/428 (40.89%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEI------------------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNRA--------------------KGNVDVTFNKPDLE-----IDITKPDMDIEIDGKKKKHGINIGLPSMKGLK-------FEGKGKKPKSEVDLG-------VKTPSIDI--------------DIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP I       DVDI G +     PKG                          D++   P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       D++ P+VD+     DI G +                       +VDV     D+E     +DIT PD DI+    K K G    +P M G+        F  KG K K ++D         +KTP +DI              DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct:    4 LNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVKGDIDASLPKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKGPDIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 419          
BLAST of SMED30001359 vs. Ensembl Medaka
Match: AHNAK (AHNAK nucleoprotein [Source:NCBI gene;Acc:101161979])

HSP 1 Score: 83.5741 bits (205), Expect = 5.884e-17
Identity = 110/355 (30.99%), Postives = 166/355 (46.76%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP I       DVDI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 3318 LNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 3659          

HSP 2 Score: 80.8777 bits (198), Expect = 3.806e-16
Identity = 109/353 (30.88%), Postives = 161/353 (45.61%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            L+I  P  + P+F+ KLK PK  G LDV+ P I       DVDI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  + + K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P++D  G   K K    +      +NV +PD   +++G K KGDID  L   E DI
Sbjct:  900 LNIKGPKMEKPEFDIKLKGPKAVGDLDVKGPKIEEDIEAPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPELDLKLKGPKVGGDLDVKAPKIEGEIKTPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDI 1241          

HSP 3 Score: 80.4925 bits (197), Expect = 5.575e-16
Identity = 110/367 (29.97%), Postives = 164/367 (44.69%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDID--------------VDIHGKK-----PKGEI-------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDL--------SVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            L+I  P  + P+F+ KLK PK  G LDV+AP I+              +DI G+K     PK ++             D++V  P+ DID   PD+DI   +VDI G   K    F  P + +PK  G          +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+    + K K PK   DL VKTP+ID DI     +I G              P   +      S+K +   +D+NLP+      +          D+DI  P++  +G   K K    +      +NV +PD   +++G K KGDI+  L   E DI
Sbjct: 4062 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAK----FKGPKFNMPKMPG----------MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKSPKMEKPDVDIKLKGPKVGGDLDVKTPNIDGDIKALDGKIGGATVGIKGSKGGFKMPKFKMPTFGSKSHKLEGPDVDVNLPSKNIEVKTP---------DMDIALPDVGIEGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKLKGDINASLPKIEGDI 4403          

HSP 4 Score: 80.1073 bits (196), Expect = 8.091e-16
Identity = 108/363 (29.75%), Postives = 166/363 (45.73%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDIDVDIHGKKPK---GEIDLNVKNP----------------------NVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP I+ DI  K P    GE +L+++ P                        D+D + P  DIEV      K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          ++DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 3132 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDI--KAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV------KAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------EVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 3473          

HSP 5 Score: 79.7221 bits (195), Expect = 9.615e-16
Identity = 109/355 (30.70%), Postives = 165/355 (46.48%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+ P I       DVDI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 3504 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKIPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 3845          

HSP 6 Score: 79.337 bits (194), Expect = 1.174e-15
Identity = 111/402 (27.61%), Postives = 170/402 (42.29%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVD-----------------------------IHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG----------------------ELDIDIRG----------------------PEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSID-------IDIDGKKHRISGDL-SVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            D  LPK EG +K P   LD++ PD+++D                             +  K PK   DL+VK PN++ D   PD+DI   E+DI+G+K      F +P +K+P F  K  K +G                        D+DI+G                      P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I+       +DI G +  I G       P   +       +K +   +D+NLP+                 D+DI  P++D  G+  K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 3835 DASLPKIEGDMKTPD--LDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKFKGPKVGGDLDVKVPNIEGDLKTPDVDIGGAELDIEGQKG----GFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVP---------DVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 4217          

HSP 7 Score: 77.7962 bits (190), Expect = 4.918e-15
Identity = 106/355 (29.86%), Postives = 164/355 (46.20%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDIDVDIHG------------KKPKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP+I+ DI              + PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI   +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 2946 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 3287          

HSP 8 Score: 77.411 bits (189), Expect = 6.111e-15
Identity = 109/361 (30.19%), Postives = 162/361 (44.88%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNV----------DIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP+I       D+DI G +     PKG   +   K P            D+D + P  DIEV      K   +D   PD  +   + KLK PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+   K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          ++DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID  L   E D++ 
Sbjct: 4992 LNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDLNLPSTDIEV------KAPDVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKMEKPEFDINLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGAKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------EVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMNT 5335          

HSP 9 Score: 77.0258 bits (188), Expect = 6.874e-15
Identity = 110/369 (29.81%), Postives = 167/369 (45.26%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHG-----KKPKGEI--------------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+ P I       DVDI G     + PKG                      D++V  P+ DI+   P++DI   + DI G   K    F  P + +PK  G          +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P+I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P++D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 4806 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGADLDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAK----FKGPKFNMPKMPG----------MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDLNLPSTDIEVKAP---------DVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 5147          

HSP 10 Score: 75.485 bits (184), Expect = 2.329e-14
Identity = 105/355 (29.58%), Postives = 165/355 (46.48%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDIDVDIHG------------KKPKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP I+ DI              + PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  + + K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          ++DI  P++D  G   K K    +      +NV +PD  ++++G K KGDID   S+P+++ D+
Sbjct: 1830 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPELDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAP---------EVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDLNLKGPKVKGDIDA--SLPKIEGDM 2171          

HSP 11 Score: 74.3294 bits (181), Expect = 6.341e-14
Identity = 106/377 (28.12%), Postives = 169/377 (44.83%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGK-------------------LKKPKGEL---DIDIRGPE----------------------VDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
              +P  K+P     +K PK    +E P++D+ + G K  G  DL+VK P ++ D   PD+DI   E+DI+G K      F +P +K+P F  K                   +K P+ ++   D+DI+GP+                      VD+++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI   +  I G  +  K P   +       +K +   +D+NLP+      +          ++DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 2006 FEMPKVKMPSLN--IKGPK----MEKPELDLKLKGPKVGG--DLDVKVPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDLNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPKIEGDIKAPDVDIGEAEMDIEGQKAGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------EVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 2357          

HSP 12 Score: 73.9442 bits (180), Expect = 7.002e-14
Identity = 111/368 (30.16%), Postives = 163/368 (44.29%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEI--------------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKH-GLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            L+I  P  ++P  + KLK PK  G LDV+AP I       DVDI G +     PKG                      D+++  P+ DI+   PD+DI   +VD+ G   K  G  FN+P  K+P              +++  P+VD ++ G + KG+ + +   P+++ DI  PD+DI+     IDG K        K   INI  P M+  + + + K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +DINLP+      +          D+DI  P++D  G   K K    +      +NV +PD   +++G K KGDID  L   E DI
Sbjct: 1272 LNIKGPKMEMPDVDIKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDTEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDITAPDVDMKGPDTKFKGTKFNMP--KMP-------------GMNVSMPDVDFNLKGPKVKGDKEASL--PNIKGDIKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSINIKGPKMEKPEVDIRLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAP---------DVDITAPDVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDI 1613          

HSP 13 Score: 73.1738 bits (178), Expect = 1.426e-13
Identity = 105/377 (27.85%), Postives = 162/377 (42.97%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV------------------------------------DIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
              +P  K+P     +K PK    +E PD+D+ + G K  G  DL+VK P ++ D   PD+DI   E+D +G K      F +P +K+P F  K  K +G          DI+++ P+VD+                                    ++ G + KG++D +   P +E DI  PD+DIE     I G K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI   +  I G     K P   +       +K +   +D+NLP+      +          ++DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 1634 FEMPKVKMPTLN--IKGPK----MEMPDVDIKLKGPKVGG--DLDVKAPKIEGDIKAPDVDIGGAELDTEGPKG----GFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDIAAPHVDIKGPDSKFKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKAPDLDIEGPDVNIGGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------EVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 1985          

HSP 14 Score: 72.0182 bits (175), Expect = 3.444e-13
Identity = 107/372 (28.76%), Postives = 169/372 (45.43%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASID---IQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ KLK PK  G LDV+AP+I       D+DI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P+I       D+DI G +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   DV+++ PDA +        K +G   +++S+P+VD ++ G K K     +LP
Sbjct: 4434 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDVNLPSP----------------DIEVKAPEVDIAAP---------------DVDIKGPDAKLKGPKFNMPKMQG---MNVSMPDVDFNLKGPKVKGDIDASLP 4769          

HSP 15 Score: 70.0922 bits (170), Expect = 1.277e-12
Identity = 89/290 (30.69%), Postives = 130/290 (44.83%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNRA--------------KG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            DVNL  P+I+V   +                 +DI  PD  +   + KLK PK        ++V  PD+D+++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +A              KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 2096 DVNLPSPDIEVKAPE-----------------VDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDLNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPKIEGDIKAPDVDIGEAEMDIEGQKAGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 2359          

HSP 16 Score: 68.9366 bits (167), Expect = 3.641e-12
Identity = 106/369 (28.73%), Postives = 163/369 (44.17%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKP-----XXXXXXXXXVSNKKKKHG--IDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ KLK PK  G LDV+AP+I       D+DI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD  +   + KLK PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I+ DI      I G DL ++ P          +    S   K  G  +D+NLP+                 D+++  PE+D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct: 4620 LNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAPDVDIKGPDAKLKGPKFNMPKMQGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGADLDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 4955          

HSP 17 Score: 68.5514 bits (166), Expect = 4.239e-12
Identity = 79/258 (30.62%), Postives = 121/258 (46.90%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P++D+     DI G +              +KG      +VDV    PD+     E+DI  PD+DI+    K K G    +P M+G+           +VD  +K P +  DID    +I GD+  
Sbjct: 4529 VDITAPDFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAPDVDIKGPDAKLK-GPKFNMPKMQGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 4777          

HSP 18 Score: 68.5514 bits (166), Expect = 4.277e-12
Identity = 67/201 (33.33%), Postives = 103/201 (51.24%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI 663
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K      F +P  K+P     +K PK      +  PE D+   G +  G++DV    P++E D+  PD+DI   E+D + +K G    +P  K   F  KG K +   D+ V  PS DID+
Sbjct: 3785 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKFKGPKVGGDLDVKV--PNIEGDLKTPDVDIGGAELDIEGQKGGFR--MPKFKMPTFGSKGHKLEGP-DVDVNLPSTDIDV 3966          

HSP 19 Score: 68.5514 bits (166), Expect = 4.762e-12
Identity = 111/377 (29.44%), Postives = 170/377 (45.09%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHG------------KKPKGEI-------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKKKKHGI-NIGLPSM--KGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD-------IDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ K K PK  G LDV+ P+I       DVDI G            + PK ++             D++V  P+ DID   PD+DI   +VDI G   K    F  P + +PK  G          +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K    +  + +PS+  KG K E      K E DL +K P +  D+D K  +I GD+   K         ++  + +K G    +P +K P F +K  K +G  D+D+N P  D D                 DV++  PD  I     K KG          +++S+P+VD ++ G K K     +LP
Sbjct: 3876 LNIKGPKMEKPEFDLKFKGPKVGGDLDVKVPNIEGDLKTPDVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAK----FKGPKFNMPKMPG----------MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKME------KPEFDLKLKGPKVGGDLDVKAPKIEGDI---KAPVVDIGGAELDIEGQKGGF--RMPKFKMPTFGSKGHKLEGP-DVDVNLPSTDIDVKVP-------------DVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 4211          

HSP 20 Score: 68.1662 bits (165), Expect = 5.254e-12
Identity = 80/258 (31.01%), Postives = 119/258 (46.12%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 3227 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 3475          

HSP 21 Score: 68.1662 bits (165), Expect = 5.593e-12
Identity = 102/391 (26.09%), Postives = 161/391 (41.18%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV------------------------------------DIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
              +P  K+P     +K PK    +E P+ D+ + G K  G  DL+VK P ++ D   PD+DI   E+DI+G+K      F +P +K+P F  K  K +G          DI+++ PEVD+                                    ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct: 2192 FEMPKVKMPSLN--IKGPK----MEKPEFDLKLKGPKIGG--DLDVKAPKIEGDIKAPDVDIGEAEMDIEGQK----AGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 2537          

HSP 22 Score: 67.781 bits (164), Expect = 6.808e-12
Identity = 80/258 (31.01%), Postives = 119/258 (46.12%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 2297 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 2545          

HSP 23 Score: 67.781 bits (164), Expect = 6.808e-12
Identity = 80/258 (31.01%), Postives = 119/258 (46.12%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDLE-----IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+E     +DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 3599 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKIPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 3847          

HSP 24 Score: 67.781 bits (164), Expect = 8.436e-12
Identity = 80/258 (31.01%), Postives = 119/258 (46.12%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 2669 VDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 2917          

HSP 25 Score: 67.781 bits (164), Expect = 8.436e-12
Identity = 80/258 (31.01%), Postives = 119/258 (46.12%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDLE-----IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+E     +DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 3041 VDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 3289          

HSP 26 Score: 67.3958 bits (163), Expect = 9.391e-12
Identity = 101/369 (27.37%), Postives = 160/369 (43.36%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDIDVDIHG------------KKPKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ KLK PK  G LDV+AP+I+ DI              + PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI   +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct: 2574 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 2909          

HSP 27 Score: 66.2402 bits (160), Expect = 2.251e-11
Identity = 79/257 (30.74%), Postives = 117/257 (45.53%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKGN----VDVTFNKPDLEIDITKPDMDI-----EIDGKKKKH-GINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P VD+     DI G +              +KG+     DV  N P  +ID+  PD+DI     +I G   K  G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 3971 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 4219          

HSP 28 Score: 65.855 bits (159), Expect = 3.187e-11
Identity = 76/258 (29.46%), Postives = 115/258 (44.57%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEV-------DVDIHGNR---------------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+I+ ++  P ++ D   P++DI   +V+IDG K        K   L+   P  + P+F+ KLK PK   D+D++GP++       DVDI G                       +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct:  809 VDIAAPDVDIEGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIETSL--PKIEGDIKTPNLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDIKLKGPKAVGDLDVKGPKIEEDIEAPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGSDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 1057          

HSP 29 Score: 65.4698 bits (158), Expect = 3.675e-11
Identity = 77/258 (29.84%), Postives = 116/258 (44.96%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNRA--------------------KGNVDVTFNKPDLE-----IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       D++ P+VD+     DI G +                       +VDV     D+E     +DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 3413 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 3661          

HSP 30 Score: 65.0846 bits (157), Expect = 5.944e-11
Identity = 79/258 (30.62%), Postives = 118/258 (45.74%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 2483 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 2731          

HSP 31 Score: 65.0846 bits (157), Expect = 5.944e-11
Identity = 79/258 (30.62%), Postives = 118/258 (45.74%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 2855 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 3103          

HSP 32 Score: 64.6994 bits (156), Expect = 6.914e-11
Identity = 106/384 (27.60%), Postives = 160/384 (41.67%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEI--------------------DLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKH-GLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  ++P  + KLK PK  G LDV+AP I       DVDI G +     PKG                      D+++  P+ DI+   PD+DI    VDI G   K  G  FN+P  K+P              +++  P+VD ++ G + KG++D +   P +E DI  PD+DIE     I G K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI   +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   D +++ PD+              +++S+P+VD ++ G K K     +LP
Sbjct: 1644 LNIKGPKMEMPDVDIKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDTEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDIAAPHVDIKGPDSKFKGTKFNMP--KMP-------------GMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKAPDLDIEGPDVNIGGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 1979          

HSP 33 Score: 64.6994 bits (156), Expect = 7.491e-11
Identity = 80/258 (31.01%), Postives = 117/258 (45.35%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDLE-----IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI LPD  +   + K K PK        ++V  PD+D ++ G K KG  D+N   P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P++D+     DI G +              +KG      +VDV     D+E     +DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 4343 MDIALPDVGIEGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKLKG--DINASLPKIEGDIKAPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNVPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 4591          

HSP 34 Score: 64.6994 bits (156), Expect = 7.901e-11
Identity = 100/344 (29.07%), Postives = 159/344 (46.22%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLP----NWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNV-------EVPDA---SIDIQGKKHK-GDIDVHLSIPEVDIDVDGKKKK 1047
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K      F +P  K+P     +K PK      +  PE+D+ + G +  G++DV    P +E +I  PD+DI   E+D +  K G    +P+ K   F  KG K +   D+ V  PS DI++      I+    VD    D        N  K  G+++++P    N K PK       S  +++ DI TP +                    DVN+       E+P     +++I+G K +  D+D+ L  P+V  D+D K  K
Sbjct:  995 VDITAPDFDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPELDLKLKGPKVGGDLDV--KAPKIEGEIKTPDVDIGGAELDIEGPKGGFK--MPTFKMPTFGSKGHKLEGP-DVDVNLPSTDIEVKAPDVDITAP-DVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDIKTPSV---------------ATKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKMEMPDVDIKLKGPKVGGDLDVKAPK 1303          

HSP 35 Score: 63.929 bits (154), Expect = 1.168e-10
Identity = 101/377 (26.79%), Postives = 161/377 (42.71%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDIDVDIHGKKPK---GEIDLNVKNP----------------------NVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ KLK PK  G LDV+AP I+ DI  K P    GE +L+++ P                        D+D + P  DIEV      K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+   D+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P+I       D+DI   +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   D +++ PD+              +++S+P+VD ++ G K K     +LP
Sbjct: 2760 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDI--KAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV------KAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 3095          

HSP 36 Score: 63.929 bits (154), Expect = 1.211e-10
Identity = 100/340 (29.41%), Postives = 163/340 (47.94%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLP----NWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNV-------EVPDA---SIDIQG-KKHKGDIDVHLSIPEVDIDVD 1032
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K      F +P  K+P     +K PK      +  PE D+ + G +  G++DV    P++E DI  PD+DI   E+D +  K G    +P  K   F  KG K +   D+ +  PS DI++      I+  D+ +  PDA +       N  K  G+++++P    N K PK       S  +++ D+ TP++D  G                DVN+       E+P     +++I+G K  K + D++L  P+V  D+D
Sbjct: 4901 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKIGGDLDV--KAPNIEGDIKTPDLDIGGAELDIEGPKGGFK--MPKFKMPTFGSKGHKWEGP-DVDLNLPSTDIEVKAPDVDIAAPDVDIKGPDAKLKGPKF--NMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKGP---------------DVNIDGTKAGFEMPKVKMPTLNIKGPKMEKPEFDINLKGPKVGGDLD 5204          

HSP 37 Score: 63.5438 bits (153), Expect = 1.973e-10
Identity = 91/344 (26.45%), Postives = 148/344 (43.02%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
              +P +K+P F  K  K      +E PD+DV++  K      ++ VK P++DI    PD+ IE    G   K    F  P + +PK  G          +++  P+VD ++ G + KG+++ +   P +E DI  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P+I       D+DI G +  I G     K P   +       +K +   +D+NLP+                 D+++  P++D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct: 4305 FKMPKFKMPTFGSKSHK------LEGPDVDVNLPSK------NIEVKTPDMDIAL--PDVGIE----GPDSK----FKGPKFNMPKMPG----------MNVSMPDVDFNLKGPKLKGDINASL--PKIEGDIKAPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPDVDITAP---------------DFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 4583          

HSP 38 Score: 63.1586 bits (152), Expect = 2.195e-10
Identity = 101/369 (27.37%), Postives = 160/369 (43.36%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ KLK PK  G LDV+ P I       DVDI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+   D+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P+I       D+DI   +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   D +++ PD+              +++S+P+VD ++ G K K     +LP
Sbjct: 2388 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 2723          

HSP 39 Score: 63.1586 bits (152), Expect = 2.315e-10
Identity = 97/327 (29.66%), Postives = 145/327 (44.34%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV-----DIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLS-----IPEV 1017
              +P  K+P     +K PK    +E P+ D+++ G K  G  DL+VK P ++ D   PD+DI   E+DI+G K      F +P +K+P F  K  K +G          DI+++ PEVD+     DI G  AK      FN P +  ++++ PD+D  + G K K  I+  LP     K EG    P    DL +K P  D++IDG K                        K K   ++I  P  + P+F  K K  K   DLD+  P+I+           +      +DV  +VP+   D +G     +ID+  S     IPE+
Sbjct: 5168 FEMPKVKMPTLN--IKGPK----MEKPEFDINLKGPKVGG--DLDVKVPKIEGDIKAPDVDIGGAELDIEGAKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP-----KIEGDMNTP----DLDIKGP--DVNIDGTKAGFE------------------MPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKIPKIE-GDIKAAGVSGSNVSLPDVDVGRKVPETQADFKGSCQFPNIDIKGSEVSSEIPEI 5451          

HSP 40 Score: 62.003 bits (149), Expect = 6.193e-10
Identity = 103/336 (30.65%), Postives = 160/336 (47.62%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEG-KLKKPK-GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLP----NWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNV-------EVPDA---SIDIQG-KKHKGDIDVHLSIPEVDIDVD 1032
            +DI  PD K   F+G K   PK   ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DIE   V+I G K      F +P  K+P     +K PK      +  PE D+ + G +  G++DV    P +E DI  PD+DI   E+D +  K G    +P  K   F  KG K +   D+ V  PS DI++   +  I+  D  +  PD+         N  K  G+++++P    N K PK       S  +++ D+ TP++D  G                DVN+       E+P     S++I+G K  K ++D+ L  P+V  D+D
Sbjct: 1746 VDIKGPDSK---FKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKAPDLDIEGPDVNIGGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDV--KAPKIEGDIKAPDVDIGRAELDIEGPKGGFK--MPKFKMPTFGSKGHKLEGP-DVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKF--NMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKGP---------------DVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPELDLKLKGPKVGGDLD 2042          

HSP 41 Score: 60.4622 bits (145), Expect = 1.729e-9
Identity = 107/377 (28.38%), Postives = 167/377 (44.30%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEI--------------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM-----DIEIDGKKKKHGI-NIGLPSM--KGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD-------IDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+ + KLK PK  G LDV+AP I       DVDI G +     PKG                      D++V  P+ DI+   PD+DI   +VD+ G   K    F  P + +PK  G          +++  P+VD ++ G + KG++D +   P +E DI  P +     D+ IDG K    +  + +P++  KG K E        +VD+ +K P +  D+D K  +I GD+   K         ++  +  K G    +P +K P F +K  K +G  D+DIN P  D +  A              DV++  PD  +     K KG          +++S+P+VD ++ G K K     +LP
Sbjct: 1086 LNIKGPKMEKPELDLKLKGPKVGGDLDVKAPKIEGEIKTPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDVDMKGPDTK----FKGPKFNMPKMPG----------MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKTPSVATKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKME------MPDVDIKLKGPKVGGDLDVKAPKIEGDI---KAPDVDIGGAELDTEGPKGGF--KMPKFKMPTFGSKGHKLEGP-DVDINLPSTDIEVKAP-------------DVDITAPDVDMKGPDTKFKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDKEASLP 1421          

HSP 42 Score: 59.6918 bits (143), Expect = 2.761e-9
Identity = 107/380 (28.16%), Postives = 166/380 (43.68%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVD-----VDIHG--NRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKG----LKFEGKG------------------------KKPKSE---VDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD-------IDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
              +P  K+P     +K PK    +E P++D+ + G K  G  DL+VK P ++ D   PD+DI   E+DI+G K      F +P +K+P F  K  K +G          DI+++ P+VD     VD+ G   + KG     FN P +  ++++ PD+D  + G K K  I+  LP ++G         KG                        K PK E   VD+ +K P +  D+D K  +I GD+   K         ++  +  K G    +P +K P F +K  K +G  D+DIN P  D +  A              DV++  P   I     K KG          +++S+P+VD ++ G K K     +LP
Sbjct: 1448 FEMPKVKMPSIN--IKGPK----MEKPEVDIRLKGPKVGG--DLDVKAPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDITAPDVDMKGPDTKFKGP---KFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDIKTPSVATKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKMEMPDVDIKLKGPKVGGDLDVKAPKIEGDI---KAPDVDIGGAELDTEGPKGGF--KMPTFKMPTFGSKGHKLEGP-DVDINLPSTDIEVKAP-------------DVDIAAPHVDIKGPDSKFKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 1793          

HSP 43 Score: 58.5362 bits (140), Expect = 6.218e-9
Identity = 52/172 (30.23%), Postives = 89/172 (51.74%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINI 561
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D + PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK   D+D++ P+++ DI   +A G      + PD+++    P+   +  G  +   I+I
Sbjct: 5273 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMNTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKIPKIEGDI---KAAGVSGSNVSLPDVDVGRKVPETQADFKGSCQFPNIDI 5439          
BLAST of SMED30001359 vs. Ensembl Medaka
Match: AHNAK (AHNAK nucleoprotein [Source:NCBI gene;Acc:101161979])

HSP 1 Score: 83.5741 bits (205), Expect = 5.884e-17
Identity = 110/355 (30.99%), Postives = 166/355 (46.76%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP I       DVDI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 3318 LNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 3659          

HSP 2 Score: 80.8777 bits (198), Expect = 3.806e-16
Identity = 109/353 (30.88%), Postives = 161/353 (45.61%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            L+I  P  + P+F+ KLK PK  G LDV+ P I       DVDI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  + + K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P++D  G   K K    +      +NV +PD   +++G K KGDID  L   E DI
Sbjct:  900 LNIKGPKMEKPEFDIKLKGPKAVGDLDVKGPKIEEDIEAPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPELDLKLKGPKVGGDLDVKAPKIEGEIKTPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDI 1241          

HSP 3 Score: 80.4925 bits (197), Expect = 5.575e-16
Identity = 110/367 (29.97%), Postives = 164/367 (44.69%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDID--------------VDIHGKK-----PKGEI-------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDL--------SVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            L+I  P  + P+F+ KLK PK  G LDV+AP I+              +DI G+K     PK ++             D++V  P+ DID   PD+DI   +VDI G   K    F  P + +PK  G          +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+    + K K PK   DL VKTP+ID DI     +I G              P   +      S+K +   +D+NLP+      +          D+DI  P++  +G   K K    +      +NV +PD   +++G K KGDI+  L   E DI
Sbjct: 4062 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAK----FKGPKFNMPKMPG----------MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKSPKMEKPDVDIKLKGPKVGGDLDVKTPNIDGDIKALDGKIGGATVGIKGSKGGFKMPKFKMPTFGSKSHKLEGPDVDVNLPSKNIEVKTP---------DMDIALPDVGIEGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKLKGDINASLPKIEGDI 4403          

HSP 4 Score: 80.1073 bits (196), Expect = 8.091e-16
Identity = 108/363 (29.75%), Postives = 166/363 (45.73%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDIDVDIHGKKPK---GEIDLNVKNP----------------------NVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP I+ DI  K P    GE +L+++ P                        D+D + P  DIEV      K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          ++DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 3132 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDI--KAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV------KAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------EVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 3473          

HSP 5 Score: 79.7221 bits (195), Expect = 9.615e-16
Identity = 109/355 (30.70%), Postives = 165/355 (46.48%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+ P I       DVDI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 3504 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKIPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 3845          

HSP 6 Score: 79.337 bits (194), Expect = 1.174e-15
Identity = 111/402 (27.61%), Postives = 170/402 (42.29%), Query Frame = 1
Query:  115 DWKLPKFEGKLKKPKGALDVEAPDIDVD-----------------------------IHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG----------------------ELDIDIRG----------------------PEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSID-------IDIDGKKHRISGDL-SVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            D  LPK EG +K P   LD++ PD+++D                             +  K PK   DL+VK PN++ D   PD+DI   E+DI+G+K      F +P +K+P F  K  K +G                        D+DI+G                      P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I+       +DI G +  I G       P   +       +K +   +D+NLP+                 D+DI  P++D  G+  K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 3835 DASLPKIEGDMKTPD--LDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKFKGPKVGGDLDVKVPNIEGDLKTPDVDIGGAELDIEGQKG----GFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVP---------DVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 4217          

HSP 7 Score: 77.7962 bits (190), Expect = 4.918e-15
Identity = 106/355 (29.86%), Postives = 164/355 (46.20%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDIDVDIHG------------KKPKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP+I+ DI              + PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI   +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 2946 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------DVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 3287          

HSP 8 Score: 77.411 bits (189), Expect = 6.111e-15
Identity = 109/361 (30.19%), Postives = 162/361 (44.88%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNV----------DIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP+I       D+DI G +     PKG   +   K P            D+D + P  DIEV      K   +D   PD  +   + KLK PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+   K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          ++DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID  L   E D++ 
Sbjct: 4992 LNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDLNLPSTDIEV------KAPDVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKMEKPEFDINLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGAKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------EVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMNT 5335          

HSP 9 Score: 77.0258 bits (188), Expect = 6.874e-15
Identity = 110/369 (29.81%), Postives = 167/369 (45.26%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHG-----KKPKGEI--------------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+ P I       DVDI G     + PKG                      D++V  P+ DI+   P++DI   + DI G   K    F  P + +PK  G          +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P+I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          D+DI  P++D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 4806 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGADLDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAK----FKGPKFNMPKMPG----------MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDLNLPSTDIEVKAP---------DVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 5147          

HSP 10 Score: 75.485 bits (184), Expect = 2.329e-14
Identity = 105/355 (29.58%), Postives = 165/355 (46.48%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDIDVDIHG------------KKPKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
            L+I  P  + P+F+ KLK PK  G LDV+AP I+ DI              + PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  + + K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+      +          ++DI  P++D  G   K K    +      +NV +PD  ++++G K KGDID   S+P+++ D+
Sbjct: 1830 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPELDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAP---------EVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDLNLKGPKVKGDIDA--SLPKIEGDM 2171          

HSP 11 Score: 74.3294 bits (181), Expect = 6.341e-14
Identity = 106/377 (28.12%), Postives = 169/377 (44.83%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGK-------------------LKKPKGEL---DIDIRGPE----------------------VDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
              +P  K+P     +K PK    +E P++D+ + G K  G  DL+VK P ++ D   PD+DI   E+DI+G K      F +P +K+P F  K                   +K P+ ++   D+DI+GP+                      VD+++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI   +  I G  +  K P   +       +K +   +D+NLP+      +          ++DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 2006 FEMPKVKMPSLN--IKGPK----MEKPELDLKLKGPKVGG--DLDVKVPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDLNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPKIEGDIKAPDVDIGEAEMDIEGQKAGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------EVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 2357          

HSP 12 Score: 73.9442 bits (180), Expect = 7.002e-14
Identity = 111/368 (30.16%), Postives = 163/368 (44.29%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEI--------------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKH-GLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI 1023
            L+I  P  ++P  + KLK PK  G LDV+AP I       DVDI G +     PKG                      D+++  P+ DI+   PD+DI   +VD+ G   K  G  FN+P  K+P              +++  P+VD ++ G + KG+ + +   P+++ DI  PD+DI+     IDG K        K   INI  P M+  + + + K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +DINLP+      +          D+DI  P++D  G   K K    +      +NV +PD   +++G K KGDID  L   E DI
Sbjct: 1272 LNIKGPKMEMPDVDIKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDTEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDITAPDVDMKGPDTKFKGTKFNMP--KMP-------------GMNVSMPDVDFNLKGPKVKGDKEASL--PNIKGDIKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSINIKGPKMEKPEVDIRLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAP---------DVDITAPDVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDI 1613          

HSP 13 Score: 73.1738 bits (178), Expect = 1.426e-13
Identity = 105/377 (27.85%), Postives = 162/377 (42.97%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV------------------------------------DIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1029
              +P  K+P     +K PK    +E PD+D+ + G K  G  DL+VK P ++ D   PD+DI   E+D +G K      F +P +K+P F  K  K +G          DI+++ P+VD+                                    ++ G + KG++D +   P +E DI  PD+DIE     I G K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI   +  I G     K P   +       +K +   +D+NLP+      +          ++DI  P+ D  G   K K    +      +NV +PD   +++G K KGDID   S+P+++ D+
Sbjct: 1634 FEMPKVKMPTLN--IKGPK----MEMPDVDIKLKGPKVGG--DLDVKAPKIEGDIKAPDVDIGGAELDTEGPKG----GFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDIAAPHVDIKGPDSKFKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKAPDLDIEGPDVNIGGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAP---------EVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDA--SLPKIEGDM 1985          

HSP 14 Score: 72.0182 bits (175), Expect = 3.444e-13
Identity = 107/372 (28.76%), Postives = 169/372 (45.43%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASID---IQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ KLK PK  G LDV+AP+I       D+DI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P+I       D+DI G +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   DV+++ PDA +        K +G   +++S+P+VD ++ G K K     +LP
Sbjct: 4434 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDVNLPSP----------------DIEVKAPEVDIAAP---------------DVDIKGPDAKLKGPKFNMPKMQG---MNVSMPDVDFNLKGPKVKGDIDASLP 4769          

HSP 15 Score: 70.0922 bits (170), Expect = 1.277e-12
Identity = 89/290 (30.69%), Postives = 130/290 (44.83%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNRA--------------KG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            DVNL  P+I+V   +                 +DI  PD  +   + KLK PK        ++V  PD+D+++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +A              KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 2096 DVNLPSPDIEVKAPE-----------------VDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDLNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPKIEGDIKAPDVDIGEAEMDIEGQKAGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 2359          

HSP 16 Score: 68.9366 bits (167), Expect = 3.641e-12
Identity = 106/369 (28.73%), Postives = 163/369 (44.17%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKP-----XXXXXXXXXVSNKKKKHG--IDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ KLK PK  G LDV+AP+I       D+DI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD  +   + KLK PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I+ DI      I G DL ++ P          +    S   K  G  +D+NLP+                 D+++  PE+D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct: 4620 LNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAPDVDIKGPDAKLKGPKFNMPKMQGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGADLDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 4955          

HSP 17 Score: 68.5514 bits (166), Expect = 4.239e-12
Identity = 79/258 (30.62%), Postives = 121/258 (46.90%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P++D+     DI G +              +KG      +VDV    PD+     E+DI  PD+DI+    K K G    +P M+G+           +VD  +K P +  DID    +I GD+  
Sbjct: 4529 VDITAPDFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAPDVDIKGPDAKLK-GPKFNMPKMQGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 4777          

HSP 18 Score: 68.5514 bits (166), Expect = 4.277e-12
Identity = 67/201 (33.33%), Postives = 103/201 (51.24%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI 663
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K      F +P  K+P     +K PK      +  PE D+   G +  G++DV    P++E D+  PD+DI   E+D + +K G    +P  K   F  KG K +   D+ V  PS DID+
Sbjct: 3785 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKFKGPKVGGDLDVKV--PNIEGDLKTPDVDIGGAELDIEGQKGGFR--MPKFKMPTFGSKGHKLEGP-DVDVNLPSTDIDV 3966          

HSP 19 Score: 68.5514 bits (166), Expect = 4.762e-12
Identity = 111/377 (29.44%), Postives = 170/377 (45.09%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHG------------KKPKGEI-------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKKKKHGI-NIGLPSM--KGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD-------IDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ K K PK  G LDV+ P+I       DVDI G            + PK ++             D++V  P+ DID   PD+DI   +VDI G   K    F  P + +PK  G          +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K    +  + +PS+  KG K E      K E DL +K P +  D+D K  +I GD+   K         ++  + +K G    +P +K P F +K  K +G  D+D+N P  D D                 DV++  PD  I     K KG          +++S+P+VD ++ G K K     +LP
Sbjct: 3876 LNIKGPKMEKPEFDLKFKGPKVGGDLDVKVPNIEGDLKTPDVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAK----FKGPKFNMPKMPG----------MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKME------KPEFDLKLKGPKVGGDLDVKAPKIEGDI---KAPVVDIGGAELDIEGQKGGF--RMPKFKMPTFGSKGHKLEGP-DVDVNLPSTDIDVKVP-------------DVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 4211          

HSP 20 Score: 68.1662 bits (165), Expect = 5.254e-12
Identity = 80/258 (31.01%), Postives = 119/258 (46.12%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 3227 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 3475          

HSP 21 Score: 68.1662 bits (165), Expect = 5.593e-12
Identity = 102/391 (26.09%), Postives = 161/391 (41.18%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV------------------------------------DIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
              +P  K+P     +K PK    +E P+ D+ + G K  G  DL+VK P ++ D   PD+DI   E+DI+G+K      F +P +K+P F  K  K +G          DI+++ PEVD+                                    ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI G +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct: 2192 FEMPKVKMPSLN--IKGPK----MEKPEFDLKLKGPKIGG--DLDVKAPKIEGDIKAPDVDIGEAEMDIEGQK----AGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 2537          

HSP 22 Score: 67.781 bits (164), Expect = 6.808e-12
Identity = 80/258 (31.01%), Postives = 119/258 (46.12%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 2297 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 2545          

HSP 23 Score: 67.781 bits (164), Expect = 6.808e-12
Identity = 80/258 (31.01%), Postives = 119/258 (46.12%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDLE-----IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+E     +DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 3599 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKIPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 3847          

HSP 24 Score: 67.781 bits (164), Expect = 8.436e-12
Identity = 80/258 (31.01%), Postives = 119/258 (46.12%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 2669 VDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 2917          

HSP 25 Score: 67.781 bits (164), Expect = 8.436e-12
Identity = 80/258 (31.01%), Postives = 119/258 (46.12%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDLE-----IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+E     +DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 3041 VDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 3289          

HSP 26 Score: 67.3958 bits (163), Expect = 9.391e-12
Identity = 101/369 (27.37%), Postives = 160/369 (43.36%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDIDVDIHG------------KKPKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ KLK PK  G LDV+AP+I+ DI              + PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI   +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct: 2574 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 2909          

HSP 27 Score: 66.2402 bits (160), Expect = 2.251e-11
Identity = 79/257 (30.74%), Postives = 117/257 (45.53%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKGN----VDVTFNKPDLEIDITKPDMDI-----EIDGKKKKH-GINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P VD+     DI G +              +KG+     DV  N P  +ID+  PD+DI     +I G   K  G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 3971 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 4219          

HSP 28 Score: 65.855 bits (159), Expect = 3.187e-11
Identity = 76/258 (29.46%), Postives = 115/258 (44.57%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEV-------DVDIHGNR---------------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+I+ ++  P ++ D   P++DI   +V+IDG K        K   L+   P  + P+F+ KLK PK   D+D++GP++       DVDI G                       +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct:  809 VDIAAPDVDIEGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIETSL--PKIEGDIKTPNLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDIKLKGPKAVGDLDVKGPKIEEDIEAPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGSDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 1057          

HSP 29 Score: 65.4698 bits (158), Expect = 3.675e-11
Identity = 77/258 (29.84%), Postives = 116/258 (44.96%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNRA--------------------KGNVDVTFNKPDLE-----IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       D++ P+VD+     DI G +                       +VDV     D+E     +DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 3413 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 3661          

HSP 30 Score: 65.0846 bits (157), Expect = 5.944e-11
Identity = 79/258 (30.62%), Postives = 118/258 (45.74%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 2483 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 2731          

HSP 31 Score: 65.0846 bits (157), Expect = 5.944e-11
Identity = 79/258 (30.62%), Postives = 118/258 (45.74%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDL-----EIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P+VD+     DI G +              +KG      +VDV     D+     E+DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 2855 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFK-GPKFNMPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 3103          

HSP 32 Score: 64.6994 bits (156), Expect = 6.914e-11
Identity = 106/384 (27.60%), Postives = 160/384 (41.67%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEI--------------------DLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKH-GLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  ++P  + KLK PK  G LDV+AP I       DVDI G +     PKG                      D+++  P+ DI+   PD+DI    VDI G   K  G  FN+P  K+P              +++  P+VD ++ G + KG++D +   P +E DI  PD+DIE     I G K        K   +NI  P M+  +F+ K K PK   DL VK P I       D+DI   +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   D +++ PD+              +++S+P+VD ++ G K K     +LP
Sbjct: 1644 LNIKGPKMEMPDVDIKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDTEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDIAAPHVDIKGPDSKFKGTKFNMP--KMP-------------GMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKAPDLDIEGPDVNIGGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 1979          

HSP 33 Score: 64.6994 bits (156), Expect = 7.491e-11
Identity = 80/258 (31.01%), Postives = 117/258 (45.35%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPK--GELDI-------DIRGPEVDV-----DIHGNR--------------AKG------NVDVTFNKPDLE-----IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSV 702
            +DI LPD  +   + K K PK        ++V  PD+D ++ G K KG  D+N   P ++ D   PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK  G+LD+       DI+ P++D+     DI G +              +KG      +VDV     D+E     +DIT PD DI+    K K G    +P M G+           +VD  +K P +  DID    +I GD+  
Sbjct: 4343 MDIALPDVGIEGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKLKG--DINASLPKIEGDIKAPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFK-GPKFNVPKMPGMNVS------MPDVDFNLKGPKVKGDIDASLPKIEGDMKT 4591          

HSP 34 Score: 64.6994 bits (156), Expect = 7.901e-11
Identity = 100/344 (29.07%), Postives = 159/344 (46.22%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLP----NWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNV-------EVPDA---SIDIQGKKHK-GDIDVHLSIPEVDIDVDGKKKK 1047
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K      F +P  K+P     +K PK      +  PE+D+ + G +  G++DV    P +E +I  PD+DI   E+D +  K G    +P+ K   F  KG K +   D+ V  PS DI++      I+    VD    D        N  K  G+++++P    N K PK       S  +++ DI TP +                    DVN+       E+P     +++I+G K +  D+D+ L  P+V  D+D K  K
Sbjct:  995 VDITAPDFDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPELDLKLKGPKVGGDLDV--KAPKIEGEIKTPDVDIGGAELDIEGPKGGFK--MPTFKMPTFGSKGHKLEGP-DVDVNLPSTDIEVKAPDVDITAP-DVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDIKTPSV---------------ATKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKMEMPDVDIKLKGPKVGGDLDVKAPK 1303          

HSP 35 Score: 63.929 bits (154), Expect = 1.168e-10
Identity = 101/377 (26.79%), Postives = 161/377 (42.71%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDIDVDIHGKKPK---GEIDLNVKNP----------------------NVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ KLK PK  G LDV+AP I+ DI  K P    GE +L+++ P                        D+D + P  DIEV      K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+   D+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P+I       D+DI   +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   D +++ PD+              +++S+P+VD ++ G K K     +LP
Sbjct: 2760 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDI--KAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV------KAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 3095          

HSP 36 Score: 63.929 bits (154), Expect = 1.211e-10
Identity = 100/340 (29.41%), Postives = 163/340 (47.94%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLP----NWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNV-------EVPDA---SIDIQG-KKHKGDIDVHLSIPEVDIDVD 1032
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DI   +V+IDG K      F +P  K+P     +K PK      +  PE D+ + G +  G++DV    P++E DI  PD+DI   E+D +  K G    +P  K   F  KG K +   D+ +  PS DI++      I+  D+ +  PDA +       N  K  G+++++P    N K PK       S  +++ D+ TP++D  G                DVN+       E+P     +++I+G K  K + D++L  P+V  D+D
Sbjct: 4901 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKIGGDLDV--KAPNIEGDIKTPDLDIGGAELDIEGPKGGFK--MPKFKMPTFGSKGHKWEGP-DVDLNLPSTDIEVKAPDVDIAAPDVDIKGPDAKLKGPKF--NMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKGP---------------DVNIDGTKAGFEMPKVKMPTLNIKGPKMEKPEFDINLKGPKVGGDLD 5204          

HSP 37 Score: 63.5438 bits (153), Expect = 1.973e-10
Identity = 91/344 (26.45%), Postives = 148/344 (43.02%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
              +P +K+P F  K  K      +E PD+DV++  K      ++ VK P++DI    PD+ IE    G   K    F  P + +PK  G          +++  P+VD ++ G + KG+++ +   P +E DI  PD+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P+I       D+DI G +  I G     K P   +       +K +   +D+NLP+                 D+++  P++D                   D +++ PDA              +++S+P+VD ++ G K K     +LP
Sbjct: 4305 FKMPKFKMPTFGSKSHK------LEGPDVDVNLPSK------NIEVKTPDMDIAL--PDVGIE----GPDSK----FKGPKFNMPKMPG----------MNVSMPDVDFNLKGPKLKGDINASL--PKIEGDIKAPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPDVDITAP---------------DFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 4583          

HSP 38 Score: 63.1586 bits (152), Expect = 2.195e-10
Identity = 101/369 (27.37%), Postives = 160/369 (43.36%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEIDL-NVKNPNVDIDFHK---PDIDIEV-DIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGEL----DIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE-----IDGKK--------KKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSI-------DIDIDGKKHRISGDLSVDK-PXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+F+ KLK PK  G LDV+ P I       DVDI G +     PKG   +   K P      HK   PD+D+ +   D + K   +D   PD+ +   + K K PK  +     +++  P+VD ++ G + KG++D +   P +E D+   D+DI+     IDG K        K   +NI  P M+  +F+ K K PK   DL VK P+I       D+DI   +  I G     K P   +       +K +   +D+NLP+                 D+++  PE+D                   D +++ PD+              +++S+P+VD ++ G K K     +LP
Sbjct: 2388 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPS----------------TDIEVKAPEVDITAP---------------DFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 2723          

HSP 39 Score: 63.1586 bits (152), Expect = 2.315e-10
Identity = 97/327 (29.66%), Postives = 145/327 (44.34%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVDV-----DIHGNRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLS-----IPEV 1017
              +P  K+P     +K PK    +E P+ D+++ G K  G  DL+VK P ++ D   PD+DI   E+DI+G K      F +P +K+P F  K  K +G          DI+++ PEVD+     DI G  AK      FN P +  ++++ PD+D  + G K K  I+  LP     K EG    P    DL +K P  D++IDG K                        K K   ++I  P  + P+F  K K  K   DLD+  P+I+           +      +DV  +VP+   D +G     +ID+  S     IPE+
Sbjct: 5168 FEMPKVKMPTLN--IKGPK----MEKPEFDINLKGPKVGG--DLDVKVPKIEGDIKAPDVDIGGAELDIEGAKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFK-GPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP-----KIEGDMNTP----DLDIKGP--DVNIDGTKAGFE------------------MPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKIPKIE-GDIKAAGVSGSNVSLPDVDVGRKVPETQADFKGSCQFPNIDIKGSEVSSEIPEI 5451          

HSP 40 Score: 62.003 bits (149), Expect = 6.193e-10
Identity = 103/336 (30.65%), Postives = 160/336 (47.62%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEG-KLKKPK-GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE---VDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI---EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISG-DLSVDKPXXXXXXXXXVSNKKKKHGIDINLP----NWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNV-------EVPDA---SIDIQG-KKHKGDIDVHLSIPEVDIDVD 1032
            +DI  PD K   F+G K   PK   ++V  PD+D ++ G K KG+ID ++  P ++ D   PD+DIE   V+I G K      F +P  K+P     +K PK      +  PE D+ + G +  G++DV    P +E DI  PD+DI   E+D +  K G    +P  K   F  KG K +   D+ V  PS DI++   +  I+  D  +  PD+         N  K  G+++++P    N K PK       S  +++ D+ TP++D  G                DVN+       E+P     S++I+G K  K ++D+ L  P+V  D+D
Sbjct: 1746 VDIKGPDSK---FKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKAPDLDIEGPDVNIGGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDV--KAPKIEGDIKAPDVDIGRAELDIEGPKGGFK--MPKFKMPTFGSKGHKLEGP-DVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKF--NMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKGP---------------DVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPELDLKLKGPKVGGDLD 2042          

HSP 41 Score: 60.4622 bits (145), Expect = 1.729e-9
Identity = 107/377 (28.38%), Postives = 167/377 (44.30%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK--GALDVEAPDI-------DVDIHGKK-----PKGEI--------------------DLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM-----DIEIDGKKKKHGI-NIGLPSM--KGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD-------IDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            L+I  P  + P+ + KLK PK  G LDV+AP I       DVDI G +     PKG                      D++V  P+ DI+   PD+DI   +VD+ G   K    F  P + +PK  G          +++  P+VD ++ G + KG++D +   P +E DI  P +     D+ IDG K    +  + +P++  KG K E        +VD+ +K P +  D+D K  +I GD+   K         ++  +  K G    +P +K P F +K  K +G  D+DIN P  D +  A              DV++  PD  +     K KG          +++S+P+VD ++ G K K     +LP
Sbjct: 1086 LNIKGPKMEKPELDLKLKGPKVGGDLDVKAPKIEGEIKTPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDVDMKGPDTK----FKGPKFNMPKMPG----------MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKTPSVATKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKME------MPDVDIKLKGPKVGGDLDVKAPKIEGDI---KAPDVDIGGAELDTEGPKGGF--KMPKFKMPTFGSKGHKLEGP-DVDINLPSTDIEVKAP-------------DVDITAPDVDMKGPDTKFKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDKEASLP 1421          

HSP 42 Score: 59.6918 bits (143), Expect = 2.761e-9
Identity = 107/380 (28.16%), Postives = 166/380 (43.68%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKG--------ELDIDIRGPEVD-----VDIHG--NRAKGNVDVTFNKPDLE-IDITKPDMDIEIDGKKKKHGINIGLPSMKG----LKFEGKG------------------------KKPKSE---VDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGD-------IDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
              +P  K+P     +K PK    +E P++D+ + G K  G  DL+VK P ++ D   PD+DI   E+DI+G K      F +P +K+P F  K  K +G          DI+++ P+VD     VD+ G   + KG     FN P +  ++++ PD+D  + G K K  I+  LP ++G         KG                        K PK E   VD+ +K P +  D+D K  +I GD+   K         ++  +  K G    +P +K P F +K  K +G  D+DIN P  D +  A              DV++  P   I     K KG          +++S+P+VD ++ G K K     +LP
Sbjct: 1448 FEMPKVKMPSIN--IKGPK----MEKPEVDIRLKGPKVGG--DLDVKAPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDITAPDVDMKGPDTKFKGP---KFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDIKTPSVATKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKMEMPDVDIKLKGPKVGGDLDVKAPKIEGDI---KAPDVDIGGAELDTEGPKGGF--KMPTFKMPTFGSKGHKLEGP-DVDINLPSTDIEVKAP-------------DVDIAAPHVDIKGPDSKFKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLP 1793          

HSP 43 Score: 58.5362 bits (140), Expect = 6.218e-9
Identity = 52/172 (30.23%), Postives = 89/172 (51.74%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPK------GALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINI 561
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D + PD+DI   +V+IDG K        K   L+   P  + P+F+ KLK PK   D+D++ P+++ DI   +A G      + PD+++    P+   +  G  +   I+I
Sbjct: 5273 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMNTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKIPKIEGDI---KAAGVSGSNVSLPDVDVGRKVPETQADFKGSCQFPNIDI 5439          
BLAST of SMED30001359 vs. Ensembl Medaka
Match: ENSORLT00000002200.2 (pep primary_assembly:ASM223467v1:13:4398514:4425977:-1 gene:ENSORLG00000001764.2 transcript:ENSORLT00000002200.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 2.059e-9
Identity = 91/293 (31.06%), Postives = 131/293 (44.71%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKP--KGAL---DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDI----DGKKKKHGLDFNLPDWKLPKFEGKLKKP----KGEL----------------DID------IRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDIT-----KPDMDIEIDGKKKKHG------INIGLPSMKGLKFE--------GKGKKPKSEVDL-GVKTPSIDI-----DIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKH--GIDINLPNW 789
            LDI LP  K       ++ P  KG +   +V++PD+DV+I G +  G     +  PNVD+ F K   D EV++    DGK K    D +LP   LPKF+  +K P    K E+                D+D         P +D+ +   +AKG  DV    P+++ DI+      PD+D  + G + + G      ++I LP  +G  FE        GK K PK +V L  V  P  D      D+ GK    S D+SV K   D+ +D+D     K H   +DI LP  
Sbjct:  192 LDITLPKMKTKGLNVNVEGPEVKGDMSLSEVKSPDVDVNIKGPEVVGGY---ISLPNVDVAFPKTKGDFEVEVPDMKDGKFKMPKFDVSLPKVSLPKFDANVKGPDLKGKAEMPSVDISVPKATTDVGVDVDTGKGSKFHMPSLDISLPKMKAKG-FDVNIEGPEVKGDISLPEVRSPDVDFNLQGPEVEGGKLSLPKVDIALPKTEG-DFEVEGPDIKGGKFKMPKFDVSLPKVSLPKFDASVEGPDLKGKAEMQSVDISVAKGTTDLGVDVDTGKDSKFHMPSLDITLPKM 479          

HSP 2 Score: 56.225 bits (134), Expect = 3.048e-8
Identity = 71/253 (28.06%), Postives = 110/253 (43.48%), Query Frame = 1
Query:  187 IDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDID-GKKKKH---GLDFNLPDWKLPKFEGKLKKP--KGELDI-DIRGPEVDVDIHGNRAKG------NVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEG-------KGKKPKSEVDLGVKTPSIDIDID------GKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEID 867
            ID  + G   KG+ ++    P+VDI   K   D+ VD+D GK  K     LD  LP  K       ++ P  KG++ + +++ P+VDV+I G    G      NVDV F K   + ++  PDM    DGK K    ++ LP +   KF+        KGK     VD+ V   + D+ +D       K H  S D+S+               K K  G D+N+   +     +  +     VD ++  PE++
Sbjct:  146 IDASVEGPDLKGKAEM----PSVDISVPKGTTDLGVDVDPGKGSKFHMPSLDITLPKMKTKGLNVNVEGPEVKGDMSLSEVKSPDVDVNIKGPEVVGGYISLPNVDVAFPKTKGDFEVEVPDMK---DGKFKMPKFDVSLPKVSLPKFDANVKGPDLKGKAEMPSVDISVPKATTDVGVDVDTGKGSKFHMPSLDISLP--------------KMKAKGFDVNIEGPEVKGDISLPEVRSPDVDFNLQGPEVE 377          
BLAST of SMED30001359 vs. Ensembl Medaka
Match: ENSORLT00000000108.2 (neuroblast differentiation-associated protein AHNAK [Source:NCBI gene;Acc:105358319])

HSP 1 Score: 49.2914 bits (116), Expect = 4.674e-6
Identity = 61/233 (26.18%), Postives = 103/233 (44.21%), Query Frame = 1
Query:  103 INLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDL-NVKNPNVD-----IDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDI-RGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGIN-----------------IGLPSMKGLKFEG---KGKKPKSEV---DLGVKTPSIDIDIDGKKHRISGDLSVDKP 711
             NLP  K P+ + KL  P    +V  P++++    + PKG ID  ++K P +D     +D + PD+++++           +   PDW +    GKLK PK  L   + +GP +D D+       + D     P ++  I  PDMD+ +D K    G N                 +GL SMKG + +G   +   P +++     G + P +D     +K ++  D+   KP
Sbjct:  958 FNLPTHKSPEVDAKLDHPD--FNVNGPNLNL----RGPKGGIDAPDIKLPKMDPKTPKLDLNVPDVNLKMP----------ELQGPDWDVNGPSGKLKMPKMNLSGTLPKGPNLDADLT------SPDFNLKAPKVKGGINTPDMDLHLDHKGPNFGANLPGVSTASPKAKLKMPKVGLSSMKGQEIDGNFDRAGLPNADIKHSKKGFEVPEVDFGKPSRKLKMP-DIGFSKP 1167          
BLAST of SMED30001359 vs. Planmine SMEST
Match: SMESG000022407.1 (SMESG000022407.1)

HSP 1 Score: 521.546 bits (1342), Expect = 4.463e-169
Identity = 353/357 (98.88%), Postives = 354/357 (99.16%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDK DADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct: 1325 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKTDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 1681          

HSP 2 Score: 375.555 bits (963), Expect = 9.838e-118
Identity = 265/325 (81.54%), Postives = 271/325 (83.38%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +   L   ++ K   +LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE+                     KFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK                   DIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDIN  EIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct:   69 IRYQLARLEITKIRRELKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEI-----------------GSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK-------------------DIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 357          

HSP 3 Score: 347.821 bits (891), Expect = 4.057e-108
Identity = 255/399 (63.91%), Postives = 280/399 (70.18%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP------------------DMDIE-----------IDGKKKKHGINIGLP--SMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP                  D+ ++           +  KKKKHGI+I L   + + L  +GK       +D+ V+ P   IDI GKKH+   D+ +  P    ++DIDV  KKKKHG+DINLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct:  848 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLQIGNFQNLVIKGK-------LDVNVEVPDASIDIQGKKHKGDIDVHLSIP----EVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 1206          

HSP 4 Score: 314.694 bits (805), Expect = 1.363e-96
Identity = 241/395 (61.01%), Postives = 277/395 (70.13%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDI----------------------------------DGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKK NIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ D+N+K PN+D+D +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE  IDGKKKKHG++  LP  K  KFEGK KKPK E+D+ ++ P +D+DI                                  DGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINL                                  +    +N   KGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct:  770 DVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINL----------------------------------QIGNFQNLVIKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 1128          

HSP 5 Score: 303.908 bits (777), Expect = 8.756e-93
Identity = 217/381 (56.96%), Postives = 266/381 (69.82%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKK---------HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKKHGFGINLP 1071
            DVNLKKPN+D+DINKPDIDIDLD D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDIDGKK          + + D+ ++KP  DIDID+DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P +D+D++            KKKKHG  INLP
Sbjct:  536 DVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKP--DIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 885          

HSP 6 Score: 293.893 bits (751), Expect = 2.751e-89
Identity = 192/349 (55.01%), Postives = 240/349 (68.77%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXX-------XXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            HGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DI G + KG++DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+        DIDID+D+ +KKKKHG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKKKHG   NLP
Sbjct: 1121 HGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 1438          

HSP 7 Score: 286.189 bits (731), Expect = 1.344e-86
Identity = 209/368 (56.79%), Postives = 271/368 (73.64%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP--DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXX-------XXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+DVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DI GKKPKG+ID+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KP  D+D++ID KKKKHG++I LP  K  KFEGK KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID        ++D+  KKKKHG+D NLP+WK PKF  K KK KG++D+DI  PE+D                  +D++      ++D+    +K D+++ ++ P++DI++DGKKKKHG  I LP
Sbjct: 1169 DVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD------------------VDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 1514          

HSP 8 Score: 282.337 bits (721), Expect = 2.485e-85
Identity = 210/392 (53.57%), Postives = 269/392 (68.62%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXX-------XXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASI--DIQGKKHK-----------------------GDIDVHLSIPEVDIDVDGKKKKHGFGINL 1068
            DVNLKKPN+DVDINKPDID+D+D   KK  HG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DI G + KG++DV   K ++++DI KPD+DI+  +DGKKKKHG  I LP  K   FEGK  KPK E+D+ V+ P +DIDI GKK +   D+++ KP+        DIDID+D+ +KKKKHG+DINLP+WK PKF  K KK KG +D++    ++D  G   K +     K   +D++   PD  I  DI GKK K                       G+ID+ +  PEVDID+ GKK K GF +N 
Sbjct: 1722 DVNLKKPNVDVDINKPDIDLDVDGKKKK--HGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNF 2111          

HSP 9 Score: 273.478 bits (698), Expect = 3.424e-82
Identity = 189/371 (50.94%), Postives = 244/371 (65.77%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKK---------HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQ-----------GKKHKGDIDVHL---------------------SIPEVDIDVDGKKKKHGFGINL 1068
            HGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDID+  D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+DI+  +DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDIDGKK          + + D+ ++KPD DID+D  V  KKKKHG  INLP+WK P F  K  K KG++D+D+  PE+D D + KK K         IDVN++ P+  +DI             KK K  +D++L                       P++D+D+ GKK K    +N+
Sbjct: 1674 HGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLD--VDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGD-------IDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNV 2033          

HSP 10 Score: 269.24 bits (687), Expect = 8.519e-81
Identity = 202/355 (56.90%), Postives = 253/355 (71.27%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP--DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXX-------XXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD 1032
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DI GKKPKG+ID+N+K  N+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+ KPKGE+DID+ GPEVD+DIHG + KG++DV   KP++++DI KP  D+D++ID KKKKHG++I LP  K  KFEGK KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID        ++D+  KKKKHG+D NLP+WK PKF  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+   P +DID++
Sbjct: 1798 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGGFDVNFKKPNIDIDIN 2121          

HSP 11 Score: 257.299 bits (656), Expect = 1.332e-76
Identity = 208/370 (56.22%), Postives = 259/370 (70.00%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK--GDIDVHLS--IPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ D+N+K PN+D+D +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE  IDGKKKKHG++  LP  K  KFEGK KKPK E+D+ ++ P +D+DI G + + + D++ +KPD +IDI       ++  KKKKHGI+I LP+ K  KF  K KK K +VDL + TP ID                             IDI GKKH+  GD+ V  +    ++DIDV  KKKKHG  INLP
Sbjct: 1247 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSID-----------------------------IDIDGKKHRISGDLSVDKTDADIDIDIDVSNKKKKHGIDINLP 1585          

HSP 12 Score: 253.832 bits (647), Expect = 2.384e-75
Identity = 155/172 (90.12%), Postives = 164/172 (95.35%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 516
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGK+KKPKGE+DID+ GPEVD+DIHG + KG  DV F KP+++IDI KPD+
Sbjct: 1954 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNFKKPNIDIDINKPDI 2125          

HSP 13 Score: 253.062 bits (645), Expect = 4.411e-75
Identity = 202/366 (55.19%), Postives = 252/366 (68.85%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+DVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK    K  L             +K +G+ D+N+K PNVDID +KPDIDI++D D KKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P   ID+  KK   D+D++    ++D+DVDGKKKKHGFGINLP
Sbjct:  474 DVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGK----KSTL----------TFMEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLP 807          

HSP 14 Score: 249.595 bits (636), Expect = 6.027e-74
Identity = 177/365 (48.49%), Postives = 227/365 (62.19%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+D+++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P   ID+  KK   D+D++    ++D+DVDGKKKKHGFGINLP
Sbjct: 1578 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLP 1913          

HSP 15 Score: 236.498 bits (602), Expect = 2.236e-69
Identity = 184/409 (44.99%), Postives = 233/409 (56.97%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWX------XXXXXXXXXXXXGQVDLDINTPEIDFXXXX---------------------------XXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKL  FEGK+KK KGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+D+++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK              +K++G  D+++  P +D D N                               + K K  KG+ID++VE P+  IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct:  254 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKKSTLTFMEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 651          

HSP 16 Score: 168.703 bits (426), Expect = 6.185e-46
Identity = 167/456 (36.62%), Postives = 218/456 (47.81%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVD------------------------IDGKK--------------------------KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGN-------VDVTFNKPDLEIDI-------------TKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDAS-----------IDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            D+N+K PN+D+D                  H  DI++      KFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE+D                        IDGKK                          KKHG+D NLP+WK PKF  K KK KG++D+DI   E+D D +  ++K         +DV    PD  IDI             + P++DI++DGKKKKHG++I LP  K   FEGK KK K E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+      DV  KKKKHG  INLP+WK P                                          +  V+ P              IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct:  113 DLNVKNPNVDIDF-----------------HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPT----------------------------------------FEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 511          

HSP 17 Score: 146.747 bits (369), Expect = 1.692e-38
Identity = 114/241 (47.30%), Postives = 145/241 (60.17%), Query Frame = 1
Query:  412 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKG---------------------KKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLK+  +                      KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID           H  DI++    + KF  K KK KG++D+DI  PE+D                  +D++      ++D+    +K D+++ ++ P++DI++DGKKKKHG  I LP
Sbjct:    1 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDF----------HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVD------------------VDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 209          

HSP 18 Score: 53.5286 bits (127), Expect = 1.982e-7
Identity = 23/23 (100.00%), Postives = 23/23 (100.00%), Query Frame = 3
Query:   75 QQEKETWIRYQLARLEITKIRRE 143
            QQEKETWIRYQLARLEITKIRRE
Sbjct:   62 QQEKETWIRYQLARLEITKIRRE 84          
BLAST of SMED30001359 vs. Planmine SMEST
Match: SMESG000022407.1 (SMESG000022407.1)

HSP 1 Score: 521.161 bits (1341), Expect = 5.326e-169
Identity = 353/357 (98.88%), Postives = 354/357 (99.16%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDK DADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct: 1315 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKTDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 1671          

HSP 2 Score: 375.17 bits (962), Expect = 1.192e-117
Identity = 265/325 (81.54%), Postives = 271/325 (83.38%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +   L   ++ K   +LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE+                     KFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK                   DIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDIN  EIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct:   69 IRYQLARLEITKIRRELKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEI-----------------GSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK-------------------DIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 357          

HSP 3 Score: 365.54 bits (937), Expect = 2.790e-114
Identity = 262/389 (67.35%), Postives = 283/389 (72.75%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDG-------------------KKKKHGINIGLP--SMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDG                   KKKKHGI+I L   + + L  +GK       +D+ V+ P   IDI GKKH+   D+ +  P    ++DIDV  KKKKHG+DINLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct:  848 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGDLSVDKPDADIDIDIDVSNKKKKHGIDINLQIGNFQNLVIKGK-------LDVNVEVPDASIDIQGKKHKGDIDVHLSIP----EVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 1196          

HSP 4 Score: 309.301 bits (791), Expect = 1.001e-94
Identity = 235/385 (61.04%), Postives = 273/385 (70.91%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHR------------------------ISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKK NIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ D+N+K PN+D+D +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE  IDGKKKKHG++  LP  K  KFEGK KKPK E+D+ ++ P +D+DI G + +                        I GDLSVDKPDADIDIDIDVSNKKKKHGIDINL                                  +    +N   KGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct:  770 DVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGDLSVDKPDADIDIDIDVSNKKKKHGIDINL----------------------------------QIGNFQNLVIKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 1118          

HSP 5 Score: 303.908 bits (777), Expect = 9.008e-93
Identity = 217/381 (56.96%), Postives = 266/381 (69.82%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKK---------HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKKHGFGINLP 1071
            DVNLKKPN+D+DINKPDIDIDLD D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDIDGKK          + + D+ ++KP  DIDID+DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P +D+D++            KKKKHG  INLP
Sbjct:  536 DVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKP--DIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 885          

HSP 6 Score: 293.893 bits (751), Expect = 2.697e-89
Identity = 192/349 (55.01%), Postives = 240/349 (68.77%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXX-------XXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            HGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DI G + KG++DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+        DIDID+D+ +KKKKHG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKKKHG   NLP
Sbjct: 1111 HGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 1428          

HSP 7 Score: 286.189 bits (731), Expect = 1.356e-86
Identity = 209/368 (56.79%), Postives = 271/368 (73.64%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP--DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXX-------XXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+DVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DI GKKPKG+ID+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KP  D+D++ID KKKKHG++I LP  K  KFEGK KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID        ++D+  KKKKHG+D NLP+WK PKF  K KK KG++D+DI  PE+D                  +D++      ++D+    +K D+++ ++ P++DI++DGKKKKHG  I LP
Sbjct: 1159 DVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD------------------VDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 1504          

HSP 8 Score: 282.337 bits (721), Expect = 2.436e-85
Identity = 210/392 (53.57%), Postives = 269/392 (68.62%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXX-------XXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASI--DIQGKKHK-----------------------GDIDVHLSIPEVDIDVDGKKKKHGFGINL 1068
            DVNLKKPN+DVDINKPDID+D+D   KK  HG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DI G + KG++DV   K ++++DI KPD+DI+  +DGKKKKHG  I LP  K   FEGK  KPK E+D+ V+ P +DIDI GKK +   D+++ KP+        DIDID+D+ +KKKKHG+DINLP+WK PKF  K KK KG +D++    ++D  G   K +     K   +D++   PD  I  DI GKK K                       G+ID+ +  PEVDID+ GKK K GF +N 
Sbjct: 1712 DVNLKKPNVDVDINKPDIDLDVDGKKKK--HGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNF 2101          

HSP 9 Score: 273.478 bits (698), Expect = 3.422e-82
Identity = 189/371 (50.94%), Postives = 244/371 (65.77%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKK---------HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQ-----------GKKHKGDIDVHL---------------------SIPEVDIDVDGKKKKHGFGINL 1068
            HGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDID+  D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+DI+  +DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDIDGKK          + + D+ ++KPD DID+D  V  KKKKHG  INLP+WK P F  K  K KG++D+D+  PE+D D + KK K         IDVN++ P+  +DI             KK K  +D++L                       P++D+D+ GKK K    +N+
Sbjct: 1664 HGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLD--VDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGD-------IDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNV 2023          

HSP 10 Score: 269.24 bits (687), Expect = 8.514e-81
Identity = 202/355 (56.90%), Postives = 253/355 (71.27%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP--DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXX-------XXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD 1032
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DI GKKPKG+ID+N+K  N+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+ KPKGE+DID+ GPEVD+DIHG + KG++DV   KP++++DI KP  D+D++ID KKKKHG++I LP  K  KFEGK KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID        ++D+  KKKKHG+D NLP+WK PKF  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+   P +DID++
Sbjct: 1788 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGGFDVNFKKPNIDIDIN 2111          

HSP 11 Score: 257.299 bits (656), Expect = 1.357e-76
Identity = 208/370 (56.22%), Postives = 259/370 (70.00%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK--GDIDVHLS--IPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ D+N+K PN+D+D +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE  IDGKKKKHG++  LP  K  KFEGK KKPK E+D+ ++ P +D+DI G + + + D++ +KPD +IDI       ++  KKKKHGI+I LP+ K  KF  K KK K +VDL + TP ID                             IDI GKKH+  GD+ V  +    ++DIDV  KKKKHG  INLP
Sbjct: 1237 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSID-----------------------------IDIDGKKHRISGDLSVDKTDADIDIDIDVSNKKKKHGIDINLP 1575          

HSP 12 Score: 253.447 bits (646), Expect = 2.524e-75
Identity = 155/172 (90.12%), Postives = 164/172 (95.35%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 516
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGK+KKPKGE+DID+ GPEVD+DIHG + KG  DV F KP+++IDI KPD+
Sbjct: 1944 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNFKKPNIDIDINKPDI 2115          

HSP 13 Score: 253.062 bits (645), Expect = 4.082e-75
Identity = 202/366 (55.19%), Postives = 252/366 (68.85%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+DVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK    K  L             +K +G+ D+N+K PNVDID +KPDIDI++D D KKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P   ID+  KK   D+D++    ++D+DVDGKKKKHGFGINLP
Sbjct:  474 DVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGK----KSTL----------TFMEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLP 807          

HSP 14 Score: 249.595 bits (636), Expect = 5.577e-74
Identity = 177/365 (48.49%), Postives = 227/365 (62.19%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+D+++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P   ID+  KK   D+D++    ++D+DVDGKKKKHGFGINLP
Sbjct: 1568 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLP 1903          

HSP 15 Score: 236.498 bits (602), Expect = 2.192e-69
Identity = 184/409 (44.99%), Postives = 233/409 (56.97%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWX------XXXXXXXXXXXXGQVDLDINTPEIDFXXXX---------------------------XXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKL  FEGK+KK KGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+D+++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK              +K++G  D+++  P +D D N                               + K K  KG+ID++VE P+  IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct:  254 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKKSTLTFMEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 651          

HSP 16 Score: 168.703 bits (426), Expect = 5.950e-46
Identity = 167/456 (36.62%), Postives = 218/456 (47.81%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVD------------------------IDGKK--------------------------KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGN-------VDVTFNKPDLEIDI-------------TKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDAS-----------IDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            D+N+K PN+D+D                  H  DI++      KFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE+D                        IDGKK                          KKHG+D NLP+WK PKF  K KK KG++D+DI   E+D D +  ++K         +DV    PD  IDI             + P++DI++DGKKKKHG++I LP  K   FEGK KK K E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+      DV  KKKKHG  INLP+WK P                                          +  V+ P              IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct:  113 DLNVKNPNVDIDF-----------------HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPT----------------------------------------FEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 511          

HSP 17 Score: 146.747 bits (369), Expect = 1.790e-38
Identity = 114/241 (47.30%), Postives = 145/241 (60.17%), Query Frame = 1
Query:  412 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKG---------------------KKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLK+  +                      KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID           H  DI++    + KF  K KK KG++D+DI  PE+D                  +D++      ++D+    +K D+++ ++ P++DI++DGKKKKHG  I LP
Sbjct:    1 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDF----------HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVD------------------VDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 209          

HSP 18 Score: 53.5286 bits (127), Expect = 1.982e-7
Identity = 23/23 (100.00%), Postives = 23/23 (100.00%), Query Frame = 3
Query:   75 QQEKETWIRYQLARLEITKIRRE 143
            QQEKETWIRYQLARLEITKIRRE
Sbjct:   62 QQEKETWIRYQLARLEITKIRRE 84          
BLAST of SMED30001359 vs. Planmine SMEST
Match: SMESG000022407.1 (SMESG000022407.1)

HSP 1 Score: 521.161 bits (1341), Expect = 5.329e-169
Identity = 353/357 (98.88%), Postives = 354/357 (99.16%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDK DADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct: 1317 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKTDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 1673          

HSP 2 Score: 375.555 bits (963), Expect = 1.181e-117
Identity = 265/325 (81.54%), Postives = 271/325 (83.38%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +   L   ++ K   +LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE+                     KFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK                   DIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDIN  EIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct:   69 IRYQLARLEITKIRRELKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEI-----------------GSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK-------------------DIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 357          

HSP 3 Score: 365.54 bits (937), Expect = 2.818e-114
Identity = 262/389 (67.35%), Postives = 283/389 (72.75%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDG-------------------KKKKHGINIGLP--SMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDG                   KKKKHGI+I L   + + L  +GK       +D+ V+ P   IDI GKKH+   D+ +  P    ++DIDV  KKKKHG+DINLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct:  850 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGDLSVDKPDADIDIDIDVSNKKKKHGIDINLQIGNFQNLVIKGK-------LDVNVEVPDASIDIQGKKHKGDIDVHLSIP----EVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 1198          

HSP 4 Score: 309.301 bits (791), Expect = 1.011e-94
Identity = 235/385 (61.04%), Postives = 273/385 (70.91%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHR------------------------ISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKK NIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ D+N+K PN+D+D +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE  IDGKKKKHG++  LP  K  KFEGK KKPK E+D+ ++ P +D+DI G + +                        I GDLSVDKPDADIDIDIDVSNKKKKHGIDINL                                  +    +N   KGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct:  772 DVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGDLSVDKPDADIDIDIDVSNKKKKHGIDINL----------------------------------QIGNFQNLVIKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 1120          

HSP 5 Score: 303.908 bits (777), Expect = 9.273e-93
Identity = 217/381 (56.96%), Postives = 266/381 (69.82%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKK---------HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKKHGFGINLP 1071
            DVNLKKPN+D+DINKPDIDIDLD D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDIDGKK          + + D+ ++KP  DIDID+DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P +D+D++            KKKKHG  INLP
Sbjct:  538 DVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKP--DIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 887          

HSP 6 Score: 293.893 bits (751), Expect = 2.803e-89
Identity = 192/349 (55.01%), Postives = 240/349 (68.77%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXX-------XXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            HGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DI G + KG++DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+        DIDID+D+ +KKKKHG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKKKHG   NLP
Sbjct: 1113 HGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 1430          

HSP 7 Score: 286.189 bits (731), Expect = 1.383e-86
Identity = 209/368 (56.79%), Postives = 271/368 (73.64%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP--DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXX-------XXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+DVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DI GKKPKG+ID+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KP  D+D++ID KKKKHG++I LP  K  KFEGK KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID        ++D+  KKKKHG+D NLP+WK PKF  K KK KG++D+DI  PE+D                  +D++      ++D+    +K D+++ ++ P++DI++DGKKKKHG  I LP
Sbjct: 1161 DVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD------------------VDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 1506          

HSP 8 Score: 282.337 bits (721), Expect = 2.532e-85
Identity = 210/392 (53.57%), Postives = 269/392 (68.62%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXX-------XXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASI--DIQGKKHK-----------------------GDIDVHLSIPEVDIDVDGKKKKHGFGINL 1068
            DVNLKKPN+DVDINKPDID+D+D   KK  HG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DI G + KG++DV   K ++++DI KPD+DI+  +DGKKKKHG  I LP  K   FEGK  KPK E+D+ V+ P +DIDI GKK +   D+++ KP+        DIDID+D+ +KKKKHG+DINLP+WK PKF  K KK KG +D++    ++D  G   K +     K   +D++   PD  I  DI GKK K                       G+ID+ +  PEVDID+ GKK K GF +N 
Sbjct: 1714 DVNLKKPNVDVDINKPDIDLDVDGKKKK--HGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNF 2103          

HSP 9 Score: 273.478 bits (698), Expect = 3.523e-82
Identity = 189/371 (50.94%), Postives = 244/371 (65.77%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKK---------HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQ-----------GKKHKGDIDVHL---------------------SIPEVDIDVDGKKKKHGFGINL 1068
            HGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDID+  D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+DI+  +DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDIDGKK          + + D+ ++KPD DID+D  V  KKKKHG  INLP+WK P F  K  K KG++D+D+  PE+D D + KK K         IDVN++ P+  +DI             KK K  +D++L                       P++D+D+ GKK K    +N+
Sbjct: 1666 HGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLD--VDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGD-------IDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNV 2025          

HSP 10 Score: 269.24 bits (687), Expect = 8.849e-81
Identity = 202/355 (56.90%), Postives = 253/355 (71.27%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP--DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXX-------XXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD 1032
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DI GKKPKG+ID+N+K  N+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+ KPKGE+DID+ GPEVD+DIHG + KG++DV   KP++++DI KP  D+D++ID KKKKHG++I LP  K  KFEGK KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID        ++D+  KKKKHG+D NLP+WK PKF  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+   P +DID++
Sbjct: 1790 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGGFDVNFKKPNIDIDIN 2113          

HSP 11 Score: 257.299 bits (656), Expect = 1.384e-76
Identity = 208/370 (56.22%), Postives = 259/370 (70.00%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK--GDIDVHLS--IPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ D+N+K PN+D+D +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE  IDGKKKKHG++  LP  K  KFEGK KKPK E+D+ ++ P +D+DI G + + + D++ +KPD +IDI       ++  KKKKHGI+I LP+ K  KF  K KK K +VDL + TP ID                             IDI GKKH+  GD+ V  +    ++DIDV  KKKKHG  INLP
Sbjct: 1239 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSID-----------------------------IDIDGKKHRISGDLSVDKTDADIDIDIDVSNKKKKHGIDINLP 1577          

HSP 12 Score: 256.144 bits (653), Expect = 3.483e-76
Identity = 201/366 (54.92%), Postives = 253/366 (69.13%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+DVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK++K                  +K +G+ D+N+K PNVDID +KPDIDI++D D KKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P   ID+  KK   D+D++    ++D+DVDGKKKKHGFGINLP
Sbjct:  474 DVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVQKSTLTF------------MEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLP 809          

HSP 13 Score: 253.447 bits (646), Expect = 2.598e-75
Identity = 155/172 (90.12%), Postives = 164/172 (95.35%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 516
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGK+KKPKGE+DID+ GPEVD+DIHG + KG  DV F KP+++IDI KPD+
Sbjct: 1946 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNFKKPNIDIDINKPDI 2117          

HSP 14 Score: 249.595 bits (636), Expect = 5.741e-74
Identity = 177/365 (48.49%), Postives = 227/365 (62.19%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+D+++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P   ID+  KK   D+D++    ++D+DVDGKKKKHGFGINLP
Sbjct: 1570 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLP 1905          

HSP 15 Score: 235.728 bits (600), Expect = 3.647e-69
Identity = 184/411 (44.77%), Postives = 233/411 (56.69%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWX--------XXXXXXXXXXXXGQVDLDINTPEIDFXXXX---------------------------XXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKL  FEGK+KK KGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+D+++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK                +K++G  D+++  P +D D N                               + K K  KG+ID++VE P+  IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct:  254 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVQKSTLTFMEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 653          

HSP 16 Score: 168.703 bits (426), Expect = 6.008e-46
Identity = 167/456 (36.62%), Postives = 218/456 (47.81%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVD------------------------IDGKK--------------------------KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGN-------VDVTFNKPDLEIDI-------------TKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDAS-----------IDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            D+N+K PN+D+D                  H  DI++      KFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE+D                        IDGKK                          KKHG+D NLP+WK PKF  K KK KG++D+DI   E+D D +  ++K         +DV    PD  IDI             + P++DI++DGKKKKHG++I LP  K   FEGK KK K E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+      DV  KKKKHG  INLP+WK P                                          +  V+ P              IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct:  113 DLNVKNPNVDIDF-----------------HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPT----------------------------------------FEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 511          

HSP 17 Score: 146.747 bits (369), Expect = 1.790e-38
Identity = 114/241 (47.30%), Postives = 145/241 (60.17%), Query Frame = 1
Query:  412 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKG---------------------KKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLK+  +                      KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID           H  DI++    + KF  K KK KG++D+DI  PE+D                  +D++      ++D+    +K D+++ ++ P++DI++DGKKKKHG  I LP
Sbjct:    1 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDF----------HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVD------------------VDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 209          

HSP 18 Score: 53.5286 bits (127), Expect = 1.982e-7
Identity = 23/23 (100.00%), Postives = 23/23 (100.00%), Query Frame = 3
Query:   75 QQEKETWIRYQLARLEITKIRRE 143
            QQEKETWIRYQLARLEITKIRRE
Sbjct:   62 QQEKETWIRYQLARLEITKIRRE 84          
BLAST of SMED30001359 vs. Planmine SMEST
Match: SMESG000052306.1 (SMESG000052306.1)

HSP 1 Score: 522.702 bits (1345), Expect = 5.490e-169
Identity = 355/357 (99.44%), Postives = 355/357 (99.44%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct: 4933 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 5289          

HSP 2 Score: 493.812 bits (1270), Expect = 6.314e-159
Identity = 346/378 (91.53%), Postives = 350/378 (92.59%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSI----------------------PEVDIDVDGKKKKHGFGINL 1068
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHL+                       PEVDID+ GKK K  F +NL
Sbjct: 2914 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 3291          

HSP 3 Score: 493.812 bits (1270), Expect = 7.809e-159
Identity = 344/378 (91.01%), Postives = 349/378 (92.33%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSI----------------------PEVDIDVDGKKKKHGFGINL 1068
            DVNLKKPNID+D NKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHL+                       PEVDID+ GKK K  F +NL
Sbjct: 1344 DVNLKKPNIDIDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 1721          

HSP 4 Score: 479.945 bits (1234), Expect = 5.060e-154
Identity = 302/327 (92.35%), Postives = 303/327 (92.66%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRIS                      +KHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct: 4276 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRIS----------------------EKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 4580          

HSP 5 Score: 440.654 bits (1132), Expect = 2.624e-140
Identity = 325/395 (82.28%), Postives = 341/395 (86.33%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELD------------------------------------IDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+D+DINKPDIDIDLD D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ID+N+K PN+D+D +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD                                    IDI GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct: 1874 DVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDVDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 2268          

HSP 6 Score: 439.884 bits (1130), Expect = 4.639e-140
Identity = 312/385 (81.04%), Postives = 336/385 (87.27%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNR--------------------------AKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+D+DINKPDIDIDLD D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ID+N+K PN+D+D +KPDIDI++D+DGKKKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG +                          +KGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAK SKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID+DGKKK  G  INLP
Sbjct:  765 DVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIESKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKISKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDIDGKKKNIGLDINLP 1147          

HSP 7 Score: 405.601 bits (1041), Expect = 4.375e-128
Identity = 279/379 (73.61%), Postives = 289/379 (76.25%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDID--------------------FHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVDID                    FHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK                   DIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNW                      P+               S K KIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct: 3507 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDAMARKRNMDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK-------------------DIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNW--------------------KFPKF--------------SNKRKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 3832          

HSP 8 Score: 350.132 bits (897), Expect = 7.796e-109
Identity = 245/377 (64.99%), Postives = 278/377 (73.74%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+DI  ++DGKK KHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKKKHGFGINLP
Sbjct:  455 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKIKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKIKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 802          

HSP 9 Score: 313.153 bits (801), Expect = 6.560e-96
Identity = 233/409 (56.97%), Postives = 284/409 (69.44%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEI--DGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDL------------DINTPEIDFXXXXX------------------XXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKKHGFGINLP 1071
            DVNLKKPN+DVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVDID +KPDIDI++D DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG++DV   KP++++DI KPD+DI++  DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+ I+        DV  KKKKHG  INLP+WK P F  K KK KG++D+            DIN P+ID D +                      + K K  KG+ID++VE P+  IDI GKK KGD DV+L  P VDID+           DGKKKKHGFGINLP
Sbjct: 2465 DVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVYINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2873          

HSP 10 Score: 312.383 bits (799), Expect = 1.104e-95
Identity = 221/379 (58.31%), Postives = 265/379 (69.92%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEI--DGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVD NKPDIDIDLD D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP+++IDI KPD+DI++  DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        D   KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct: 2387 DVNLKKPNIDVDNNKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVYINKPDIDIDLDVDGKKKKHGFGINLP 2736          

HSP 11 Score: 308.145 bits (788), Expect = 3.312e-94
Identity = 218/379 (57.52%), Postives = 268/379 (70.71%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG++DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ DIDI+        D   KKKKHG+DINLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKKKHG  INLP
Sbjct: 4621 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 4970          

HSP 12 Score: 307.76 bits (787), Expect = 4.685e-94
Identity = 243/433 (56.12%), Postives = 281/433 (64.90%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKK----------------PKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP------------------DMDIE-----------IDGKKKKHGINIGLPSMK--GLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVD----------------LDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            DVNLKKPN+D+DINKPDIDIDLD D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK                PKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP                  D+ ++           +  KKKKHGI+I LP+ K      + K  K + ++D+ V+ P   IDI GKKH+   D+ +  P    ++DIDV  KKKKHG+DINLP+WK P F  K KK KG++D                LDIN P+        K K    +      ++VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKKKHG   NLP
Sbjct: 3937 DVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIVVNLKKPDIDKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIP----EVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEVQKYRQQEKKHGLDINLPDWKLPKFEGKLKKPKGA------LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4359          

HSP 13 Score: 305.064 bits (780), Expect = 3.344e-93
Identity = 195/349 (55.87%), Postives = 241/349 (69.05%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEI--DGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKKHGFGINLP 1071
            HGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG++DV   KP++++D  KPD+DI++  DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKKKHGFGINLP
Sbjct: 2261 HGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDNNKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2580          

HSP 14 Score: 303.523 bits (776), Expect = 1.392e-92
Identity = 214/384 (55.73%), Postives = 278/384 (72.40%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEI--DGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXI-------DVNVEVPDASIDIQGKKHKGDIDVH---------LSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+DV INKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ID+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP+++IDI KPD+DI++  DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+D +        D+ +KKKKHG+DINLP+WK PKF  K KK KG +D++    ++D  G   K +     K   +       D+++E P+  +DI G + KG++DV          ++ P++DI++DGKKKKHG  I LP
Sbjct: 1718 DVNLKKPNVDVYINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDVDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 2101          

HSP 15 Score: 301.597 bits (771), Expect = 6.377e-92
Identity = 213/368 (57.88%), Postives = 270/368 (73.37%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+D+DINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DI GKKPKG+ID+N+K PN+D+D +KPDIDI++D+DGKKKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  KPD+DIE  IDGKKKKHG++  LP  K  KFEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KK KHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P   ID+  KK   D+D++    ++D+DVDGKKKKHGFGINLP
Sbjct:  377 DVNLKKPNVDIDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKIKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKIKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 724          

HSP 16 Score: 300.442 bits (768), Expect = 1.623e-91
Identity = 188/338 (55.62%), Postives = 240/338 (71.01%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            HGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ID+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P    D+  KK   DID++     +D+D DGKKKKHG  INLP
Sbjct: 4573 HGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 4892          

HSP 17 Score: 298.901 bits (764), Expect = 5.360e-91
Identity = 190/338 (56.21%), Postives = 244/338 (72.19%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDV--EAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXX-------XXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            HGLDINLPDWKLP FEGK+KKPKG +D+  E P++D+DIHGKKPKG+ D+N+K PNVDID +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DI G + KG++DV   KP++++DI KPD+DI  ++DGKKKKHG++I LP  K  KFEGK KKPK   DL V+ P ID+DI GKK +   DL+V  P+ DID        ++D+  KKKKHG+D NLP+WK PKF  K KK KG++D+D+  PE+D                  ID++ + P    D+  KK   D+D++    ++D+DVDGKK KHGFGINLP
Sbjct:  329 HGLDINLPDWKLPTFEGKVKKPKGEIDIDFEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKIKKPKGEIDIDVEGPEVD------------------IDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKIKHGFGINLP 646          

HSP 18 Score: 296.975 bits (759), Expect = 2.362e-90
Identity = 211/388 (54.38%), Postives = 271/388 (69.85%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX---------------------------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLD D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG++DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ DIDI+                            D+  KKKKHG+D NLP+WK PKF  K KK KG++D+DI  PE+D                  +D++      ++D+    +K D+++ ++ P++DI++DGKKKKHG  I LP
Sbjct: 3351 DVNLKKPNIDVDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPPFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDAMARKRNMDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD------------------VDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3718          

HSP 19 Score: 296.59 bits (758), Expect = 2.892e-90
Identity = 215/368 (58.42%), Postives = 267/368 (72.55%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPD--MDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXX-------XXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG  D+N+K PNVDID +KPDI I++D DGKKKKHGLD NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG++DV   KP++++D  KPD  +D++ DGKKKKHG++I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+        DIDID+D+ +KKKKHG+DINLP+WK PKF  K KK KG   LD   P+ID                  +D++ + P   ID+  K    DID H    ++++D+DGKK KHG   NLP
Sbjct: 5464 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNVDVDNNKPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDFEAPDID------------------VDIHGKKPKGEIDLNVKNPNVDIDFHKPDMDIEVDIDGKKNKHGLDFNLP 5811          

HSP 20 Score: 287.73 bits (735), Expect = 3.564e-87
Identity = 188/348 (54.02%), Postives = 236/348 (67.82%), Query Frame = 1
Query:   94 GLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEI--DGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            GLDINLPDWKLPKFEGK+KKPKG +D  VE P+ D+DIHGKKPKG+ D+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLP+WKLP FEGK+KKP GE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+DI++  DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ DID +        D+ +KKKKHG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKKKHG   NLP
Sbjct: 1141 GLDINLPDWKLPKFEGKIKKPKGEIDIDVEGPEFDIDIHGKKPKGDFDVNLKKPNIDVDNNKPDIDIDLDVDGKKKKHGFGINLPNWKLPTFEGKVKKPNGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDIDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 1457          

HSP 21 Score: 283.108 bits (723), Expect = 1.480e-85
Identity = 208/368 (56.52%), Postives = 268/368 (72.83%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP--DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXX-------XXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVD NKPDIDIDLD+D KKKKHG  INLP+WKLP FEGK+KKP G +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDIDI++D DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG++DV   KP+++ID  KP  D+D++ID KKKKHG++I LP  K  KFEGK KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID        ++D+  KKKKHG+D NLP+WK PKF  K KK KG++D+DI  PE+D                  +D++      ++D+    +K D+++ ++ P++DI++DGKKKKHG  I LP
Sbjct: 1188 DVNLKKPNIDVDNNKPDIDIDLDVDGKKKKHGFGINLPNWKLPTFEGKVKKPNGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDIDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD------------------VDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 1533          

HSP 22 Score: 280.411 bits (716), Expect = 1.195e-84
Identity = 207/364 (56.87%), Postives = 267/364 (73.35%), Query Frame = 1
Query:   13 KKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP--DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXX-------XXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +KPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVDID +KPDIDI++D DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG++DV   KP++++DI KP  D+D++ID KKKKHG++I LP  K  KFEGK KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID        ++D+  KKKKHG+D NLP+WK PKF  K KK KG++D+DI  PE+D                  +D++      ++D+    +K D+++ ++ P++DI++DGKKKKHG  I LP
Sbjct: 2762 EKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD------------------VDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3103          

HSP 23 Score: 277.715 bits (709), Expect = 1.288e-83
Identity = 183/347 (52.74%), Postives = 234/347 (67.44%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKKHGFGINLP 1071
            +D++L +WKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+  +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG++DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ DIDI+        D   KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D +            KKKKHG  INLP
Sbjct: 1673 IDVHL-NWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVYINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDNNKPDIDIDLDIDSKKKKHGLDINLP 1989          

HSP 24 Score: 275.018 bits (702), Expect = 9.723e-83
Identity = 216/394 (54.82%), Postives = 262/394 (66.50%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGK--------------------GKKPKSEVDLGVKTPSIDIDIDGKKHRISG----DLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIP----EVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVDID +KPDIDI++D DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG++DV   KP++++DI KPD+DI  ++DGKKKKHG++I LP  K  KFEGK                    GKKPK E+DL VK P++DID       I      D++ +KPD +IDI       ++  KKKKHGI+I LP+ K  KF  K KK K +VDL + TP ID                             IDI GKKH+   D+ +  P    ++DIDV  KKKKHG  INLP
Sbjct:  687 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIESKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSID-----------------------------IDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLP 1051          

HSP 25 Score: 274.248 bits (700), Expect = 2.120e-82
Identity = 203/355 (57.18%), Postives = 253/355 (71.27%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP--DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXX-------XXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD 1032
            DVNLKKPN+D+DINKPDI IDLD D KKKKHGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ID+N+K PNVD+D +KPDI I++D DGKKKKHGLD NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG++DV   KP++++DI KP  D+D++ID KKKKHG++I LP  K  KFEGK KKPK  +D   + P ID+DI GKK +   DL+V  P+        D+DI++D+  KK KHG+D NLP+WK PKF    KK KG++DL +  PE+D                             IDI GKK KG  DV+   P +DID++
Sbjct: 5542 DVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNVDVDNNKPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDF--EAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDMDIEVDIDGKKNKHGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVD-----------------------------IDIHGKKPKGGFDVNFKKPNIDIDIN 5865          

HSP 26 Score: 274.248 bits (700), Expect = 2.141e-82
Identity = 190/377 (50.40%), Postives = 247/377 (65.52%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKL-------PKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+DV                      DIN PD  +        +  GK+KKPKG +D  VE P++D+DIHGKKPKG+ID+N+K PN+D+D +KPDIDI++D DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE  ID  G   K       KK  +D+++  PD  ID+     K ++D H    ++++D+DGKKKKHG   NLP
Sbjct: 3288 DVNLKKPNVDV----------------------DINKPDIDIDLDVDGKKRNMGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPPFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDAMARKRNMDFHKPDIDIEVDIDGKKKKHGLDFNLP 3642          

HSP 27 Score: 273.478 bits (698), Expect = 3.963e-82
Identity = 176/334 (52.69%), Postives = 228/334 (68.26%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHG---INIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            HGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ID+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+DI  ++DGKKKKHG   I++  P    +  +   KKPK ++D+ +K P+ID+DI+  K  I  DL VD              KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P    D+  KK   DID++     +D+D DGKKKKHG  INLP
Sbjct: 5282 HGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGRIDIDVEGPE---VDIDIHWKKPKGDIDVNLKKPNIDVDIN--KPDIDIDLDVD-------------GKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 5579          

HSP 28 Score: 261.536 bits (667), Expect = 4.698e-78
Identity = 207/370 (55.95%), Postives = 259/370 (70.00%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIP----EVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+D+DINKPDI IDLD D KKKKHGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ID+N+K PN+D+D +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE  IDGKKKKHG++  LP  K  KFEGK KKPK E+D+ ++ P +D+DI G + + + D++ +KPD +IDI       ++  KKKKHGI+I LP+ K  KF  K KK K +VDL + TP ID                             IDI GKKH+   D+ +  P    ++DIDV  KKKKHG  INLP
Sbjct: 4855 DVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSID-----------------------------IDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLP 5193          

HSP 29 Score: 257.684 bits (657), Expect = 9.262e-77
Identity = 206/370 (55.68%), Postives = 258/370 (69.73%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIP----EVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+D+DINKPDIDIDLD D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ID+N+K PN+D+D +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE  IDGKKKKHG++  LP  K  KFEGK KKPK E+D+ ++ P +D+DI G + + + D++ +KPD +IDI       ++  KKKKHGI+I LP+ K  KF  K KK K +VDL + TP ID                             IDI GKKH+   D+ +  P    ++DIDV  KKKKHG  INLP
Sbjct: 2836 DVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSID-----------------------------IDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLP 3174          

HSP 30 Score: 257.684 bits (657), Expect = 9.533e-77
Identity = 208/370 (56.22%), Postives = 258/370 (69.73%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIP----EVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+DVDINKPDIDIDLD D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ID+N+K PN+DID +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE  IDGKKKKHG++  LP  K  KFEGK KKPK E+D+ ++ P +D+DI G + + + D++ +KPD +IDI       ++  KKKKHGI+I LP+ K  KF  K KK K +VDL + TP ID                             IDI GKKH+   D+ +  P    ++DIDV  KKKKHG  INLP
Sbjct: 1266 DVNLKKPNVDVDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIDVNLKKPNIDIDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSID-----------------------------IDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLP 1604          

HSP 31 Score: 245.358 bits (625), Expect = 1.978e-72
Identity = 181/356 (50.84%), Postives = 235/356 (66.01%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGE-------IDLNVKNPNVDIDF----HKPDIDI-------EVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG   LD+  P+ID D + KK K +       ID+NV+ P+  ID     HK DID+       ++D+DGKKKKHGLD NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG++DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P   ID+  KK   D+D++    ++D+DVDGKKKKHGFGINLP
Sbjct: 4477 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 4814          

HSP 32 Score: 242.662 bits (618), Expect = 1.561e-71
Identity = 149/172 (86.63%), Postives = 160/172 (93.02%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 516
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD EAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPD+DIEVDIDGKK KHGLDFNLPDWKLPKFEG +KKPKGE+D+ + GPEVD+DIHG + KG  DV F KP+++IDI KPD+
Sbjct: 5698 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDFEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDMDIEVDIDGKKNKHGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVDIDIHGKKPKGGFDVNFKKPNIDIDINKPDI 5869          

HSP 33 Score: 241.506 bits (615), Expect = 4.042e-71
Identity = 181/378 (47.88%), Postives = 222/378 (58.73%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+D +        D   KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct: 2165 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDNNKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 2502          

HSP 34 Score: 234.572 bits (597), Expect = 1.125e-68
Identity = 166/337 (49.26%), Postives = 213/337 (63.20%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGK--------KPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K K     ++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG++DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK +        KPK + D+ +K P++DIDI+  K  I  DL  D              KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D D + KK+K        K D  ++ P   ID+  K    DID H    ++++D+DGKKKKHG   NLP
Sbjct: 3763 HGIDINLPNWKFPKFSNKRKI---DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVQKSTLTFMGKPKGDFDVNLKKPNVDIDIN--KPDIDIDLDAD-------------GKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIVVNLKKPD--IDKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4068          

HSP 35 Score: 224.557 bits (571), Expect = 3.343e-65
Identity = 159/311 (51.13%), Postives = 203/311 (65.27%), Query Frame = 1
Query:  166 LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            ++VE P   +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLP FEGK+KKPKGE+DID  GPEVD+DIHG + KG+ DV   KP+++IDI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDIDGKK +   D+++ KP+ D+DI+        DV  KKKKHG+DINLP+WK PKF  K KK KG  DLD+  P+ID                  +D++ + P   ID+  K    DID H    ++++D+DGKKKKHG   NLP
Sbjct:  289 INVEEPYASIDIQGKKLKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDFEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDID------------------VDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 568          

HSP 36 Score: 224.172 bits (570), Expect = 4.209e-65
Identity = 175/378 (46.30%), Postives = 217/378 (57.41%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDID           IDGKKK  GLD NLPDWKLPKFEGK+KKPKGE+DID+ GPE D+DIHG + KG+ DV   KP++++D  KPD+DI  ++DGKKKKHG  I LP+ K   FEGK KKP  E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        D   KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +DID +            KKKKHG  INLP
Sbjct: 1044 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKISKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------IDGKKKNIGLDINLPDWKLPKFEGKIKKPKGEIDIDVEGPEFDIDIHGKKPKGDFDVNLKKPNIDVDNNKPDIDIDLDVDGKKKKHGFGINLPNWKLPTFEGKVKKPNGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDIDNNKPDIDIDLDIDSKKKKHGLDINLP 1381          

HSP 37 Score: 206.453 bits (524), Expect = 5.309e-59
Identity = 210/493 (42.60%), Postives = 271/493 (54.97%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVE------------------------APDIDVDIH--------------------------------GKKPKGEIDLNVKNPNVDIDF----HKPDIDIEVD-----------IDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGN-------VDVTFNKPDLEIDI-------------TKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXX---------------------------XXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKKHGFGINLP 1071
            D+N+K PN+D+D +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD++                         PD+++DI                                 GKKPK E+DL VK P++DID     H+   D+ VD           +  KKKKHG+D NLP+WK PKF  K KK KG++D+DI  PE+D D +  ++K         +DV    PD  IDI             + P++DI++DGKKKKHG++I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D D + KK                             D  K K G+ID++VE P+  IDI  KK KGDIDV+L  P           ++D+DVDGKKKKHGFGINLP
Sbjct: 5009 DLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGRIDIDVEGPEVDIDIHWKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 5501          

HSP 38 Score: 189.504 bits (480), Expect = 4.717e-53
Identity = 155/345 (44.93%), Postives = 202/345 (58.55%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D++    ++D  G   K +     K   +D++   PD  I  DI GKK K  +D +L +WKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+DI++D   KK  +             GK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        D   KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct: 3167 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASI--DIQGKKHKGDIDVHL-NWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKRNM-------------GKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 3466          

HSP 39 Score: 176.407 bits (446), Expect = 1.468e-48
Identity = 157/367 (42.78%), Postives = 197/367 (53.68%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI----------------------EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D++    ++D  G   K +     K   +D++   PD  I  DI GKK K  +D +L +WKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG                    D                       ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKKKHGFGINLP
Sbjct: 1597 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASI--DIQGKKHKGDIDVHL-NWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKG--------------------DFDVNLKKPNVDVYINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 1911          

HSP 40 Score: 132.494 bits (332), Expect = 1.392e-33
Identity = 121/302 (40.07%), Postives = 172/302 (56.95%), Query Frame = 1
Query:  247 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVD----------------IHGNRAKGNVDVTFN--KPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+D   PE+D D                I+      ++D+     K D+++ ++ P++DI++DGKKKKHG++I LP  K   FEGK KKPK E+D+  + P +DIDI GKK +   D+++ KP+ DIDI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P   ID+  KK   D+D++    ++D+DVDGKKKKHG  INLP
Sbjct:  209 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDTNTPEIDFDGNAKKSKDKLKKGKLDINVEEPYASIDIQGKKLKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDFEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLP 492          
BLAST of SMED30001359 vs. Planmine SMEST
Match: SMESG000022407.1 (SMESG000022407.1)

HSP 1 Score: 521.161 bits (1341), Expect = 5.508e-169
Identity = 353/357 (98.88%), Postives = 354/357 (99.16%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDK DADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct: 1339 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKTDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 1695          

HSP 2 Score: 408.297 bits (1048), Expect = 4.403e-129
Identity = 281/357 (78.71%), Postives = 284/357 (79.55%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEID                              VDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINL                                  +    +N   KGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct:  850 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEID------------------------------VDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINL----------------------------------QIGNFQNLVIKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 1142          

HSP 3 Score: 375.555 bits (963), Expect = 1.095e-117
Identity = 265/325 (81.54%), Postives = 271/325 (83.38%), Query Frame = 1
Query:   97 LDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            +   L   ++ K   +LKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIE+                     KFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK                   DIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDIN  EIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHG  INLP
Sbjct:   69 IRYQLARLEITKIRRELKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEI-----------------GSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK-------------------DIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 357          

HSP 4 Score: 303.908 bits (777), Expect = 8.934e-93
Identity = 217/381 (56.96%), Postives = 266/381 (69.82%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKK---------HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKKHGFGINLP 1071
            DVNLKKPN+D+DINKPDIDIDLD D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDIDGKK          + + D+ ++KP  DIDID+DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P +D+D++            KKKKHG  INLP
Sbjct:  538 DVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKP--DIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 887          

HSP 5 Score: 293.893 bits (751), Expect = 2.917e-89
Identity = 192/349 (55.01%), Postives = 240/349 (68.77%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXX-------XXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            HGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DI G + KG++DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+        DIDID+D+ +KKKKHG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKKKHG   NLP
Sbjct: 1135 HGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 1452          

HSP 6 Score: 286.189 bits (731), Expect = 1.425e-86
Identity = 209/368 (56.79%), Postives = 271/368 (73.64%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP--DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXX-------XXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+DVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DI GKKPKG+ID+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KP  D+D++ID KKKKHG++I LP  K  KFEGK KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID        ++D+  KKKKHG+D NLP+WK PKF  K KK KG++D+DI  PE+D                  +D++      ++D+    +K D+++ ++ P++DI++DGKKKKHG  I LP
Sbjct: 1183 DVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD------------------VDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 1528          

HSP 7 Score: 282.337 bits (721), Expect = 2.463e-85
Identity = 210/392 (53.57%), Postives = 269/392 (68.62%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXX-------XXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASI--DIQGKKHK-----------------------GDIDVHLSIPEVDIDVDGKKKKHGFGINL 1068
            DVNLKKPN+DVDINKPDID+D+D   KK  HG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PN+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DI G + KG++DV   K ++++DI KPD+DI+  +DGKKKKHG  I LP  K   FEGK  KPK E+D+ V+ P +DIDI GKK +   D+++ KP+        DIDID+D+ +KKKKHG+DINLP+WK PKF  K KK KG +D++    ++D  G   K +     K   +D++   PD  I  DI GKK K                       G+ID+ +  PEVDID+ GKK K GF +N 
Sbjct: 1736 DVNLKKPNVDVDINKPDIDLDVDGKKKK--HGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNF 2125          

HSP 8 Score: 273.478 bits (698), Expect = 3.427e-82
Identity = 189/371 (50.94%), Postives = 244/371 (65.77%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKK---------HRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQ-----------GKKHKGDIDVHL---------------------SIPEVDIDVDGKKKKHGFGINL 1068
            HGLDINLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDID+  D+DGKKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+DI+  +DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDIDGKK          + + D+ ++KPD DID+D  V  KKKKHG  INLP+WK P F  K  K KG++D+D+  PE+D D + KK K         IDVN++ P+  +DI             KK K  +D++L                       P++D+D+ GKK K    +N+
Sbjct: 1688 HGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLD--VDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGD-------IDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNV 2047          

HSP 9 Score: 269.24 bits (687), Expect = 8.945e-81
Identity = 202/355 (56.90%), Postives = 253/355 (71.27%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP--DMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXX-------XXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD 1032
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DI GKKPKG+ID+N+K  N+D+D +KPDIDI++D+DGKKKKHG   NLPDWKLP FEGK+ KPKGE+DID+ GPEVD+DIHG + KG++DV   KP++++DI KP  D+D++ID KKKKHG++I LP  K  KFEGK KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID        ++D+  KKKKHG+D NLP+WK PKF  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+   P +DID++
Sbjct: 1812 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGGFDVNFKKPNIDIDIN 2135          

HSP 10 Score: 257.299 bits (656), Expect = 1.385e-76
Identity = 208/370 (56.22%), Postives = 259/370 (70.00%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHK--GDIDVHLS--IPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPNIDVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK+KKPKG +D  VE P++D+DIHGKK KG+ D+N+K PN+D+D +KPDIDI++DID KKKKHGLD NLPDWKLPKFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE  IDGKKKKHG++  LP  K  KFEGK KKPK E+D+ ++ P +D+DI G + + + D++ +KPD +IDI       ++  KKKKHGI+I LP+ K  KF  K KK K +VDL + TP ID                             IDI GKKH+  GD+ V  +    ++DIDV  KKKKHG  INLP
Sbjct: 1261 DVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSID-----------------------------IDIDGKKHRISGDLSVDKTDADIDIDIDVSNKKKKHGIDINLP 1599          

HSP 11 Score: 256.144 bits (653), Expect = 3.388e-76
Identity = 201/366 (54.92%), Postives = 253/366 (69.13%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDI--EIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            DVNLKKPN+DVDINKPDIDIDLD+D KKKKHG  INLPDWKLP FEGK++K                  +K +G+ D+N+K PNVDID +KPDIDI++D D KKKKHG   NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG +AKG+ DV   KP++++DI KPD+DI  ++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P   ID+  KK   D+D++    ++D+DVDGKKKKHGFGINLP
Sbjct:  474 DVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVQKSTLTF------------MEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLP 809          

HSP 12 Score: 253.447 bits (646), Expect = 2.479e-75
Identity = 155/172 (90.12%), Postives = 164/172 (95.35%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 516
            DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGK+KKPKGE+DID+ GPEVD+DIHG + KG  DV F KP+++IDI KPD+
Sbjct: 1968 DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNFKKPNIDIDINKPDI 2139          

HSP 13 Score: 249.595 bits (636), Expect = 5.639e-74
Identity = 177/365 (48.49%), Postives = 227/365 (62.19%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+D+++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK P F  K KK KG++D+D+  PE+D                  ID++ + P   ID+  KK   D+D++    ++D+DVDGKKKKHGFGINLP
Sbjct: 1592 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD------------------IDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLP 1927          

HSP 14 Score: 235.728 bits (600), Expect = 3.548e-69
Identity = 184/411 (44.77%), Postives = 233/411 (56.69%), Query Frame = 1
Query:   91 HGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-------XVSNKKKKHGIDINLPNWX--------XXXXXXXXXXXXGQVDLDINTPEIDFXXXX---------------------------XXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            HG+DINLP+WK PKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKL  FEGK+KK KGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+D+++DGKKKKHG  I LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+        DV  KKKKHG  INLP+WK                +K++G  D+++  P +D D N                               + K K  KG+ID++VE P+  IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct:  254 HGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVQKSTLTFMEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 653          

HSP 15 Score: 168.703 bits (426), Expect = 6.073e-46
Identity = 167/456 (36.62%), Postives = 218/456 (47.81%), Query Frame = 1
Query:    1 DVNLKKPNIDVXXXXXXXXXXXXXXXXXXXHGLDINLPDWKLPKFEGKLKKPKGALDVE--APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVD------------------------IDGKK--------------------------KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGN-------VDVTFNKPDLEIDI-------------TKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXX-----XVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDAS-----------IDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKKHGFGINLP 1071
            D+N+K PN+D+D                  H  DI++      KFEGKLKKPKG LD++   P++DVDIHG + KG +D+    P+++ID  KPD+DIE+D                        IDGKK                          KKHG+D NLP+WK PKF  K KK KG++D+DI   E+D D +  ++K         +DV    PD  IDI             + P++DI++DGKKKKHG++I LP  K   FEGK KK K E+D+ V+ P +DIDI GKK +   D+++ KP+ D+DI+      DV  KKKKHG  INLP+WK P                                          +  V+ P              IDI GKK KGD DV+L  P VD+           DVDGKKKKHGFGINLP
Sbjct:  113 DLNVKNPNVDIDF-----------------HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDLDVDGKKKKHGFGINLPDWKLPT----------------------------------------FEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 511          

HSP 16 Score: 146.747 bits (369), Expect = 1.826e-38
Identity = 114/241 (47.30%), Postives = 145/241 (60.17%), Query Frame = 1
Query:  412 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKG---------------------KKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPXXXXXXXXXVSNKKKKHGIDINLPNWXXXXXXXXXXXXXGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGFGINLP 1071
            GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLK+  +                      KKPK  +D  V+ P ID+DI GKK +   DL+V  P+ DID           H  DI++    + KF  K KK KG++D+DI  PE+D                  +D++      ++D+    +K D+++ ++ P++DI++DGKKKKHG  I LP
Sbjct:    1 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGALD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDF----------HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVD------------------VDIHGNRAKGNVDVTF--NKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 209          

HSP 17 Score: 53.5286 bits (127), Expect = 1.983e-7
Identity = 23/23 (100.00%), Postives = 23/23 (100.00%), Query Frame = 3
Query:   75 QQEKETWIRYQLARLEITKIRRE 143
            QQEKETWIRYQLARLEITKIRRE
Sbjct:   62 QQEKETWIRYQLARLEITKIRRE 84          
The following BLAST results are available for this feature:
BLAST of SMED30001359 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AHNAK2.119e-1230.68AHNAK nucleoprotein [Source:HGNC Symbol;Acc:HGNC:3... [more]
AHNAK22.391e-1125.31AHNAK nucleoprotein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of SMED30001359 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001359 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001359 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ahnak2.314e-1430.52AHNAK nucleoprotein [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
si:ch211-125o16.49.288e-1128.71si:ch211-125o16.4 [Source:ZFIN;Acc:ZDB-GENE-131120... [more]
BX005403.11.642e-1028.22si:ch211-125o16.4 [Source:NCBI gene;Acc:566639][more]
prx8.485e-730.70periaxin [Source:ZFIN;Acc:ZDB-GENE-030131-5790][more]
prx8.485e-730.70periaxin [Source:ZFIN;Acc:ZDB-GENE-030131-5790][more]
back to top
BLAST of SMED30001359 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000032614.12.526e-1331.54pep primary_assembly:Xenopus_tropicalis_v9.1:4:413... [more]
ENSXETT00000017745.12.666e-1331.54pep primary_assembly:Xenopus_tropicalis_v9.1:4:413... [more]
ENSXETT00000017705.12.900e-1331.54pep primary_assembly:Xenopus_tropicalis_v9.1:4:413... [more]
ENSXETT00000017926.13.044e-1331.54pep primary_assembly:Xenopus_tropicalis_v9.1:4:413... [more]
ENSXETT00000032387.13.070e-1331.54pep primary_assembly:Xenopus_tropicalis_v9.1:4:413... [more]
back to top
BLAST of SMED30001359 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ahnak6.420e-1230.08AHNAK nucleoprotein (desmoyokin) [Source:MGI Symbo... [more]
Ahnak22.380e-825.29AHNAK nucleoprotein 2 [Source:MGI Symbol;Acc:MGI:2... [more]
MF597757.24.334e-825.30pep chromosome:GRCm38:CHR_MG3490_PATCH:112777125:1... [more]
MF597757.24.334e-825.30pep chromosome:GRCm38:CHR_MG3490_PATCH:112777125:1... [more]
Ahnak25.671e-825.40AHNAK nucleoprotein 2 [Source:MGI Symbol;Acc:MGI:2... [more]
back to top
BLAST of SMED30001359 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q09666|AHNK_HUMAN1.017e-1130.68Neuroblast differentiation-associated protein AHNA... [more]
sp|Q8IVF2|AHNK2_HUMAN1.148e-1025.31Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2 P... [more]
back to top
BLAST of SMED30001359 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K2VA862.028e-1532.10Neuroblast differentiationassociated protein AHNAK... [more]
A0A3B4URF81.765e-1433.23Uncharacterized protein OS=Seriola dumerili OX=414... [more]
A0A3B3DV465.534e-1429.14Uncharacterized protein OS=Oryzias melastigma OX=3... [more]
H2LD515.674e-1430.68AHNAK nucleoprotein OS=Oryzias latipes OX=8090 GN=... [more]
A0A402EPP96.501e-1432.36PDZ domain-containing protein OS=Paroedura picta O... [more]
back to top
BLAST of SMED30001359 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039323.19.348e-1427.46pep primary_assembly:Astyanax_mexicanus-2.0:24:370... [more]
ENSAMXT00000036931.13.283e-1227.78pep primary_assembly:Astyanax_mexicanus-2.0:24:370... [more]
ENSAMXT00000011221.21.740e-928.87pep primary_assembly:Astyanax_mexicanus-2.0:9:1257... [more]
ENSAMXT00000011223.22.152e-928.87pep primary_assembly:Astyanax_mexicanus-2.0:9:1257... [more]
ENSAMXT00000033698.11.760e-832.57pep primary_assembly:Astyanax_mexicanus-2.0:5:1489... [more]
back to top
BLAST of SMED30001359 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002063.12.346e-1329.05pep scaffold:Pmarinus_7.0:GL491826:26:5749:-1 gene... [more]
ENSPMAT00000001909.13.438e-1333.48pep scaffold:Pmarinus_7.0:GL476451:21233:28988:1 g... [more]
ENSPMAT00000004925.11.683e-1028.79pep scaffold:Pmarinus_7.0:GL480373:16762:23670:1 g... [more]
ENSPMAT00000010813.11.168e-925.68pep scaffold:Pmarinus_7.0:GL477610:65266:75627:1 g... [more]
back to top
BLAST of SMED30001359 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001359 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO335691.013e-1028.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30001359 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AHNAK2.136e-1730.68AHNAK nucleoprotein [Source:NCBI gene;Acc:10116197... [more]
AHNAK5.884e-1730.99AHNAK nucleoprotein [Source:NCBI gene;Acc:10116197... [more]
AHNAK5.884e-1730.99AHNAK nucleoprotein [Source:NCBI gene;Acc:10116197... [more]
ENSORLT00000002200.22.059e-931.06pep primary_assembly:ASM223467v1:13:4398514:442597... [more]
ENSORLT00000000108.24.674e-626.18neuroblast differentiation-associated protein AHNA... [more]
back to top
BLAST of SMED30001359 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022407.14.463e-16998.88SMESG000022407.1[more]
SMESG000022407.15.326e-16998.88SMESG000022407.1[more]
SMESG000022407.15.329e-16998.88SMESG000022407.1[more]
SMESG000052306.15.490e-16999.44SMESG000052306.1[more]
SMESG000022407.15.508e-16998.88SMESG000022407.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001359 ID=SMED30001359|Name=SMED30001359|organism=Schmidtea mediterranea sexual|type=transcript|length=1071bp
GATGTCAATTTGAAGAAACCGAATATTGATGTAGACATTAATAAACCAGA
TATTGATATTGATCTAGATATCGACAGCAAGAAAAAGAAACATGGATTAG
ATATCAACTTGCCAGATTGGAAATTACCAAAATTCGAAGGGAAACTTAAA
AAACCGAAAGGAGCTTTAGATGTTGAAGCACCTGACATCGACGTTGACAT
TCATGGAAAGAAACCGAAAGGCGAAATAGATCTCAATGTAAAGAACCCAA
ATGTCGATATAGATTTTCATAAACCGGATATTGATATTGAAGTTGATATC
GATGGAAAGAAAAAGAAACATGGATTAGACTTTAATTTACCAGATTGGAA
GTTACCAAAATTCGAAGGAAAACTTAAAAAACCTAAAGGAGAATTGGATA
TCGATATTAGGGGACCAGAAGTTGATGTTGATATTCATGGCAATAGAGCA
AAAGGAAATGTTGATGTTACTTTTAATAAGCCAGATCTTGAAATAGACAT
CACTAAACCGGATATGGATATTGAGATCGATGGTAAGAAAAAGAAACATG
GAATAAATATTGGGTTACCAAGCATGAAAGGCTTGAAGTTTGAAGGAAAA
GGTAAAAAACCAAAATCTGAAGTTGATTTGGGTGTTAAAACACCATCTAT
TGACATAGATATTGATGGAAAGAAACATAGGATTTCAGGTGATTTGAGTG
TTGATAAACCTGATGCTGATATTGATATTGATATTGATGTGAGTAATAAA
AAGAAAAAACATGGAATAGATATTAATTTACCAAATTGGAAATTTCCAAA
ATTTAGTAATAAAAGTAAGAAATCTAAAGGACAGGTTGATCTCGATATAA
ATACTCCTGAAATCGATTTCGATGGAAATGCCAAAAAATCTAAAGATAAA
AATAAATCGAAAAAGGGAAAAATAGATGTTAATGTTGAAGTACCAGATGC
TAGCATCGATATTCAGGGAAAGAAGCATAAAGGAGACATTGATGTTCATT
TGAGTATCCCAGAAGTTGATATTGATGTCGACGGCAAGAAAAAGAAACAT
GGGTTTGGTATCAACTTACCT
back to top

protein sequence of SMED30001359-orf-1

>SMED30001359-orf-1 ID=SMED30001359-orf-1|Name=SMED30001359-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=357bp
DVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLK
KPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDI
DGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRA
KGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGK
GKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNK
KKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDK
NKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKH
GFGINLP
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000463cholinergic neuron
PLANA:0000478pharynx musculature
PLANA:0002032epidermal cell
Vocabulary: biological process
TermDefinition
GO:0051259protein oligomerization
GO:0043484regulation of RNA splicing
GO:1901385regulation of voltage-gated calcium channel activity
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
GO:0044548S100 protein binding
GO:0045296cadherin binding
GO:0097493structural molecule activity conferring elasticity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005765lysosomal membrane
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0015629actin cytoskeleton
GO:0016020membrane
GO:0030315T-tubule
GO:0031982vesicle
GO:0042383sarcolemma
GO:0043034costamere
GO:0044291cell-cell contact zone
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 289..311
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 267..311
NoneNo IPR availablePANTHERPTHR23348PERIAXIN/AHNAKcoord: 3..347