SMED30001347

Overview
NameSMED30001347
Smed IDSMED30001347
Length (bp)470
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30001347 (SMED30001347) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30001347 (SMED30001347) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001347 (SMED30001347) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001347 (SMED30001347) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001347

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30001347SMESG000053274.1 dd_Smed_v4_6857_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001347SMESG000053274.1 dd_Smed_v4_6857_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001347SMESG000053274.1 dd_Smed_v4_6857_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001347SMESG000053274.1 dd_Smed_v4_6857_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001347SMESG000053274.1 dd_Smed_v6_6857_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001347SMESG000053274.1 dd_Smed_v4_6857_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30001347 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.007292:21684..22191 +2219
v31.010311:5937..6440 -2207
Homology
BLAST of SMED30001347 vs. Ensembl Human
Match: MORN2 (MORN repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:30166])

HSP 1 Score: 105.145 bits (261), Expect = 6.498e-29
Identity = 59/123 (47.97%), Postives = 75/123 (60.98%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            SFIF NGD Y+G+    SS    R G GI  T + I+Y G + +D M G G L   SGA YEG F +NMFHG G YTFP+G+ Y GNF++NR+ G G++ D     W G F  T A +LK +L
Sbjct:   27 SFIFPNGDKYDGDCTRTSSGIYERNGIGIHTTPNGIVYTGSWKDDKMNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKL 149          
BLAST of SMED30001347 vs. Ensembl Human
Match: MORN2 (MORN repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:30166])

HSP 1 Score: 72.4034 bits (176), Expect = 6.179e-17
Identity = 39/77 (50.65%), Postives = 49/77 (63.64%), Query Frame = 1
Query:  175 MQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            M G G L   SGA YEG F +NMFHG G YTFP+G+ Y GNF++NR+ G G++ D     W G F  T A +LK +L
Sbjct:    1 MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKL 77          

HSP 2 Score: 51.2174 bits (121), Expect = 7.315e-9
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  136 SSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNF 300
            S  +Y+G+F +++  G GT TFP+GAKY G+F  N   GEG+YT   G  + GNF
Sbjct:   11 SGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNF 65          
BLAST of SMED30001347 vs. Ensembl Human
Match: MORN2 (MORN repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:30166])

HSP 1 Score: 72.4034 bits (176), Expect = 6.179e-17
Identity = 39/77 (50.65%), Postives = 49/77 (63.64%), Query Frame = 1
Query:  175 MQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            M G G L   SGA YEG F +NMFHG G YTFP+G+ Y GNF++NR+ G G++ D     W G F  T A +LK +L
Sbjct:    1 MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKL 77          

HSP 2 Score: 51.2174 bits (121), Expect = 7.315e-9
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  136 SSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNF 300
            S  +Y+G+F +++  G GT TFP+GAKY G+F  N   GEG+YT   G  + GNF
Sbjct:   11 SGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNF 65          
BLAST of SMED30001347 vs. Ensembl Human
Match: MORN2 (MORN repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:30166])

HSP 1 Score: 72.4034 bits (176), Expect = 6.179e-17
Identity = 39/77 (50.65%), Postives = 49/77 (63.64%), Query Frame = 1
Query:  175 MQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            M G G L   SGA YEG F +NMFHG G YTFP+G+ Y GNF++NR+ G G++ D     W G F  T A +LK +L
Sbjct:    1 MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKL 77          

HSP 2 Score: 51.2174 bits (121), Expect = 7.315e-9
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  136 SSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNF 300
            S  +Y+G+F +++  G GT TFP+GAKY G+F  N   GEG+YT   G  + GNF
Sbjct:   11 SGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNF 65          
BLAST of SMED30001347 vs. Ensembl Human
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 61.2326 bits (147), Expect = 5.422e-11
Identity = 39/107 (36.45%), Postives = 54/107 (50.47%), Query Frame = 1
Query:   58 DTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF-FDTNRETWIGAFDN 375
            ++YEGE +       + +G+G +  +    Y G F   LM G GT  +  G KYEGDF+ N+    G YT+PDGS YEG        G G F   T   ++IG + N
Sbjct:   84 ESYEGEKVRG-----LYEGEGFAAFQGGCTYRGMFSEGLMHGQGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCN 185          

HSP 2 Score: 51.9878 bits (123), Expect = 6.925e-8
Identity = 25/58 (43.10%), Postives = 35/58 (60.34%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIG 321
            Y GEFVN    G G   + SGA Y+G++++N  HG G+ TF +G  YEG F  + + G
Sbjct:  284 YIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAG 341          

HSP 3 Score: 48.521 bits (114), Expect = 1.148e-6
Identity = 34/138 (24.64%), Postives = 60/138 (43.48%), Query Frame = 1
Query:   64 YEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTL----------------------------------TFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDN 375
            YEG+++ +     I++G GI   KS  IY+G++ +++  G G +                                   +P   +Y G+F+N   HG GK+ +  G+ Y+G +  N+  G+G+    N   + GAF N
Sbjct:  204 YEGDWVQN-----IKKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN 336          
BLAST of SMED30001347 vs. Ensembl Celegans
Match: jph-1 (JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667])

HSP 1 Score: 47.3654 bits (111), Expect = 1.273e-6
Identity = 29/74 (39.19%), Postives = 41/74 (55.41%), Query Frame = 1
Query:  103 IRQGKGISVTKSSI-IYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIG 321
            ++Q +  +V +SSI  Y GE+ ND+  G G      G KY+G++ NN   G G  TF DG+  EG +  N LI 
Sbjct:  267 LQQPEEEAVEESSIETYMGEWKNDMRSGFGVCERSDGLKYQGEWANNAKCGYGVTTFKDGTKEEGRYKNNILIA 340          
BLAST of SMED30001347 vs. Ensembl Fly
Match: rtp (gene:FBgn0087005 transcript:FBtr0078825)

HSP 1 Score: 57.3806 bits (137), Expect = 1.629e-10
Identity = 29/60 (48.33%), Postives = 35/60 (58.33%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIG 327
            YDG+F   L QG G L F  GAKYEG+F    FHG G +   DG  YEG F   ++ G+G
Sbjct:   88 YDGQFQEGLSQGVGCLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEGEFRGGKIWGLG 147          
BLAST of SMED30001347 vs. Ensembl Fly
Match: CG5458 (gene:FBgn0032478 transcript:FBtr0080437)

HSP 1 Score: 55.4546 bits (132), Expect = 1.946e-9
Identity = 32/97 (32.99%), Postives = 50/97 (51.55%), Query Frame = 1
Query:   43 IFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF 333
            I  NGD Y+G Y         R G G+ V K    Y G++      G G   +P G+ YEG++  N+ HG+G+Y + +G  Y G++ K +  G+G +
Sbjct:   44 ILPNGDQYDGNYRKGR-----RHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVGIY 135          

HSP 2 Score: 53.5286 bits (127), Expect = 7.789e-9
Identity = 30/88 (34.09%), Postives = 44/88 (50.00%), Query Frame = 1
Query:   70 GEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF 333
            G YI   +    RQG+G ++  +   YDG +      G G   F  G++Y G +      G G + +PDGS YEGN+ KN   G G++
Sbjct:   25 GLYIGGRNAAGQRQGRGWAILPNGDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHGKGRY 112          
BLAST of SMED30001347 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0079861)

HSP 1 Score: 46.9802 bits (110), Expect = 1.811e-6
Identity = 25/57 (43.86%), Postives = 31/57 (54.39%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLI 318
            Y GE+  D   G+G      G KYEG++ NN  HG G  TF DG+  EG +  N LI
Sbjct:  334 YMGEWKKDKRCGHGVAERSDGLKYEGEWYNNRKHGYGVTTFRDGTVEEGKYKNNILI 390          
BLAST of SMED30001347 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0079860)

HSP 1 Score: 46.9802 bits (110), Expect = 1.811e-6
Identity = 25/57 (43.86%), Postives = 31/57 (54.39%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLI 318
            Y GE+  D   G+G      G KYEG++ NN  HG G  TF DG+  EG +  N LI
Sbjct:  334 YMGEWKKDKRCGHGVAERSDGLKYEGEWYNNRKHGYGVTTFRDGTVEEGKYKNNILI 390          
BLAST of SMED30001347 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0304056)

HSP 1 Score: 46.9802 bits (110), Expect = 1.811e-6
Identity = 25/57 (43.86%), Postives = 31/57 (54.39%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLI 318
            Y GE+  D   G+G      G KYEG++ NN  HG G  TF DG+  EG +  N LI
Sbjct:  334 YMGEWKKDKRCGHGVAERSDGLKYEGEWYNNRKHGYGVTTFRDGTVEEGKYKNNILI 390          
BLAST of SMED30001347 vs. Ensembl Zebrafish
Match: morn2 (MORN repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-060825-230])

HSP 1 Score: 117.472 bits (293), Expect = 3.160e-34
Identity = 61/122 (50.00%), Postives = 74/122 (60.66%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            ++F NGD YEGE    S  G+IR+G G   + S   Y GE+ ND M G GTLT PSGA Y G F  NM+HG+G Y FPDGS Y G+F+ NR  G G+F D+    W G F N  A  LK Q+
Sbjct:   10 YVFPNGDKYEGECCRTSD-GVIRKGSGTQTSASGATYTGEWDNDKMNGRGTLTHPSGAFYSGLFRENMYHGKGTYRFPDGSEYTGSFNNNRFEGDGEFTDSQGLVWTGMFHNKAALGLKLQV 130          
BLAST of SMED30001347 vs. Ensembl Zebrafish
Match: CR626962.3 (pep chromosome:GRCz11:CHR_ALT_CTG17_1_18:24687572:24688567:-1 gene:ENSDARG00000116467.1 transcript:ENSDART00000181538.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR626962.3)

HSP 1 Score: 80.4925 bits (197), Expect = 2.035e-20
Identity = 41/77 (53.25%), Postives = 48/77 (62.34%), Query Frame = 1
Query:  175 MQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            M G GTLT PSGA Y G F  NM+HG+G Y FPDGS Y G+F+ NR  G G+F D+    W G F N  A  LK Q+
Sbjct:    1 MNGRGTLTHPSGAFYSGLFRENMYHGKGTYRFPDGSEYTGSFNNNRFEGDGEFTDSQGLVWTGMFHNKAALGLKLQV 77          

HSP 2 Score: 48.9062 bits (115), Expect = 3.603e-8
Identity = 25/71 (35.21%), Postives = 36/71 (50.70%), Query Frame = 1
Query:  112 GKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGI 324
            G+G     S   Y G F  ++  G GT  FP G++Y G F NN F G+G++T   G  + G F     +G+
Sbjct:    3 GRGTLTHPSGAFYSGLFRENMYHGKGTYRFPDGSEYTGSFNNNRFEGDGEFTDSQGLVWTGMFHNKAALGL 73          
BLAST of SMED30001347 vs. Ensembl Zebrafish
Match: CT573248.3 (radial spoke head component 1 [Source:NCBI gene;Acc:100003444])

HSP 1 Score: 65.4698 bits (158), Expect = 3.686e-13
Identity = 39/118 (33.05%), Postives = 61/118 (51.69%), Query Frame = 1
Query:   16 MQDILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAF 369
            M D+  + F    G    GEY  D +    R G+G +V  +   Y G + N      GT  F +GA+Y G++  N+ HGEG + +PDGS YEG +  ++  G+G +   N +T+ G +
Sbjct:    1 MSDVGSEEFDEERGSL--GEYEGDRNEAGERHGQGKAVLPNGDTYQGAYENGKRSSQGTYKFKNGARYTGEWYMNLKHGEGTFYYPDGSKYEGTWVDDQRQGLGVYTYPNGDTYDGEW 116          

HSP 2 Score: 64.6994 bits (156), Expect = 5.904e-13
Identity = 39/111 (35.14%), Postives = 59/111 (53.15%), Query Frame = 1
Query:   43 IFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGK--FFDTNRE---TWI 360
            +  NGDTY+G Y N       R  +G    K+   Y GE+  +L  G GT  +P G+KYEG ++++   G G YT+P+G  Y+G +  ++  G G   + DT  +   TWI
Sbjct:   36 VLPNGDTYQGAYENGK-----RSSQGTYKFKNGARYTGEWYMNLKHGEGTFYYPDGSKYEGTWVDDQRQGLGVYTYPNGDTYDGEWLHHQRHGQGAYTYHDTGSQYVGTWI 141          
BLAST of SMED30001347 vs. Ensembl Zebrafish
Match: RSPH1 (radial spoke head component 1 [Source:NCBI gene;Acc:100003444])

HSP 1 Score: 65.4698 bits (158), Expect = 3.686e-13
Identity = 39/118 (33.05%), Postives = 61/118 (51.69%), Query Frame = 1
Query:   16 MQDILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAF 369
            M D+  + F    G    GEY  D +    R G+G +V  +   Y G + N      GT  F +GA+Y G++  N+ HGEG + +PDGS YEG +  ++  G+G +   N +T+ G +
Sbjct:    1 MSDVGSEEFDEERGSL--GEYEGDRNEAGERHGQGKAVLPNGDTYQGAYENGKRSSQGTYKFKNGARYTGEWYMNLKHGEGTFYYPDGSKYEGTWVDDQRQGLGVYTYPNGDTYDGEW 116          

HSP 2 Score: 64.6994 bits (156), Expect = 5.904e-13
Identity = 39/111 (35.14%), Postives = 59/111 (53.15%), Query Frame = 1
Query:   43 IFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGK--FFDTNRE---TWI 360
            +  NGDTY+G Y N       R  +G    K+   Y GE+  +L  G GT  +P G+KYEG ++++   G G YT+P+G  Y+G +  ++  G G   + DT  +   TWI
Sbjct:   36 VLPNGDTYQGAYENGK-----RSSQGTYKFKNGARYTGEWYMNLKHGEGTFYYPDGSKYEGTWVDDQRQGLGVYTYPNGDTYDGEWLHHQRHGQGAYTYHDTGSQYVGTWI 141          
BLAST of SMED30001347 vs. Ensembl Zebrafish
Match: morn4 (MORN repeat containing 4 [Source:ZFIN;Acc:ZDB-GENE-050417-7])

HSP 1 Score: 62.7734 bits (151), Expect = 7.931e-13
Identity = 37/97 (38.14%), Postives = 49/97 (50.52%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIG 327
            SF +S+G+ Y GE+         R GKG         Y G F N L  G+G L FP G++YEG+F    F G G ++  DG  +EG F   R+ G G
Sbjct:    7 SFTYSSGEEYTGEWKEGR-----RHGKGELKFADGTCYKGHFENGLFHGSGVLVFPDGSRYEGEFAQGKFQGVGIFSRFDGMKFEGEFKSGRVEGHG 98          

HSP 2 Score: 56.6102 bits (135), Expect = 1.628e-10
Identity = 28/62 (45.16%), Postives = 34/62 (54.84%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF 333
            Y GE+      G G L F  G  Y+G F N +FHG G   FPDGS YEG F + +  G+G F
Sbjct:   16 YTGEWKEGRRHGKGELKFADGTCYKGHFENGLFHGSGVLVFPDGSRYEGEFAQGKFQGVGIF 77          
BLAST of SMED30001347 vs. Ensembl Xenopus
Match: MORN2 (MORN repeat containing 2 [Source:NCBI gene;Acc:100488991])

HSP 1 Score: 105.145 bits (261), Expect = 3.816e-29
Identity = 52/123 (42.28%), Postives = 74/123 (60.16%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            S++F NGD Y+GE     S  + R G G+  +   + Y G + ND M G G L  PSGA YEG+F +NMFHG+G Y FP+G+ Y G+F++NR+ G G++ D +   W G F    A  L+ +L
Sbjct:   16 SYVFPNGDRYDGECRRTQSELLERNGTGVHKSLCGLTYSGLWNNDKMNGMGRLEHPSGAVYEGEFTDNMFHGKGTYIFPNGARYIGSFNQNRMEGEGEYVDAHGLQWRGMFHYKAAPGLRLKL 138          
BLAST of SMED30001347 vs. Ensembl Xenopus
Match: MORN4 (Novel protein containing Rieske domain and Protein of unknown function (DUF455) domains [Source:Xenbase;Acc:XB-GENE-5959487])

HSP 1 Score: 62.7734 bits (151), Expect = 1.151e-12
Identity = 38/101 (37.62%), Postives = 53/101 (52.48%), Query Frame = 1
Query:   25 ILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIG 327
            ++  SF +S+G+ Y GE+         R G G  +     IY G+F N L  G G LTFP G++YEG+F+   F G G +T  D   +EG F   R+ G G
Sbjct:    3 LIKGSFKYSSGEEYHGEWKEGR-----RHGIGQLLFADGSIYVGQFENGLFSGCGVLTFPDGSRYEGEFVQGKFQGTGVFTRYDNMKFEGEFKGGRVEGYG 98          

HSP 2 Score: 50.8322 bits (120), Expect = 4.474e-8
Identity = 28/62 (45.16%), Postives = 33/62 (53.23%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF 333
            Y GE+      G G L F  G+ Y G F N +F G G  TFPDGS YEG F + +  G G F
Sbjct:   16 YHGEWKEGRRHGIGQLLFADGSIYVGQFENGLFSGCGVLTFPDGSRYEGEFVQGKFQGTGVF 77          
BLAST of SMED30001347 vs. Ensembl Xenopus
Match: ENSXETT00000041411.1 (radial spoke head 10 homolog B (Chlamydomonas) [Source:NCBI gene;Acc:779504])

HSP 1 Score: 53.5286 bits (127), Expect = 1.708e-8
Identity = 32/82 (39.02%), Postives = 42/82 (51.22%), Query Frame = 1
Query:  109 QGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRET 354
            +G+G++  K   IY G F   +M G G  T+  G  YEGDF  N   G G Y + DGS YEG   K    G G F  +N++ 
Sbjct:    2 EGEGVAYFKDGNIYRGMFSEGMMHGKGKYTWKDGLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKV 83          

HSP 2 Score: 46.595 bits (109), Expect = 4.657e-6
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGIIRQGKGI-SVTKSSIIYDGEFVNDLMQGNGTLTF--PSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF-FDTNRETWIGAFDNTCAN 387
            + +S+G  YEGE         IR G GI + +   + Y G++      G G + +     + YEGD+++N   G G   F  G+ YEG +  N   G+GK  + T+ E + G ++N   N
Sbjct:   53 YKWSDGSQYEGEVYKA-----IRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQN 167          
BLAST of SMED30001347 vs. Ensembl Xenopus
Match: ENSXETT00000041392.1 (radial spoke head 10 homolog B (Chlamydomonas) [Source:NCBI gene;Acc:779504])

HSP 1 Score: 53.5286 bits (127), Expect = 1.814e-8
Identity = 32/82 (39.02%), Postives = 42/82 (51.22%), Query Frame = 1
Query:  109 QGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRET 354
            +G+G++  K   IY G F   +M G G  T+  G  YEGDF  N   G G Y + DGS YEG   K    G G F  +N++ 
Sbjct:    2 EGEGVAYFKDGNIYRGMFSEGMMHGKGKYTWKDGLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKV 83          

HSP 2 Score: 46.595 bits (109), Expect = 5.135e-6
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGIIRQGKGI-SVTKSSIIYDGEFVNDLMQGNGTLTF--PSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF-FDTNRETWIGAFDNTCAN 387
            + +S+G  YEGE         IR G GI + +   + Y G++      G G + +     + YEGD+++N   G G   F  G+ YEG +  N   G+GK  + T+ E + G ++N   N
Sbjct:   53 YKWSDGSQYEGEVYK-----AIRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQN 167          
BLAST of SMED30001347 vs. Ensembl Xenopus
Match: ENSXETT00000041404.1 (radial spoke head 10 homolog B (Chlamydomonas) [Source:NCBI gene;Acc:779504])

HSP 1 Score: 53.5286 bits (127), Expect = 1.884e-8
Identity = 32/82 (39.02%), Postives = 42/82 (51.22%), Query Frame = 1
Query:  109 QGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRET 354
            +G+G++  K   IY G F   +M G G  T+  G  YEGDF  N   G G Y + DGS YEG   K    G G F  +N++ 
Sbjct:    2 EGEGVAYFKDGNIYRGMFSEGMMHGKGKYTWKDGLTYEGDFYMNFPMGHGIYKWSDGSQYEGEVYKAIRHGHGIFTSSNQKV 83          

HSP 2 Score: 49.2914 bits (116), Expect = 5.511e-7
Identity = 35/118 (29.66%), Postives = 65/118 (55.08%), Query Frame = 1
Query:   46 FSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLT----------FPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAF 369
            F +G+ YEG++ N+   G+   GK   +T S+  Y G++ N +  G+GT T          +    +Y G+F+N +  G+G++ + +G+ Y+G +  N+  G+GKF   N + ++G F
Sbjct:  127 FISGNIYEGQWKNNIFHGM---GKMRWLT-SNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYYANGAMYDGEWKNNKKHGLGKFVFKNGQIYVGEF 240          

HSP 3 Score: 48.9062 bits (115), Expect = 6.735e-7
Identity = 23/56 (41.07%), Postives = 35/56 (62.50%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRL 315
            Y G FVN + QG G   + +GA Y+G++ NN  HG GK+ F +G  Y G F ++++
Sbjct:  190 YVGNFVNGIRQGQGQFYYANGAMYDGEWKNNKKHGLGKFVFKNGQIYVGEFVEDQI 245          

HSP 4 Score: 46.595 bits (109), Expect = 5.284e-6
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGIIRQGKGI-SVTKSSIIYDGEFVNDLMQGNGTLTF--PSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF-FDTNRETWIGAFDNTCAN 387
            + +S+G  YEGE         IR G GI + +   + Y G++      G G + +     + YEGD+++N   G G   F  G+ YEG +  N   G+GK  + T+ E + G ++N   N
Sbjct:   53 YKWSDGSQYEGEVYK-----AIRHGHGIFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQN 167          
BLAST of SMED30001347 vs. Ensembl Mouse
Match: Morn2 (MORN repeat containing 2 [Source:MGI Symbol;Acc:MGI:2674071])

HSP 1 Score: 106.301 bits (264), Expect = 1.729e-29
Identity = 58/122 (47.54%), Postives = 73/122 (59.84%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            FIF NGDTY+G+    +S    R G G   T + I+Y G + +D M G G L   SGA YEG F +NMFHG G YTFP G+ Y GNF++NR+ G G++ DT    W G F  T A  LK +L
Sbjct:   29 FIFPNGDTYDGDCTRTTSGICERNGTGTHTTPNGIVYTGSWKDDKMNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPTGAKYTGNFNENRVEGEGEYTDTQGLQWCGNFHFTAAPGLKLKL 150          
BLAST of SMED30001347 vs. Ensembl Mouse
Match: Morn2 (MORN repeat containing 2 [Source:MGI Symbol;Acc:MGI:2674071])

HSP 1 Score: 73.559 bits (179), Expect = 1.442e-17
Identity = 40/77 (51.95%), Postives = 48/77 (62.34%), Query Frame = 1
Query:  175 MQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            M G G L   SGA YEG F +NMFHG G YTFP G+ Y GNF++NR+ G G++ DT    W G F  T A  LK +L
Sbjct:    1 MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPTGAKYTGNFNENRVEGEGEYTDTQGLQWCGNFHFTAAPGLKLKL 77          
BLAST of SMED30001347 vs. Ensembl Mouse
Match: Rsph1 (radial spoke head 1 homolog (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1194909])

HSP 1 Score: 62.003 bits (149), Expect = 1.117e-11
Identity = 33/100 (33.00%), Postives = 54/100 (54.00%), Query Frame = 1
Query:   70 GEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAF 369
            GEY  + +    R G G +   +   Y+G +      G GT  F +GA+Y GD++ N  HG+G + +PDGS YEG +  ++  G G ++  N +T+ G +
Sbjct:   18 GEYEGERNEVGERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEW 117          

HSP 2 Score: 55.8398 bits (133), Expect = 1.762e-9
Identity = 32/97 (32.99%), Postives = 51/97 (52.58%), Query Frame = 1
Query:   46 FSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFF 336
              NGDTYEG Y      G  R G+G    K+   Y G++V +   G GT  +P G++YEG++ ++  HG+G Y + +   Y G +  ++  G G + 
Sbjct:   38 LPNGDTYEGSY----EFGK-RHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYL 129          

HSP 3 Score: 45.8246 bits (107), Expect = 5.543e-6
Identity = 36/143 (25.17%), Postives = 64/143 (44.76%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPD-GSFYEGNFDKNRLIGI-----------GKFFDTNRETWIGA----FDNTCANNLKFQLTSLD 417
            ++ F NG  Y G+Y+ +      + G+G  +      Y+GE+ +D   G G   + +   Y G++ N+  HG+G Y + + GS Y G +   +  G            GKF + N    +G     FD  C  + +++LT  +
Sbjct:   58 TYKFKNGARYTGDYVKNK-----KHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAAELIHLNHRYQGKFMNKNP---VGPGKYVFDIGCEQHGEYRLTDTE 192          
BLAST of SMED30001347 vs. Ensembl Mouse
Match: Rsph10b (radial spoke head 10 homolog B (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1922386])

HSP 1 Score: 61.2326 bits (147), Expect = 1.304e-11
Identity = 42/120 (35.00%), Postives = 60/120 (50.00%), Query Frame = 1
Query:   58 DTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF-FDTNRETWIGAFDNTCANNLKFQLTSL 414
            ++YEGE +       + +G+G +V +    Y G F   LM G GT  +  G KYEGDF+ N+    G YT+PDGS YEG        G G F   T   ++IG +   C      +++SL
Sbjct:   84 ESYEGEKVRG-----LYEGEGFAVFQGGNTYHGMFSEGLMHGQGTYIWADGLKYEGDFVKNIPMNHGVYTWPDGSTYEGEVTNGMRNGFGMFKCGTQPVSYIGHW---CHGKRHGKVSSL 195          
BLAST of SMED30001347 vs. Ensembl Mouse
Match: Rsph1 (radial spoke head 1 homolog (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1194909])

HSP 1 Score: 61.2326 bits (147), Expect = 2.076e-11
Identity = 30/88 (34.09%), Postives = 49/88 (55.68%), Query Frame = 1
Query:  106 RQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAF 369
            R G G +   +   Y+G +      G GT  F +GA+Y GD++ N  HG+G + +PDGS YEG +  ++  G G ++  N +T+ G +
Sbjct:   13 RHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEW 100          

HSP 2 Score: 55.8398 bits (133), Expect = 1.621e-9
Identity = 32/97 (32.99%), Postives = 51/97 (52.58%), Query Frame = 1
Query:   46 FSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFF 336
              NGDTYEG Y      G  R G+G    K+   Y G++V +   G GT  +P G++YEG++ ++  HG+G Y + +   Y G +  ++  G G + 
Sbjct:   21 LPNGDTYEGSY----EFGK-RHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYL 112          

HSP 3 Score: 45.8246 bits (107), Expect = 4.837e-6
Identity = 36/143 (25.17%), Postives = 64/143 (44.76%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPD-GSFYEGNFDKNRLIGI-----------GKFFDTNRETWIGA----FDNTCANNLKFQLTSLD 417
            ++ F NG  Y G+Y+ +      + G+G  +      Y+GE+ +D   G G   + +   Y G++ N+  HG+G Y + + GS Y G +   +  G            GKF + N    +G     FD  C  + +++LT  +
Sbjct:   41 TYKFKNGARYTGDYVKNK-----KHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAAELIHLNHRYQGKFMNKNP---VGPGKYVFDIGCEQHGEYRLTDTE 175          
BLAST of SMED30001347 vs. UniProt/SwissProt
Match: sp|Q6UL01|MORN2_MOUSE (MORN repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Morn2 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.009e-16
Identity = 40/77 (51.95%), Postives = 48/77 (62.34%), Query Frame = 1
Query:  175 MQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            M G G L   SGA YEG F +NMFHG G YTFP G+ Y GNF++NR+ G G++ DT    W G F  T A  LK +L
Sbjct:    1 MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPTGAKYTGNFNENRVEGEGEYTDTQGLQWCGNFHFTAAPGLKLKL 77          
BLAST of SMED30001347 vs. UniProt/SwissProt
Match: sp|Q502X0|MORN2_HUMAN (MORN repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=MORN2 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.967e-16
Identity = 39/77 (50.65%), Postives = 49/77 (63.64%), Query Frame = 1
Query:  175 MQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            M G G L   SGA YEG F +NMFHG G YTFP+G+ Y GNF++NR+ G G++ D     W G F  T A +LK +L
Sbjct:    1 MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKL 77          

HSP 2 Score: 51.2174 bits (121), Expect = 3.513e-8
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  136 SSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNF 300
            S  +Y+G+F +++  G GT TFP+GAKY G+F  N   GEG+YT   G  + GNF
Sbjct:   11 SGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNF 65          
BLAST of SMED30001347 vs. UniProt/SwissProt
Match: sp|Q27YU0|RSP1_CHLRE (Flagellar radial spoke protein 1 OS=Chlamydomonas reinhardtii OX=3055 GN=RSP1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.233e-16
Identity = 37/101 (36.63%), Postives = 55/101 (54.46%), Query Frame = 1
Query:   46 FSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNR 348
            F NGDTY G Y +D     ++ G G+    +   Y GE+      G G + FP G  Y G+F+ + F G+G+Y +PDGS Y G++   +  G G ++DT R
Sbjct:  571 FPNGDTYFGSYADD-----VKHGPGLYAFATGAGYAGEYAGGKRHGRGVMVFPDGGTYVGEFVADKFEGQGQYRYPDGSVYTGSWAAGQKHGPGVYWDTAR 666          

HSP 2 Score: 50.0618 bits (118), Expect = 1.774e-6
Identity = 23/74 (31.08%), Postives = 37/74 (50.00%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAF 369
            Y G + +D+  G G   F +GA Y G++     HG G   FPDG  Y G F  ++  G G++   +   + G++
Sbjct:  577 YFGSYADDVKHGPGLYAFATGAGYAGEYAGGKRHGRGVMVFPDGGTYVGEFVADKFEGQGQYRYPDGSVYTGSW 650          
BLAST of SMED30001347 vs. UniProt/SwissProt
Match: sp|Q32KU3|MORN2_BOVIN (MORN repeat-containing protein 2 OS=Bos taurus OX=9913 GN=MORN2 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.088e-16
Identity = 38/77 (49.35%), Postives = 48/77 (62.34%), Query Frame = 1
Query:  175 MQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            M G G L   SGA YEG F +NMFHG G YTFP+G+ Y GNF++NR+ G G++ D     W G F  T A  L+ +L
Sbjct:    1 MNGFGRLEHFSGAIYEGHFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGQYTDIQGLEWCGNFHFTAAPGLRLKL 77          

HSP 2 Score: 50.8322 bits (120), Expect = 6.085e-8
Identity = 28/63 (44.44%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  136 SSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGI 324
            S  IY+G F +++  G GT TFP+GAKY G+F  N   GEG+YT   G  + GNF      G+
Sbjct:   11 SGAIYEGHFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGQYTDIQGLEWCGNFHFTAAPGL 73          
BLAST of SMED30001347 vs. UniProt/SwissProt
Match: sp|Q8RY89|PI5K8_ARATH (Phosphatidylinositol 4-phosphate 5-kinase 8 OS=Arabidopsis thaliana OX=3702 GN=PIP5K8 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.586e-13
Identity = 42/109 (38.53%), Postives = 57/109 (52.29%), Query Frame = 1
Query:   43 IFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAF 369
            +FSNGD Y G+       G +  GKG       IIY+G++    + G G L + SGAKYEGDF     HG G  T PDGS Y G +  N   G+G+    N + + G++
Sbjct:    9 VFSNGDVYSGQLK-----GTLPHGKGKYAWPDGIIYEGDWEEGKISGRGKLMWSSGAKYEGDFSGGYLHGFGTLTSPDGSVYAGAWRMNVRHGLGRKEYCNSDVYDGSW 112          
BLAST of SMED30001347 vs. TrEMBL
Match: A0A1S3J984 (MORN repeat-containing protein 2-like OS=Lingula unguis OX=7574 GN=LOC106171198 PE=4 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.322e-36
Identity = 64/127 (50.39%), Postives = 83/127 (65.35%), Query Frame = 1
Query:   25 ILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            +L   +IF NGD Y+GEY N     IIR G G   T   ++Y G++ +D M G G L  PSGA YEGDF+NN FHG G+YT+P+GSFYEG F +NRL G G+F DT+ + W G F    A +L+F+L
Sbjct:   17 VLKGIYIFPNGDKYDGEYTNKEDGTIIRNGPGSHFTSEGVVYHGDWKDDKMTGKGRLEHPSGAIYEGDFVNNQFHGTGRYTWPNGSFYEGPFVENRLEGEGEFTDTDSQVWAGTFRYKAAPSLRFKL 143          
BLAST of SMED30001347 vs. TrEMBL
Match: A0A1S3HD05 (MORN repeat-containing protein 2-like OS=Lingula unguis OX=7574 GN=LOC106154184 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.159e-36
Identity = 64/127 (50.39%), Postives = 82/127 (64.57%), Query Frame = 1
Query:   25 ILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            +L   +IF NGD Y+GEY N     I+R G G   T   + Y GE+ +D M G G L  PSGA YEGDF+NN FHG G+YT+P+GSFYEG F +NRL G G+F DT+ + W G F    A +L+F+L
Sbjct:   17 VLKGIYIFPNGDKYDGEYTNKEDGTILRNGPGSHFTSEGVAYHGEWKDDKMTGKGRLEHPSGAIYEGDFVNNQFHGTGRYTWPNGSFYEGPFVENRLEGEGEFTDTDSQVWAGTFRYKAAPSLRFKL 143          
BLAST of SMED30001347 vs. TrEMBL
Match: C3Z251 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_246978 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 7.841e-36
Identity = 62/123 (50.41%), Postives = 84/123 (68.29%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGII-RQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            +IF NGD Y+GEY + S +G++ R G G   TK  ++Y G +V D M G G L  PSGA Y+G+F NN FHG GKY +PDGSFYEGN+++N++ G G+F DT  +TW G F +  A  L+F+L
Sbjct:   15 YIFPNGDKYDGEY-SQSDIGVLERNGIGTHTTKDGVVYTGRWVQDKMSGQGKLEHPSGAVYDGEFYNNTFHGRGKYVWPDGSFYEGNWEENKMEGDGEFIDTEGQTWTGTFRHRAAPGLRFKL 136          
BLAST of SMED30001347 vs. TrEMBL
Match: A0A3M6TP25 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00006841 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 9.946e-36
Identity = 66/127 (51.97%), Postives = 83/127 (65.35%), Query Frame = 1
Query:   25 ILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            IL   ++F NGD Y+GEYI  +  G++RQG G   T   + Y G +  D M G G L  PSGA YEG+F+NNMFHG GKYT+PDGSFYEGNF++N+L G G F D   + W G F +  A  LKF+L
Sbjct:   21 ILSGVYMFPNGDKYDGEYIQ-ADEGLLRQGYGTHTTVDGLSYYGNWSGDKMNGQGKLLHPSGAIYEGEFVNNMFHGFGKYTWPDGSFYEGNFNENKLEGQGTFTDVKSQVWYGKFTHKAAPGLKFKL 146          
BLAST of SMED30001347 vs. TrEMBL
Match: A0A4W6FNL9 (Uncharacterized protein OS=Lates calcarifer OX=8187 GN=morn2 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.551e-35
Identity = 61/122 (50.00%), Postives = 78/122 (63.93%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQ 402
            S++F NGD YEGE    +S  ++R G G   + + IIY GE+  D+MQG GTL  PSGA YEG+F +NM+HG G YTFPDGS Y+G+F KNR+ G G F +T    W G F    A  L+ Q
Sbjct:   11 SYVFPNGDRYEGECSKSASGAMVRSGTGKHTSANGIIYTGEWHEDMMQGRGTLQHPSGAVYEGEFKDNMYHGTGTYTFPDGSTYKGHFHKNRMEGEGAFTNTQGLVWTGEFHGKAALGLRMQ 132          
BLAST of SMED30001347 vs. Ensembl Cavefish
Match: morn2 (MORN repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-060825-230])

HSP 1 Score: 116.701 bits (291), Expect = 4.855e-34
Identity = 60/128 (46.88%), Postives = 77/128 (60.16%), Query Frame = 1
Query:   22 DILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            ++L  S+IF NGDTY GE  +     ++RQG G  ++ S   Y GE+ ND M G GTL+ PSGA YEG F  NM+HG G Y+FPDG+ Y GNF+ N   G G+F D     W G+F    A  LK +L
Sbjct:    3 ELLKISYIFPNGDTY-GECCHTPEGVMMRQGTGTQISSSGTTYSGEWSNDKMNGRGTLSHPSGAVYEGQFRENMYHGRGTYSFPDGTTYSGNFNNN-FEGEGEFTDAEGHVWAGSFHRKAAPGLKLKL 128          
BLAST of SMED30001347 vs. Ensembl Cavefish
Match: ENSAMXT00000015895.2 (ankyrin repeat and MYND domain containing 1 [Source:NCBI gene;Acc:103035247])

HSP 1 Score: 72.0182 bits (175), Expect = 4.835e-15
Identity = 35/88 (39.77%), Postives = 47/88 (53.41%), Query Frame = 1
Query:  106 RQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAF 369
            R G+G+        Y+G+FV DL  G+G  T+P+G  YEG F  +  HG G Y +PDGS + G F  NR  G G     +  T+ G F
Sbjct:   15 RNGEGVQQWPDGSRYEGQFVEDLKHGHGVYTWPNGQSYEGSFYKDFRHGSGTYIWPDGSRFTGKFYLNRKEGYGVHVFRDGTTFQGLF 102          

HSP 2 Score: 61.6178 bits (148), Expect = 1.903e-11
Identity = 28/94 (29.79%), Postives = 49/94 (52.13%), Query Frame = 1
Query:   46 FSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIG 327
            + +G  YEG+++ D     ++ G G+    +   Y+G F  D   G+GT  +P G+++ G F  N   G G + F DG+ ++G F  ++  G G
Sbjct:   23 WPDGSRYEGQFVED-----LKHGHGVYTWPNGQSYEGSFYKDFRHGSGTYIWPDGSRFTGKFYLNRKEGYGVHVFRDGTTFQGLFHADKRFGPG 111          
BLAST of SMED30001347 vs. Ensembl Cavefish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 63.5438 bits (153), Expect = 3.878e-12
Identity = 40/139 (28.78%), Postives = 61/139 (43.88%), Query Frame = 1
Query:   28 LFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNN-MFHGEGKYTFPDGSFYEGNF------------------------DKNRLIGIGKFFDTNRETWIGAF 369
            +FD    + G+ Y G +  D     +RQG G+ VT+  + Y+G F N+ M G G L       +EGDF ++    G+G  T P+G + EG+F                        DKNR + +G+    + E W   F
Sbjct: 1197 VFDDI--TRGEKYMGLWQED-----LRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDDWTLSGKGTLTMPNGDYIEGSFSGVWGTGLKISGSYYKPNLYDSDKDKNRTLKLGRLAVPSEEKWKAVF 1328          

HSP 2 Score: 55.0694 bits (131), Expect = 3.781e-9
Identity = 38/137 (27.74%), Postives = 66/137 (48.18%), Query Frame = 1
Query:   31 FDSFIFSNGDTYEGEYIND--SSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLT-FPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQLTSLDASKIE 432
            F +F ++ G+ YEG + ++     G++R GK  S + S  ++ G++++D   G G       G KY G +  ++  G G      G +YEG F  N+++G G     +  T+ G F +    + K  LT  +   IE
Sbjct: 1144 FGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPS--VFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDDWTLSGKGTLTMPNGDYIE 1278          

HSP 3 Score: 46.595 bits (109), Expect = 2.969e-6
Identity = 30/112 (26.79%), Postives = 49/112 (43.75%), Query Frame = 1
Query:   85 DSSLGIIRQGKGISVTKS----------SIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSF-----YEGNFDKNRLIGIGKFFDTNRETWIGAFDN 375
            D+S   +R    IS T S           ++Y+G ++     G G L +P G  Y G F N +  G G Y  P+ +      Y+G++   ++ G G F     E + G+F +
Sbjct: 1050 DTSGAAMRADPPISRTASYTFYKDSRLKEVMYEGRWLAGKPNGRGVLKWPDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQD 1161          
BLAST of SMED30001347 vs. Ensembl Cavefish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 63.5438 bits (153), Expect = 3.879e-12
Identity = 40/139 (28.78%), Postives = 61/139 (43.88%), Query Frame = 1
Query:   28 LFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNN-MFHGEGKYTFPDGSFYEGNF------------------------DKNRLIGIGKFFDTNRETWIGAF 369
            +FD    + G+ Y G +  D     +RQG G+ VT+  + Y+G F N+ M G G L       +EGDF ++    G+G  T P+G + EG+F                        DKNR + +G+    + E W   F
Sbjct: 1206 VFDDI--TRGEKYMGLWQED-----LRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDDWTLSGKGTLTMPNGDYIEGSFSGVWGTGLKISGSYYKPNLYDSDKDKNRTLKLGRLAVPSEEKWKAVF 1337          

HSP 2 Score: 55.0694 bits (131), Expect = 3.782e-9
Identity = 38/137 (27.74%), Postives = 66/137 (48.18%), Query Frame = 1
Query:   31 FDSFIFSNGDTYEGEYIND--SSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLT-FPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQLTSLDASKIE 432
            F +F ++ G+ YEG + ++     G++R GK  S + S  ++ G++++D   G G       G KY G +  ++  G G      G +YEG F  N+++G G     +  T+ G F +    + K  LT  +   IE
Sbjct: 1153 FGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPS--VFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDDWTLSGKGTLTMPNGDYIE 1287          

HSP 3 Score: 46.595 bits (109), Expect = 2.969e-6
Identity = 30/112 (26.79%), Postives = 49/112 (43.75%), Query Frame = 1
Query:   85 DSSLGIIRQGKGISVTKS----------SIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSF-----YEGNFDKNRLIGIGKFFDTNRETWIGAFDN 375
            D+S   +R    IS T S           ++Y+G ++     G G L +P G  Y G F N +  G G Y  P+ +      Y+G++   ++ G G F     E + G+F +
Sbjct: 1059 DTSGAAMRADPPISRTASYTFYKDSRLKEVMYEGRWLAGKPNGRGVLKWPDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQD 1170          
BLAST of SMED30001347 vs. Ensembl Cavefish
Match: morn4 (MORN repeat containing 4 [Source:NCBI gene;Acc:103033377])

HSP 1 Score: 60.4622 bits (145), Expect = 5.467e-12
Identity = 36/97 (37.11%), Postives = 46/97 (47.42%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIG 327
            SF +S G+ Y GE+         R G G         Y G F N L  G G L FP G++YEG+F    F G G ++  DG  +EG F   R+ G G
Sbjct:    7 SFTYSTGEEYSGEWKEGK-----RHGVGQLKFSDGTCYKGHFENGLFHGCGVLMFPDGSRYEGEFAQGKFQGVGVFSRFDGMKFEGEFKNGRVEGCG 98          

HSP 2 Score: 55.8398 bits (133), Expect = 3.215e-10
Identity = 31/76 (40.79%), Postives = 39/76 (51.32%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDN 375
            Y GE+      G G L F  G  Y+G F N +FHG G   FPDGS YEG F + +  G+G F   +   + G F N
Sbjct:   16 YSGEWKEGKRHGVGQLKFSDGTCYKGHFENGLFHGCGVLMFPDGSRYEGEFAQGKFQGVGVFSRFDGMKFEGEFKN 91          
BLAST of SMED30001347 vs. Ensembl Sea Lamprey
Match: morn2 (MORN repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-060825-230])

HSP 1 Score: 106.686 bits (265), Expect = 8.838e-31
Identity = 54/123 (43.90%), Postives = 69/123 (56.10%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            S++F NGD YEGEY       + R G G   +    IY G++  D M+G G L + SGA YEG F +NM+HG G YT+P G  Y G+F  N+L G G F DT  + W G F    A  LK +L
Sbjct:    1 SYVFPNGDKYEGEYSKSEDGVMERHGTGTHRSAGGSIYTGQWKYDKMEGTGRLVYLSGAVYEGSFHDNMYHGTGTYTWPSGVKYIGSFQHNKLKGEGMFTDTEGQEWTGMFHKKAAPGLKLKL 123          
BLAST of SMED30001347 vs. Ensembl Sea Lamprey
Match: morn2 (MORN repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-060825-230])

HSP 1 Score: 90.8929 bits (224), Expect = 1.632e-24
Identity = 47/113 (41.59%), Postives = 61/113 (53.98%), Query Frame = 1
Query:   67 EGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            +GEY       + R G G   +    IY G++  D M+G G L + SGA YEG F +NM+HG G YT+P G  Y G+F  N+L G G F DT  + W G F    A  LK +L
Sbjct:   16 KGEYSKSEDGVMERHGTGTHRSAGGSIYTGQWKYDKMEGTGRLVYLSGAVYEGSFHDNMYHGTGTYTWPSGVKYIGSFQHNKLKGEGMFTDTEGQEWTGMFHKKAAPGLKLKL 128          
BLAST of SMED30001347 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003398.1 (pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-1 gene:ENSPMAG00000003108.1 transcript:ENSPMAT00000003398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 2.290e-12
Identity = 34/101 (33.66%), Postives = 50/101 (49.50%), Query Frame = 1
Query:   25 ILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIG 327
            ++  SF ++ G+ Y+GE+         R G G         Y G+F N L  G G L FP G+++EG+F    FHG G ++  DG  +EG F    + G G
Sbjct:    3 LMKGSFTYATGEEYQGEWKEGR-----RHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYG 98          

HSP 2 Score: 51.9878 bits (123), Expect = 1.567e-9
Identity = 29/76 (38.16%), Postives = 38/76 (50.00%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDN 375
            Y GE+      G G L F  G  Y G F N +F G G   FPDGS +EG F + +  G+G F  ++   + G F N
Sbjct:   16 YQGEWKEGRRHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKN 91          
BLAST of SMED30001347 vs. Ensembl Sea Lamprey
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 55.0694 bits (131), Expect = 6.433e-10
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 1
Query:  145 IYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFD 303
            +Y G F N++M G G   +  G ++EGDF  N   G G Y +PDGS Y GN +
Sbjct:    7 VYSGSFCNNMMHGKGKYVWADGVEFEGDFWLNAMVGHGTYQWPDGSKYTGNVE 59          

HSP 2 Score: 53.5286 bits (127), Expect = 2.131e-9
Identity = 32/106 (30.19%), Postives = 54/106 (50.94%), Query Frame = 1
Query:   46 FSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSF-YEGNFDKNRLIGIG-KFFDTNRETW 357
            +  G+ Y G + N+     +  GKG  V    + ++G+F  + M G+GT  +P G+KY G+  N + HG+G  T       Y G++  +   G G  ++D  RE+W
Sbjct:    2 YEGGNVYSGSFCNN-----MMHGKGKYVWADGVEFEGDFWLNAMVGHGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESW 102          

HSP 3 Score: 48.1358 bits (113), Expect = 1.731e-7
Identity = 22/59 (37.29%), Postives = 33/59 (55.93%), Query Frame = 1
Query:  199 FPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDN 375
            +  G  Y G F NNM HG+GKY + DG  +EG+F  N ++G G +   +   + G  +N
Sbjct:    2 YEGGNVYSGSFCNNMMHGKGKYVWADGVEFEGDFWLNAMVGHGTYQWPDGSKYTGNVEN 60          

HSP 4 Score: 46.2098 bits (108), Expect = 7.096e-7
Identity = 20/58 (34.48%), Postives = 33/58 (56.90%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIG 321
            Y GE+      G G   + SGA+Y+G++  +  HG G +T   G  YEG+F ++ ++G
Sbjct:  183 YHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEGSFVEDVMVG 240          
BLAST of SMED30001347 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002910.1 (pep scaffold:Pmarinus_7.0:GL480350:1227:27530:-1 gene:ENSPMAG00000002661.1 transcript:ENSPMAT00000002910.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.651e-9
Identity = 43/135 (31.85%), Postives = 61/135 (45.19%), Query Frame = 1
Query:   46 FSNGDTYEGEYINDSSLGIIRQGKGI-----SVTKSSIIYDGEFVNDLMQGNGTLT-FPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQLTSLDASKIE 432
            ++NGD YEG + N +     R G G+       + SS +Y G++ ND   G G       G KY G ++N+  HG G      G +YE  F  NR++G G     +   + G F    A N K  LT  +   IE
Sbjct:   44 YANGDVYEGGFSNGA-----RHGHGVLRSGSHTSTSSSLYIGQWANDCKCGYGVFDDITRGEKYMGMWMNDCRHGNGVVVSQFGLYYECVFSSNRMVGQGVLLSEDDTRYEGEFTADLALNGKGVLTLPNGDAIE 173          
BLAST of SMED30001347 vs. Ensembl Nematostella
Match: EDO34440 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPF0])

HSP 1 Score: 75.485 bits (184), Expect = 7.059e-19
Identity = 38/71 (53.52%), Postives = 46/71 (64.79%), Query Frame = 1
Query:  193 LTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQL 405
            L  PSGA YEG+F+NN F G G+YT+ DGS YEGNF  N+L G G F D   + W G F +  A  LKF+L
Sbjct:    3 LIHPSGAVYEGEFVNNEFSGFGRYTWADGSSYEGNFSDNKLEGYGNFTDVKGQVWYGNFTHKAAPGLKFKL 73          
BLAST of SMED30001347 vs. Ensembl Nematostella
Match: EDO36375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIW7])

HSP 1 Score: 76.2554 bits (186), Expect = 1.179e-18
Identity = 39/98 (39.80%), Postives = 55/98 (56.12%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF 333
            F + NG  Y+GEY ++      R GKG        +Y+GEF+ DL  G G +TFP    Y+G F  +  HG G YT+PDG+ +EG+F  ++  G G F
Sbjct:   24 FKWPNGACYDGEYTDNK-----RHGKGKQYWSDGAVYNGEFIRDLRHGFGQITFPDHETYKGQFHRDHKHGSGVYTWPDGTTFEGHFQNDKKEGFGTF 116          

HSP 2 Score: 55.8398 bits (133), Expect = 6.137e-11
Identity = 31/93 (33.33%), Postives = 49/93 (52.69%), Query Frame = 1
Query:   97 GIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDN 375
            G  + GKG+    +   YDGE+ ++   G G   +  GA Y G+F+ ++ HG G+ TFPD   Y+G F ++   G G +   +  T+ G F N
Sbjct:   15 GNKKTGKGVFKWPNGACYDGEYTDNKRHGKGKQYWSDGAVYNGEFIRDLRHGFGQITFPDHETYKGQFHRDHKHGSGVYTWPDGTTFEGHFQN 107          
BLAST of SMED30001347 vs. Ensembl Nematostella
Match: EDO39343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAB7])

HSP 1 Score: 67.3958 bits (163), Expect = 1.755e-14
Identity = 40/112 (35.71%), Postives = 61/112 (54.46%), Query Frame = 1
Query:   34 DSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAF 369
            D  +  N D   GEY  D +    R G+G ++  +  +Y G + N    G GT  F  GA+Y G + NN  +G+G +T+PDGS YEG +  +   G+G +F TN +T+ G +
Sbjct:    5 DEELLQNADI--GEYEGDRNELGERHGQGKALHGNGDLYTGSYWNGKRHGKGTYIFRKGARYMGFYENNKKNGKGTFTYPDGSRYEGTWSDDERHGVGTYFYTNGDTYEGEW 114          

HSP 2 Score: 63.5438 bits (153), Expect = 4.863e-13
Identity = 36/101 (35.64%), Postives = 52/101 (51.49%), Query Frame = 1
Query:   43 IFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTN 345
            +  NGD Y G Y N       R GKG  + +    Y G + N+   G GT T+P G++YEG + ++  HG G Y + +G  YEG +  NR  G G + D +
Sbjct:   34 LHGNGDLYTGSYWNGK-----RHGKGTYIFRKGARYMGFYENNKKNGKGTFTYPDGSRYEGTWSDDERHGVGTYFYTNGDTYEGEWRSNRRHGKGTYTDAH 129          
BLAST of SMED30001347 vs. Ensembl Nematostella
Match: EDO27248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9S6])

HSP 1 Score: 66.2402 bits (160), Expect = 1.820e-14
Identity = 37/101 (36.63%), Postives = 57/101 (56.44%), Query Frame = 1
Query:   31 FDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF 333
            + + + ++GDTY+G Y N       R G GI    +   Y+GE+VN+  +G GT+ FP G+ Y+G++ NN   G GKY + +G  YEG +   R  G G +
Sbjct:   16 YGTALLTSGDTYQGLYNNGK-----RHGYGIYRFVNKARYEGEYVNNKREGTGTMYFPDGSMYKGEWKNNKRSGNGKYKYANGDTYEGEWKLGRRHGQGVY 111          

HSP 2 Score: 61.2326 bits (147), Expect = 1.632e-12
Identity = 38/102 (37.25%), Postives = 53/102 (51.96%), Query Frame = 1
Query:   64 YEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAF 369
            YEGE  ND      R G G ++  S   Y G + N    G G   F + A+YEG+++NN   G G   FPDGS Y+G +  N+  G GK+   N +T+ G +
Sbjct:    3 YEGERNNDGE----RHGYGTALLTSGDTYQGLYNNGKRHGYGIYRFVNKARYEGEYVNNKREGTGTMYFPDGSMYKGEWKNNKRSGNGKYKYANGDTYEGEW 100          

HSP 3 Score: 51.2174 bits (121), Expect = 7.976e-9
Identity = 33/98 (33.67%), Postives = 50/98 (51.02%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPD-GSFYEGNFDKNRLIGIGK 330
            + F N   YEGEY+N+      R+G G        +Y GE+ N+   GNG   + +G  YEG++     HG+G Y + D G  Y+GN+   +  G G+
Sbjct:   42 YRFVNKARYEGEYVNNK-----REGTGTMYFPDGSMYKGEWKNNKRSGNGKYKYANGDTYEGEWKLGRRHGQGVYVYKDLGISYKGNWAFGKFDGKGQ 134          
BLAST of SMED30001347 vs. Ensembl Nematostella
Match: EDO45129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTQ4])

HSP 1 Score: 65.855 bits (159), Expect = 5.921e-14
Identity = 36/97 (37.11%), Postives = 52/97 (53.61%), Query Frame = 1
Query:   43 IFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF 333
               NGD YEGEY +       R G+G    K+   Y G + N    G GT  +P G++YEG ++N+  HG G Y +P+G  YEG + +N+  G G +
Sbjct:   19 TLPNGDVYEGEYSHGK-----RHGQGTYKFKTGGKYTGSYANGKKHGEGTFWYPDGSRYEGFWINDEKHGFGTYYYPNGDAYEGEWSQNQRNGQGMY 110          

HSP 2 Score: 62.7734 bits (151), Expect = 7.710e-13
Identity = 36/108 (33.33%), Postives = 54/108 (50.00%), Query Frame = 1
Query:   64 YEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCAN 387
            YEG+   D      R GKG +   +  +Y+GE+ +    G GT  F +G KY G + N   HGEG + +PDGS YEG +  +   G G ++  N + + G +     N
Sbjct:    2 YEGDRNEDEE----RHGKGKATLPNGDVYEGEYSHGKRHGQGTYKFKTGGKYTGSYANGKKHGEGTFWYPDGSRYEGFWINDEKHGFGTYYYPNGDAYEGEWSQNQRN 105          

HSP 3 Score: 52.373 bits (124), Expect = 4.547e-9
Identity = 32/106 (30.19%), Postives = 55/106 (51.89%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPD-GSFYEGNFDKNRLIGIGKFFDTNRE 351
            ++ F  G  Y G Y N       + G+G         Y+G ++ND   G GT  +P+G  YEG++  N  +G+G YT+ + GS Y+G++   ++ G G+   +N +
Sbjct:   40 TYKFKTGGKYTGSYANGK-----KHGEGTFWYPDGSRYEGFWINDEKHGFGTYYYPNGDAYEGEWSQNQRNGQGMYTYAETGSKYKGSWVAGKMDGAGELIHSNHK 140          
BLAST of SMED30001347 vs. Ensembl Medaka
Match: morn2 (MORN repeat containing 2 [Source:NCBI gene;Acc:101169252])

HSP 1 Score: 117.087 bits (292), Expect = 6.410e-34
Identity = 54/122 (44.26%), Postives = 74/122 (60.66%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQ 402
            ++ F NGD YEG+     S G++R G G   + + + Y GE+  D M G G+L +PSGA+YEG+   NM+HG G YTF DGS Y+G+F +NR +G+G F D   + W G F    A  LK Q
Sbjct:   21 AYFFPNGDRYEGDCSGSDSDGLVRSGIGKHTSANGLTYVGEWCKDKMHGRGSLQYPSGARYEGEVKGNMYHGAGTYTFSDGSVYKGHFHENRFMGVGTFIDAQGQVWTGEFHGKEALGLKMQ 142          
BLAST of SMED30001347 vs. Ensembl Medaka
Match: ENSORLT00000000050.2 (MORN repeat-containing protein 4 [Source:NCBI gene;Acc:101156553])

HSP 1 Score: 65.855 bits (159), Expect = 4.227e-14
Identity = 38/98 (38.78%), Postives = 51/98 (52.04%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGK 330
            SF +SNG+ Y GE+        +R G G         Y G+F N L  G G L FP G++YEGDF+   F G G +T  DG  +EG F +  + G G+
Sbjct:    7 SFTYSNGEEYHGEWREG-----LRHGLGQLTFSDGTCYTGQFENGLFNGCGVLAFPDGSRYEGDFVQGKFQGVGVFTRFDGMKFEGEFKRGCVDGYGE 99          

HSP 2 Score: 57.3806 bits (137), Expect = 6.442e-11
Identity = 32/80 (40.00%), Postives = 42/80 (52.50%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCAN 387
            Y GE+   L  G G LTF  G  Y G F N +F+G G   FPDGS YEG+F + +  G+G F   +   + G F   C +
Sbjct:   16 YHGEWREGLRHGLGQLTFSDGTCYTGQFENGLFNGCGVLAFPDGSRYEGDFVQGKFQGVGVFTRFDGMKFEGEFKRGCVD 95          
BLAST of SMED30001347 vs. Ensembl Medaka
Match: RSPH1 (radial spoke head component 1 [Source:NCBI gene;Acc:101161589])

HSP 1 Score: 64.3142 bits (155), Expect = 5.708e-13
Identity = 32/86 (37.21%), Postives = 49/86 (56.98%), Query Frame = 1
Query:   43 IFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNF 300
            +  NGD Y+G Y +       R G+G    K+  +Y GE+  +L  G GT  +P G+KYEG ++N++  G G YT+ +G  YEG +
Sbjct:   36 VLPNGDIYQGRYEHGE-----RHGQGTYRFKNGAVYVGEYFKNLKHGQGTFYYPDGSKYEGSWVNDLRQGRGVYTYSNGDTYEGEW 116          

HSP 2 Score: 60.077 bits (144), Expect = 2.245e-11
Identity = 39/122 (31.97%), Postives = 61/122 (50.00%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFP-DGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKF 399
            ++ F NG  Y GEY  +     ++ G+G         Y+G +VNDL QG G  T+ +G  YEG++LN+  HG+G Y +   GS Y G++    +   G++   N +     F+N      KF
Sbjct:   57 TYRFKNGAVYVGEYFKN-----LKHGQGTFYYPDGSKYEGSWVNDLRQGRGVYTYSNGDTYEGEWLNHFRHGQGVYHYHLTGSKYVGSWVNGNMQSAGEYIHANHKYQGNFFNNKPDGPGKF 173          

HSP 3 Score: 59.3066 bits (142), Expect = 4.234e-11
Identity = 38/117 (32.48%), Postives = 58/117 (49.57%), Query Frame = 1
Query:   76 YINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQLTSLDASK 426
            Y  D +    R G G SV  +  IY G + +    G GT  F +GA Y G++  N+ HG+G + +PDGS YEG++  +   G G +  +N +T+ G + N   +        L  SK
Sbjct:   19 YEGDRNDAGQRHGVGRSVLPNGDIYQGRYEHGERHGQGTYRFKNGAVYVGEYFKNLKHGQGTFYYPDGSKYEGSWVNDLRQGRGVYTYSNGDTYEGEWLNHFRHGQGVYHYHLTGSK 135          

HSP 4 Score: 47.7506 bits (112), Expect = 5.867e-7
Identity = 34/92 (36.96%), Postives = 48/92 (52.17%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGIIRQGKGI---SVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDK 306
            + +SNGDTYEGE++N       R G+G+    +T S  +  G +VN  MQ  G     +  KY+G+F NN   G GK+ F  G    G F +
Sbjct:  104 YTYSNGDTYEGEWLNH-----FRHGQGVYHYHLTGSKYV--GSWVNGNMQSAGEYIH-ANHKYQGNFFNNKPDGPGKFVFDFGCEQHGEFQQ 187          
BLAST of SMED30001347 vs. Ensembl Medaka
Match: morn4 (MORN repeat-containing protein 4 [Source:NCBI gene;Acc:101164499])

HSP 1 Score: 62.7734 bits (151), Expect = 6.968e-13
Identity = 36/97 (37.11%), Postives = 51/97 (52.58%), Query Frame = 1
Query:   37 SFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIG 327
            SF +++G+ Y GE+         R G G    +    Y G+F N L  G+G L F  G++YEG+FLN  F G G ++  DG  +EG F   R+ G G
Sbjct:    7 SFTYASGEEYHGEWKEGR-----RHGLGQLKFQDGTCYSGQFENGLFHGSGVLLFTDGSRYEGEFLNGQFQGTGVFSRYDGMKFEGEFKDGRVEGYG 98          

HSP 2 Score: 47.7506 bits (112), Expect = 3.680e-7
Identity = 27/62 (43.55%), Postives = 30/62 (48.39%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKF 333
            Y GE+      G G L F  G  Y G F N +FHG G   F DGS YEG F   +  G G F
Sbjct:   16 YHGEWKEGRRHGLGQLKFQDGTCYSGQFENGLFHGSGVLLFTDGSRYEGEFLNGQFQGTGVF 77          
BLAST of SMED30001347 vs. Ensembl Medaka
Match: ENSORLT00000014461.2 (ankyrin repeat and MYND domain containing 1 [Source:NCBI gene;Acc:101172320])

HSP 1 Score: 56.6102 bits (135), Expect = 1.111e-9
Identity = 29/94 (30.85%), Postives = 48/94 (51.06%), Query Frame = 1
Query:   46 FSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIG 327
            +S+   YEG+++N      ++ GKG  +  +   Y+G F  D   G+G   +PSG K+ G F  N   G     FPDG+ ++G +  ++  G G
Sbjct:   48 WSDESKYEGQFVN-----ALKHGKGKYIWGNGECYEGFFYKDCRHGSGEYFWPSGHKFTGKFYLNRKEGYAVQAFPDGATFQGLYHTDQRFGPG 136          

HSP 2 Score: 46.9802 bits (110), Expect = 2.217e-6
Identity = 22/53 (41.51%), Postives = 33/53 (62.26%), Query Frame = 1
Query:  211 AKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAF 369
            +KYEG F+N + HG+GKY + +G  YEG F K+   G G++F  +   + G F
Sbjct:   52 SKYEGQFVNALKHGKGKYIWGNGECYEGFFYKDCRHGSGEYFWPSGHKFTGKF 104          

HSP 3 Score: 46.595 bits (109), Expect = 3.402e-6
Identity = 25/80 (31.25%), Postives = 38/80 (47.50%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDG 279
            +I+ NG+ YEG +  D      R G G     S   + G+F  +  +G     FP GA ++G +  +   G G  T+PDG
Sbjct:   69 YIWGNGECYEGFFYKDC-----RHGSGEYFWPSGHKFTGKFYLNRKEGYAVQAFPDGATFQGLYHTDQRFGPGVLTYPDG 143          
BLAST of SMED30001347 vs. Planmine SMEST
Match: SMESG000053274.1 (SMESG000053274.1)

HSP 1 Score: 285.419 bits (729), Expect = 1.257e-100
Identity = 141/143 (98.60%), Postives = 142/143 (99.30%), Query Frame = 1
Query:   16 MQDILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQLTSLDASKIEMTKI 444
            MQDILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDG+FVNDLMQGNGTL FPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQLTSLDASKIEMTKI
Sbjct:    1 MQDILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGDFVNDLMQGNGTLKFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDNTCANNLKFQLTSLDASKIEMTKI 143          
BLAST of SMED30001347 vs. Planmine SMEST
Match: SMESG000012434.1 (SMESG000012434.1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.341e-12
Identity = 45/142 (31.69%), Postives = 69/142 (48.59%), Query Frame = 1
Query:   46 FSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDN--TCANNLKFQLTS--LDASKIEMTKI*LCLV 459
            + NGD Y G++ ++S     R+G G     +  +Y+GEF    + G G +   +G+ Y G ++    HG GK T PDGS YEG F+ N   G G  F      + G ++    C    K +LT+  LD  +    +I L L+
Sbjct:   82 YGNGDEYHGDWNSNS-----REGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILDCFQGHTFQISLTLI 218          

HSP 2 Score: 51.2174 bits (121), Expect = 5.667e-8
Identity = 35/97 (36.08%), Postives = 53/97 (54.64%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGIIRQGKGISV-TKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIG 327
            F+ ++G  YEGE+ N    G     KG     K+  +Y GEF N  M G G + + +G +Y GD+ +N   G G+ T+ +G  YEG F K+++ G G
Sbjct:   33 FVMADGSFYEGEFQNGEICG-----KGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEG 124          
BLAST of SMED30001347 vs. Planmine SMEST
Match: SMESG000012434.1 (SMESG000012434.1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.743e-12
Identity = 45/142 (31.69%), Postives = 69/142 (48.59%), Query Frame = 1
Query:   46 FSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDN--TCANNLKFQLTS--LDASKIEMTKI*LCLV 459
            + NGD Y G++ ++S     R+G G     +  +Y+GEF    + G G +   +G+ Y G ++    HG GK T PDGS YEG F+ N   G G  F      + G ++    C    K +LT+  LD  +    +I L L+
Sbjct:   98 YGNGDEYHGDWNSNS-----REGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILDCFQGHTFQISLTLI 234          

HSP 2 Score: 51.2174 bits (121), Expect = 5.763e-8
Identity = 35/97 (36.08%), Postives = 53/97 (54.64%), Query Frame = 1
Query:   40 FIFSNGDTYEGEYINDSSLGIIRQGKGISV-TKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIG 327
            F+ ++G  YEGE+ N    G     KG     K+  +Y GEF N  M G G + + +G +Y GD+ +N   G G+ T+ +G  YEG F K+++ G G
Sbjct:   49 FVMADGSFYEGEFQNGEICG-----KGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEG 140          
BLAST of SMED30001347 vs. Planmine SMEST
Match: SMESG000023247.1 (SMESG000023247.1)

HSP 1 Score: 58.9214 bits (141), Expect = 2.446e-11
Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = 1
Query:  148 YDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFF 336
            YDG ++N  M+G G  T P+  +YEGD L+ MFHGEG   FP+G  Y   + K +++  GK+ 
Sbjct:    8 YDGTWINGRMEGQGKYTLPTDTRYEGDMLDGMFHGEGTLYFPNGGKYVAKWHKGKVV-TGKYI 69          
BLAST of SMED30001347 vs. Planmine SMEST
Match: SMESG000014300.1 (SMESG000014300.1)

HSP 1 Score: 58.151 bits (139), Expect = 1.593e-10
Identity = 36/110 (32.73%), Postives = 57/110 (51.82%), Query Frame = 1
Query:   43 IFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGK-FFDTNRETWIGAF 369
               NGDTYEG Y N       R G G    K+   Y GE+  +   G+G   +P G+KYEG ++++  +G GKY + +G ++EG +  +   G G  F+D     ++G +
Sbjct:   37 TLPNGDTYEGLYENGK-----RHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVW 141          

HSP 2 Score: 56.225 bits (134), Expect = 9.158e-10
Identity = 35/104 (33.65%), Postives = 56/104 (53.85%), Query Frame = 1
Query:   64 YEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFVNDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRLIGIGKFFDTNRETWIGAFDN 375
            Y GEY    +    R G G +   +   Y+G + N    G+GT  F +GA+Y G++  N  HG G + +PDGS YEG++  ++  G GK++  N + + G + N
Sbjct:   16 YLGEYEGGRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKN 119          
The following BLAST results are available for this feature:
BLAST of SMED30001347 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MORN26.498e-2947.97MORN repeat containing 2 [Source:HGNC Symbol;Acc:H... [more]
MORN26.179e-1750.65MORN repeat containing 2 [Source:HGNC Symbol;Acc:H... [more]
MORN26.179e-1750.65MORN repeat containing 2 [Source:HGNC Symbol;Acc:H... [more]
MORN26.179e-1750.65MORN repeat containing 2 [Source:HGNC Symbol;Acc:H... [more]
RSPH10B25.422e-1136.45radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
back to top
BLAST of SMED30001347 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
jph-11.273e-639.19JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667][more]
back to top
BLAST of SMED30001347 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtp1.629e-1048.33gene:FBgn0087005 transcript:FBtr0078825[more]
CG54581.946e-932.99gene:FBgn0032478 transcript:FBtr0080437[more]
jp1.811e-643.86gene:FBgn0032129 transcript:FBtr0079861[more]
jp1.811e-643.86gene:FBgn0032129 transcript:FBtr0079860[more]
jp1.811e-643.86gene:FBgn0032129 transcript:FBtr0304056[more]
back to top
BLAST of SMED30001347 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
morn23.160e-3450.00MORN repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
CR626962.32.035e-2053.25pep chromosome:GRCz11:CHR_ALT_CTG17_1_18:24687572:... [more]
CT573248.33.686e-1333.05radial spoke head component 1 [Source:NCBI gene;Ac... [more]
RSPH13.686e-1333.05radial spoke head component 1 [Source:NCBI gene;Ac... [more]
morn47.931e-1338.14MORN repeat containing 4 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30001347 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MORN23.816e-2942.28MORN repeat containing 2 [Source:NCBI gene;Acc:100... [more]
MORN41.151e-1237.62Novel protein containing Rieske domain and Protei... [more]
ENSXETT00000041411.11.708e-839.02radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
ENSXETT00000041392.11.814e-839.02radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
ENSXETT00000041404.11.884e-839.02radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
back to top
BLAST of SMED30001347 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Morn21.729e-2947.54MORN repeat containing 2 [Source:MGI Symbol;Acc:MG... [more]
Morn21.442e-1751.95MORN repeat containing 2 [Source:MGI Symbol;Acc:MG... [more]
Rsph11.117e-1133.00radial spoke head 1 homolog (Chlamydomonas) [Sourc... [more]
Rsph10b1.304e-1135.00radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
Rsph12.076e-1134.09radial spoke head 1 homolog (Chlamydomonas) [Sourc... [more]
back to top
BLAST of SMED30001347 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6UL01|MORN2_MOUSE1.009e-1651.95MORN repeat-containing protein 2 OS=Mus musculus O... [more]
sp|Q502X0|MORN2_HUMAN2.967e-1650.65MORN repeat-containing protein 2 OS=Homo sapiens O... [more]
sp|Q27YU0|RSP1_CHLRE4.233e-1636.63Flagellar radial spoke protein 1 OS=Chlamydomonas ... [more]
sp|Q32KU3|MORN2_BOVIN8.088e-1649.35MORN repeat-containing protein 2 OS=Bos taurus OX=... [more]
sp|Q8RY89|PI5K8_ARATH3.586e-1338.53Phosphatidylinositol 4-phosphate 5-kinase 8 OS=Ara... [more]
back to top
BLAST of SMED30001347 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J9841.322e-3650.39MORN repeat-containing protein 2-like OS=Lingula u... [more]
A0A1S3HD052.159e-3650.39MORN repeat-containing protein 2-like OS=Lingula u... [more]
C3Z2517.841e-3650.41Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A3M6TP259.946e-3651.97Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A4W6FNL94.551e-3550.00Uncharacterized protein OS=Lates calcarifer OX=818... [more]
back to top
BLAST of SMED30001347 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
morn24.855e-3446.88MORN repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSAMXT00000015895.24.835e-1539.77ankyrin repeat and MYND domain containing 1 [Sourc... [more]
als2b3.878e-1228.78alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
als2b3.879e-1228.78alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
morn45.467e-1237.11MORN repeat containing 4 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of SMED30001347 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
morn28.838e-3143.90MORN repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
morn21.632e-2441.59MORN repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000003398.12.290e-1233.66pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-... [more]
RSPH10B26.433e-1043.40radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
ENSPMAT00000002910.11.651e-931.85pep scaffold:Pmarinus_7.0:GL480350:1227:27530:-1 g... [more]
back to top
BLAST of SMED30001347 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001347 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO344407.059e-1953.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363751.179e-1839.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393431.755e-1435.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272481.820e-1436.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451295.921e-1437.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30001347 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
morn26.410e-3444.26MORN repeat containing 2 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000000050.24.227e-1438.78MORN repeat-containing protein 4 [Source:NCBI gene... [more]
RSPH15.708e-1337.21radial spoke head component 1 [Source:NCBI gene;Ac... [more]
morn46.968e-1337.11MORN repeat-containing protein 4 [Source:NCBI gene... [more]
ENSORLT00000014461.21.111e-930.85ankyrin repeat and MYND domain containing 1 [Sourc... [more]
back to top
BLAST of SMED30001347 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053274.11.257e-10098.60SMESG000053274.1[more]
SMESG000012434.13.341e-1231.69SMESG000012434.1[more]
SMESG000012434.13.743e-1231.69SMESG000012434.1[more]
SMESG000023247.12.446e-1142.86SMESG000023247.1[more]
SMESG000014300.11.593e-1032.73SMESG000014300.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001347 ID=SMED30001347|Name=SMED30001347|organism=Schmidtea mediterranea sexual|type=transcript|length=470bp
TAAATCTTATATGAAATGCAAGATATTTTATTTGATTCTTTCATTTTTTC
AAATGGCGATACTTATGAAGGAGAATATATTAATGATTCTTCACTAGGAA
TCATTCGTCAAGGGAAAGGTATTAGCGTTACAAAATCATCTATTATTTAC
GACGGTGAATTTGTGAATGACCTTATGCAAGGAAATGGAACACTAACATT
TCCATCTGGTGCAAAATATGAAGGCGACTTTTTAAACAATATGTTTCACG
GAGAAGGAAAATATACATTTCCCGATGGATCGTTTTATGAAGGAAATTTT
GATAAAAACAGACTCATAGGAATCGGGAAATTTTTTGACACGAATAGAGA
AACGTGGATAGGAGCATTTGACAACACTTGTGCCAACAACTTAAAATTTC
AATTAACTAGTTTAGATGCCAGTAAAATCGAAATGACTAAAATATAACTT
TGTCTTGTTGAAAAAAAAGA
back to top

protein sequence of SMED30001347-orf-1

>SMED30001347-orf-1 ID=SMED30001347-orf-1|Name=SMED30001347-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MQDILFDSFIFSNGDTYEGEYINDSSLGIIRQGKGISVTKSSIIYDGEFV
NDLMQGNGTLTFPSGAKYEGDFLNNMFHGEGKYTFPDGSFYEGNFDKNRL
IGIGKFFDTNRETWIGAFDNTCANNLKFQLTSLDASKIEMTKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003409MORN
Vocabulary: cellular component
TermDefinition
GO:0001669acrosomal vesicle
GO:0005575cellular_component
GO:0005634nucleus
GO:0031410cytoplasmic vesicle
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0007283spermatogenesis
GO:0008150biological_process
GO:0030154cell differentiation