Coatomer subunit beta

Overview
NameCoatomer subunit beta
Smed IDSMED30001344
Length (bp)3090
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coatomer subunit beta (SMED30001344) t-SNE clustered cells

Violin plots show distribution of expression levels for Coatomer subunit beta (SMED30001344) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coatomer subunit beta (SMED30001344) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coatomer subunit beta (SMED30001344) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001344

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30001344SMESG000033847.1 dd_Smed_v4_1208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30001344SMESG000033847.1 dd_Smed_v4_1208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001344SMESG000033847.1 dd_Smed_v4_1208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001344SMESG000033847.1 dd_Smed_v4_1208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001344SMESG000033847.1 Contig45540newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001344SMESG000033847.1 Contig45540uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30001344SMESG000033847.1 dd_Smed_v4_1208_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coatomer subunit beta vs. Ensembl Human
Match: COPB1 (coatomer protein complex subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:2231])

HSP 1 Score: 1091.26 bits (2821), Expect = 0.000e+0
Identity = 568/988 (57.49%), Postives = 732/988 (74.09%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACK--VTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEP---VTGHVRIRAKSQGMAVTMGEKISAAQKQMPV 2968
            +  ++  CYTLIN+P +S+ PSE  LK+DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +G+L  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRL+ L+E+  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LI+EK++E +  I+  ++ R  +WI+GEYC+T ++I++ +  I + LG +P+VE EIK+ +GE       L P+  +T    +  VT  GTYATQ+AL+S++P K+        RP L+  L   DF    +L+  L K+  R    ++E         KK+NSF AE ML++A++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L  M++++  E  ++ +  ES  + R V   +QPD P+ F  L  KNEMN   D+F L++  A+G+T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PA+C+ + +R+MW EFEWENKVTVNT + DL+ YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP    P   VTGH+RIRAKSQGMA+++G+KI+ +QK+  +
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DNNEAAAAD-VLEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIKKEAGE-------LKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEED-----RPPLRGFLLDGDFFVAASLATTLTKIALRYVALVQEK--------KKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAK-LEEEKLSQKKES--EKRNV--TVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQR--KEAADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI 953          
BLAST of Coatomer subunit beta vs. Ensembl Human
Match: COPB1 (coatomer protein complex subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:2231])

HSP 1 Score: 1091.26 bits (2821), Expect = 0.000e+0
Identity = 568/988 (57.49%), Postives = 732/988 (74.09%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACK--VTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEP---VTGHVRIRAKSQGMAVTMGEKISAAQKQMPV 2968
            +  ++  CYTLIN+P +S+ PSE  LK+DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +G+L  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRL+ L+E+  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LI+EK++E +  I+  ++ R  +WI+GEYC+T ++I++ +  I + LG +P+VE EIK+ +GE       L P+  +T    +  VT  GTYATQ+AL+S++P K+        RP L+  L   DF    +L+  L K+  R    ++E         KK+NSF AE ML++A++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L  M++++  E  ++ +  ES  + R V   +QPD P+ F  L  KNEMN   D+F L++  A+G+T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PA+C+ + +R+MW EFEWENKVTVNT + DL+ YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP    P   VTGH+RIRAKSQGMA+++G+KI+ +QK+  +
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DNNEAAAAD-VLEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIKKEAGE-------LKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEED-----RPPLRGFLLDGDFFVAASLATTLTKIALRYVALVQEK--------KKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAK-LEEEKLSQKKES--EKRNV--TVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQR--KEAADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI 953          
BLAST of Coatomer subunit beta vs. Ensembl Human
Match: COPB1 (coatomer protein complex subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:2231])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 311/491 (63.34%), Postives = 389/491 (79.23%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLG 1492
            +  ++  CYTLIN+P +S+ PSE  LK+DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +G+L  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRL+ L+E+  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LI+EK++E +  I+  ++ R  +WI+GEYC+T ++I++ +  I + LG
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DNNEAAAAD-VLEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLG 484          
BLAST of Coatomer subunit beta vs. Ensembl Human
Match: COPB1 (coatomer protein complex subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:2231])

HSP 1 Score: 199.904 bits (507), Expect = 5.648e-59
Identity = 93/137 (67.88%), Postives = 114/137 (83.21%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLM 436
            +  ++  CYTLIN+P +S+ PSE  LK+DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +G+L  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLM
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLM 137          
BLAST of Coatomer subunit beta vs. Ensembl Human
Match: COPB1 (coatomer protein complex subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:2231])

HSP 1 Score: 190.274 bits (482), Expect = 1.328e-55
Identity = 88/132 (66.67%), Postives = 109/132 (82.58%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEV 421
            +  ++  CYTLIN+P +S+ PSE  LK+DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +G+L  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAEL 132          
BLAST of Coatomer subunit beta vs. Ensembl Celegans
Match: copb-1 (Coatomer subunit beta [Source:UniProtKB/TrEMBL;Acc:Q9TYL9])

HSP 1 Score: 943.34 bits (2437), Expect = 0.000e+0
Identity = 518/993 (52.17%), Postives = 691/993 (69.59%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKIN-NLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLR--ENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKV---FCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDL--LPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPV----PKIIQPDSPVHFSLL-ANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKP---PGNEPVTGHVRIRAKSQGMAVTMGEKISAAQK 2956
            + + +Q CYTLI++P+++++PSE +LK+  +    K +  ALK++I MI NGEK + ++LM VIRF +P   HT+KK+LL+FWE VPK D+NGKL  EMILVCDAYRKDLQHPNEF+RGSTLRFLCKL+EPE+LEPLMP+I  CLEHRHSYVRRNAV AIFTIYKNF FLIPDAPE +  +L+QEQDASCKRNAFMMLLH  Q  AL+YLS C+DQV +FGDILQL+IVELIYKVCH+NP E +RFIRCVYNLLQSSSP+VRYEAAGTL+TL++  AA+KA AS YIDLI+KESDNNVKLIVLDRLV LR   ++EK LQ LVMD+LR+LSS  LEVRKKTL L LDL+++R  E+++  L+KE+ K  +  N ++G     YR  LV T++ A +++P++  T+VP L E L+   E      +  V +F+REA+ K P  K+ I+  L E  P I+   +    +WI+  YC   D   + + L+   LG +PLV+ E   +SG+  ++     P+     Q  KVTADGTYATQTAL+ST     T+S +N ++P L+  L   +F  G +L+  L K+   F  L+ A  E          + N F AECMLI++S+I+L KS L  +   V  D LDRM   +K LA     + +     C+  L  M+ ++   R  +D T E +  T          ++ D  ++F+ L A  N+  E  + FDL++SQAL   GT  K +   FS+SKL KV QL GFSDPIYAEAYV+VNQYDIVLD+ +VNQTSDTLQN+++ELAT+GDLKLV+KP+P+T+ P+DF+NIKA +KV+S+ENG+IF  I YDV+G+  + NCV L DI IDI++YI+P + + + +R MW++FEWENKV V T I+DL  +LNH++ +TNM+ LT   A+EG+C +L   L A SIFGE  LAN+ +EK      + P+ GH+RIRAKSQGM +T+G+K+S+A +
Sbjct:    1 MSSGEQPCYTLIHVPSDAELPSEAQLKEKFEKGGDKERIEALKKLIYMILNGEKTSQSMLMYVIRFCLPSNEHTLKKVLLIFWECVPKTDSNGKLLHEMILVCDAYRKDLQHPNEFVRGSTLRFLCKLREPELLEPLMPAIRACLEHRHSYVRRNAVCAIFTIYKNFEFLIPDAPELVTEYLEQEQDASCKRNAFMMLLHVDQARALDYLSGCIDQVGSFGDILQLVIVELIYKVCHNNPNEASRFIRCVYNLLQSSSPAVRYEAAGTLVTLSNVPAAVKAAASAYIDLIVKESDNNVKLIVLDRLVALRGSSSNEKILQGLVMDILRVLSSPGLEVRKKTLSLALDLVSSRNVEDMVMFLKKEINKTATESNDENG----KYRQELVKTLHAATIKFPDVASTIVPVLMEFLSDTNE----KASSYVLQFVREAVHKLPNLKNAILGALREGIPFIQSPTIFMSALWILATYCEA-DGALDVLKLVKNSLGELPLVDSE---LSGQEEQKPEEQQPE-QQQKQKPKVTADGTYATQTALSSTV----TTSKKN-EKPPLRRFLLDGEFFLGASLATVLTKLAQQFTELNGAASE----------RANRFRAECMLILSSIIHLAKSGLCIVHQQVNEDDLDRMGATIKILAQGIPGLDEQYGDDCKKSLELMLGAKSISR--LDVTTEKMASTTAAGYRSKDFVEIDKTINFTQLSARSNQQGE--NLFDLSLSQAL---GTAPKAQKFDFSSSKLGKVIQLAGFSDPIYAEAYVNVNQYDIVLDVLIVNQTSDTLQNVSLELATVGDLKLVDKPTPVTLAPNDFSNIKATVKVASTENGVIFSTISYDVTGSTSDRNCVYLQDIKIDIMDYIVPGNVTDTEFRTMWSDFEWENKVNVMTPIRDLRDFLNHLSTSTNMKVLTGDAAIEGDCGFLAANLCAHSIFGEDALANVSVEKALPMDDSSPIVGHIRIRAKSQGMCLTLGDKLSSAMR 958          
BLAST of Coatomer subunit beta vs. Ensembl Celegans
Match: copb-1 (Coatomer subunit beta [Source:UniProtKB/TrEMBL;Acc:Q9TYL9])

HSP 1 Score: 943.34 bits (2437), Expect = 0.000e+0
Identity = 518/993 (52.17%), Postives = 691/993 (69.59%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKIN-NLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLR--ENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKV---FCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDL--LPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPV----PKIIQPDSPVHFSLL-ANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKP---PGNEPVTGHVRIRAKSQGMAVTMGEKISAAQK 2956
            + + +Q CYTLI++P+++++PSE +LK+  +    K +  ALK++I MI NGEK + ++LM VIRF +P   HT+KK+LL+FWE VPK D+NGKL  EMILVCDAYRKDLQHPNEF+RGSTLRFLCKL+EPE+LEPLMP+I  CLEHRHSYVRRNAV AIFTIYKNF FLIPDAPE +  +L+QEQDASCKRNAFMMLLH  Q  AL+YLS C+DQV +FGDILQL+IVELIYKVCH+NP E +RFIRCVYNLLQSSSP+VRYEAAGTL+TL++  AA+KA AS YIDLI+KESDNNVKLIVLDRLV LR   ++EK LQ LVMD+LR+LSS  LEVRKKTL L LDL+++R  E+++  L+KE+ K  +  N ++G     YR  LV T++ A +++P++  T+VP L E L+   E      +  V +F+REA+ K P  K+ I+  L E  P I+   +    +WI+  YC   D   + + L+   LG +PLV+ E   +SG+  ++     P+     Q  KVTADGTYATQTAL+ST     T+S +N ++P L+  L   +F  G +L+  L K+   F  L+ A  E          + N F AECMLI++S+I+L KS L  +   V  D LDRM   +K LA     + +     C+  L  M+ ++   R  +D T E +  T          ++ D  ++F+ L A  N+  E  + FDL++SQAL   GT  K +   FS+SKL KV QL GFSDPIYAEAYV+VNQYDIVLD+ +VNQTSDTLQN+++ELAT+GDLKLV+KP+P+T+ P+DF+NIKA +KV+S+ENG+IF  I YDV+G+  + NCV L DI IDI++YI+P + + + +R MW++FEWENKV V T I+DL  +LNH++ +TNM+ LT   A+EG+C +L   L A SIFGE  LAN+ +EK      + P+ GH+RIRAKSQGM +T+G+K+S+A +
Sbjct:    1 MSSGEQPCYTLIHVPSDAELPSEAQLKEKFEKGGDKERIEALKKLIYMILNGEKTSQSMLMYVIRFCLPSNEHTLKKVLLIFWECVPKTDSNGKLLHEMILVCDAYRKDLQHPNEFVRGSTLRFLCKLREPELLEPLMPAIRACLEHRHSYVRRNAVCAIFTIYKNFEFLIPDAPELVTEYLEQEQDASCKRNAFMMLLHVDQARALDYLSGCIDQVGSFGDILQLVIVELIYKVCHNNPNEASRFIRCVYNLLQSSSPAVRYEAAGTLVTLSNVPAAVKAAASAYIDLIVKESDNNVKLIVLDRLVALRGSSSNEKILQGLVMDILRVLSSPGLEVRKKTLSLALDLVSSRNVEDMVMFLKKEINKTATESNDENG----KYRQELVKTLHAATIKFPDVASTIVPVLMEFLSDTNE----KASSYVLQFVREAVHKLPNLKNAILGALREGIPFIQSPTIFMSALWILATYCEA-DGALDVLKLVKNSLGELPLVDSE---LSGQEEQKPEEQQPE-QQQKQKPKVTADGTYATQTALSSTV----TTSKKN-EKPPLRRFLLDGEFFLGASLATVLTKLAQQFTELNGAASE----------RANRFRAECMLILSSIIHLAKSGLCIVHQQVNEDDLDRMGATIKILAQGIPGLDEQYGDDCKKSLELMLGAKSISR--LDVTTEKMASTTAAGYRSKDFVEIDKTINFTQLSARSNQQGE--NLFDLSLSQAL---GTAPKAQKFDFSSSKLGKVIQLAGFSDPIYAEAYVNVNQYDIVLDVLIVNQTSDTLQNVSLELATVGDLKLVDKPTPVTLAPNDFSNIKATVKVASTENGVIFSTISYDVTGSTSDRNCVYLQDIKIDIMDYIVPGNVTDTEFRTMWSDFEWENKVNVMTPIRDLRDFLNHLSTSTNMKVLTGDAAIEGDCGFLAANLCAHSIFGEDALANVSVEKALPMDDSSPIVGHIRIRAKSQGMCLTLGDKLSSAMR 958          
BLAST of Coatomer subunit beta vs. Ensembl Celegans
Match: apb-3 (AP-3 complex subunit beta [Source:UniProtKB/TrEMBL;Acc:O62348])

HSP 1 Score: 59.3066 bits (142), Expect = 1.353e-8
Identity = 43/138 (31.16%), Postives = 73/138 (52.90%), Query Frame = 2
Query:  101 LKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            LK  L S    LK +A+KR+I +I  G+ ++ L   V++ V   +N  +KKL+ ++  +V   +    LA   +L    +++ L+ PN+ IRGS LR L  ++ P V   ++ +I   +     YVR+ A  AI  +Y
Sbjct:   31 LKAMLDSNKDNLKVDAMKRIINLIAKGKDVSELFAAVVKNVA-AKNVELKKLVFVY--LVRYAEEQQDLA---LLSISTFQRALKDPNQLIRGSALRVLTSIRVPMVAPIMLLAIKDAVRDMSPYVRKVAAHAIPKLY 162          
BLAST of Coatomer subunit beta vs. Ensembl Celegans
Match: apb-3 (AP-3 complex subunit beta [Source:UniProtKB/TrEMBL;Acc:O62348])

HSP 1 Score: 59.3066 bits (142), Expect = 1.480e-8
Identity = 43/138 (31.16%), Postives = 73/138 (52.90%), Query Frame = 2
Query:  101 LKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            LK  L S    LK +A+KR+I +I  G+ ++ L   V++ V   +N  +KKL+ ++  +V   +    LA   +L    +++ L+ PN+ IRGS LR L  ++ P V   ++ +I   +     YVR+ A  AI  +Y
Sbjct:   31 LKAMLDSNKDNLKVDAMKRIINLIAKGKDVSELFAAVVKNVA-AKNVELKKLVFVY--LVRYAEEQQDLA---LLSISTFQRALKDPNQLIRGSALRVLTSIRVPMVAPIMLLAIKDAVRDMSPYVRKVAAHAIPKLY 162          
BLAST of Coatomer subunit beta vs. Ensembl Fly
Match: betaCOP (gene:FBgn0008635 transcript:FBtr0074576)

HSP 1 Score: 1021.15 bits (2639), Expect = 0.000e+0
Identity = 539/996 (54.12%), Postives = 711/996 (71.39%), Query Frame = 2
Query:   29 MTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLRENH--EKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEES------------ALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLAN--KNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFS-TSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPG--NEPVTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            MTS   CYT+IN P + +V +E +LK DL+  D  +K   LKRVI ++ NGE+   L+M +IRFV+P QNHT+KKLLL+FWE+VPK   +GKL QEMILVCDAYRKDLQHPNEF+RGSTLRFLCKLKEPE+LEPLMP+I  CL+HRHSYVRRNAVLAIFTIYKNF++L+PD PE I +FLD +QD SCKRNAF+MLLHA QE AL YL++C+DQVHTFGDILQL+IVELIYKVCH+NP ER+RFIRC+YNLL SSS +VRYE+AGTLITL+ A  AIKA ASCYI+L++KESDNNVKLIVLDRLV ++E+   EK +Q LVMDVLR+L++ D+EVR+KTL L LDL+ +R   E++ VL+KEV K  + E+ D+G     YR  LV T++   +++P++   V+P L E L+   +  E   AD V  F+REAIQK+P  ++LIIE L+E +P I+  ++ R  +WI+GEY     +I   + +I Q LG VP+VE E +R++G+  EE                A   G  + + KVT+DGTYATQ+A  S  P    + AE  KRP L+  L   DF  G  LS  L K+  R ++   E+        + +N    + MLI++S+++LGKS      +  D  DR++ CL+ L++R    +      CR  L +M+++Q  E + +      L + +     +QPD PV F+ L+N   N++ E +  F+ +++QAL   G+     SD+ S  SKL+KVTQLTGFSDP+YAEAYV+VNQYDIVLD+ +VNQT+DTLQN T+ELATLGDLKLVE+P P+ + PHDF NIKAN+KVSS+ENGIIFGNIVY+    A   N VVLN IHIDI++YI+PASC+ + +R+MW +FEWENKVTVNT   DLH+YL H+ K+TNM+CLTP +AL G+C ++   +YAKSIFGE+ LAN+ +EKP    +  VTGH+RIRAKSQGMA+++G+KIS++QKQ
Sbjct:    1 MTSQVPCYTIINSP-DLEVTNEMQLKRDLEKGDTNVKIETLKRVIKLLLNGERYPGLIMTIIRFVLPVQNHTIKKLLLIFWEIVPKTSADGKLLQEMILVCDAYRKDLQHPNEFLRGSTLRFLCKLKEPELLEPLMPAIRACLDHRHSYVRRNAVLAIFTIYKNFDWLVPDGPELIASFLDTQQDMSCKRNAFLMLLHADQERALNYLASCIDQVHTFGDILQLVIVELIYKVCHANPAERSRFIRCIYNLLNSSSNAVRYESAGTLITLSLAPTAIKAAASCYIELVVKESDNNVKLIVLDRLVAMKEHEGMEKVMQDLVMDVLRVLAAPDIEVRRKTLALALDLVYSRNIGEMVLVLKKEVAKTHNVEHEDTG----KYRQLLVRTLHTCSIKFPDVAANVIPVLVEFLS---DTNELAAAD-VLIFIREAIQKFPALRALIIEHLIEAFPQIKSSKIHRAAVWILGEYVEG-SQILEVIAVIQQTLGEVPMVEAEQRRLAGDQTEEQKQQQGSAGGNAAGSAAEGSGSGNASNKVTSDGTYATQSAY-SLAP---VAKAE--KRPPLRQYLMDGDFFIGAALSATLTKLALRYAELETEA--------RAQNRLTTQVMLIMSSILHLGKSGFPSKPITNDDTDRIFVCLRTLSERTPEAISVFTLYCREALGKMLDAQHDEDQRM------LKEKQKATAKVQPDDPVLFAQLSNGRDNQLGENV--FESSLNQALA--GSKNAQLSDVASPNSKLNKVTQLTGFSDPVYAEAYVNVNQYDIVLDVLIVNQTNDTLQNCTLELATLGDLKLVERPHPVVLAPHDFCNIKANVKVSSTENGIIFGNIVYET---ALNTNVVVLNTIHIDIMDYIIPASCTDTEFRQMWQDFEWENKVTVNTSFTDLHEYLKHLLKSTNMKCLTPEKALSGQCGFMAANMYAKSIFGENALANLSIEKPVDDPDSKVTGHIRIRAKSQGMALSLGDKISSSQKQ 959          
BLAST of Coatomer subunit beta vs. Ensembl Fly
Match: rb (gene:FBgn0003210 transcript:FBtr0070702)

HSP 1 Score: 56.225 bits (134), Expect = 1.612e-7
Identity = 45/147 (30.61%), Postives = 73/147 (49.66%), Query Frame = 2
Query:   74 ESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            +SD      LK  L S    LK  A+KR+I MI  G   ++L   V++ V+  +N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++   ++  +M +I         YVR+ A  AI  +Y
Sbjct:   39 QSDGRKHDDLKQMLDSNKDGLKLEAMKRIIGMIARGRDASDLFPAVVKNVV-SKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRALKDPNQLIRASALRVLSSIRVSMIVPIVMLAIRDSAADLSPYVRKTAAHAIPKLY 179          
BLAST of Coatomer subunit beta vs. Ensembl Fly
Match: rb (gene:FBgn0003210 transcript:FBtr0332290)

HSP 1 Score: 56.225 bits (134), Expect = 1.612e-7
Identity = 45/147 (30.61%), Postives = 73/147 (49.66%), Query Frame = 2
Query:   74 ESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            +SD      LK  L S    LK  A+KR+I MI  G   ++L   V++ V+  +N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++   ++  +M +I         YVR+ A  AI  +Y
Sbjct:   39 QSDGRKHDDLKQMLDSNKDGLKLEAMKRIIGMIARGRDASDLFPAVVKNVV-SKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRALKDPNQLIRASALRVLSSIRVSMIVPIVMLAIRDSAADLSPYVRKTAAHAIPKLY 179          
BLAST of Coatomer subunit beta vs. Ensembl Fly
Match: rb (gene:FBgn0003210 transcript:FBtr0343568)

HSP 1 Score: 56.225 bits (134), Expect = 1.612e-7
Identity = 45/147 (30.61%), Postives = 73/147 (49.66%), Query Frame = 2
Query:   74 ESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            +SD      LK  L S    LK  A+KR+I MI  G   ++L   V++ V+  +N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++   ++  +M +I         YVR+ A  AI  +Y
Sbjct:   39 QSDGRKHDDLKQMLDSNKDGLKLEAMKRIIGMIARGRDASDLFPAVVKNVV-SKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRALKDPNQLIRASALRVLSSIRVSMIVPIVMLAIRDSAADLSPYVRKTAAHAIPKLY 179          
BLAST of Coatomer subunit beta vs. Ensembl Fly
Match: g (gene:FBgn0001087 transcript:FBtr0073842)

HSP 1 Score: 51.9878 bits (123), Expect = 3.185e-6
Identity = 100/482 (20.75%), Postives = 203/482 (42.12%), Query Frame = 2
Query:   95 QKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTC---LDQVHTFGDILQLI-IVELIYKVCHSNPQERARFIRCVYNLLQSSSP-SVRYEXXXXXXXXXXXXXXXXXXXXCYIDL-------ILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLV--NTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCR-------EVLRHTMWIMGEYCTTIDEIENFVNLI 1477
            +++K +L+  +I +K NA+ ++  +   G  I+     +I  VM     T K++  L        D     ++ ++L  +  RKDL   N++  G  L  L     P++   L   I+  +     Y+R  AVL ++ ++  +   +  A  K+   L ++ D   +  A  ++   +++    YL         + T  +   LI I++L   +    P+   + I  + NL+ S+S  S+ YE   T+I +  + ++     S  I L       ++++SD N+K + L  +  + + H K +Q     +L  L   D  +R + L L   +++ +   E++    K ++       G +  DE +Y+   +   + Y     + E   TV   L EL+  ++E    +G     + L  AI + P  +   + ++                 EVL    WI+GE+   +++ E  +N++
Sbjct:   42 EEIKQELRQDNISVKCNAVAKLTYIQMLGYDISWAGFNIIE-VMSSSRFTCKRIGYLAASQCFHPD-----SELLMLTTNMIRKDLNSQNQYDAGVALSGLSCFISPDLSRDLANDIMTLMSSTKPYLRMKAVLMMYKVFLRYPEALRPAFPKLKEKL-EDPDPGVQSAAVNVICELARKNPKNYLPLAPIFFKLMTTSTNNWMLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECINTVIAVLISISSGMPNHSASIQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTHPKSVQAHKDLILACLDDKDESIRLRALDLLYGMVSKKNLMEIV----KRLLGHMERAEGSAYRDELLYKVIEICAQSSYLYVTNF-EWYLTV---LVELI--QLEAGSRHGRLIAEQLLDVAI-RVPVVRQFAVNEMTNLLDTFTVSAQSNSMYEVLYAAAWIVGEFAGELEDAEKTLNIL 505          
BLAST of Coatomer subunit beta vs. Ensembl Zebrafish
Match: copb1 (coatomer protein complex, subunit beta 1 [Source:NCBI gene;Acc:338138])

HSP 1 Score: 1083.55 bits (2801), Expect = 0.000e+0
Identity = 568/984 (57.72%), Postives = 730/984 (74.19%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGE-NNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKP---PGNEPVTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            +  ++  CYTLIN+ N+S+ PSE  LK DL+  +IK KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +GKL QEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQVHTFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRL+ L+E+  HE+ LQ LVMD+LR+L++ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LIIEK++E +  I+  ++ R  +WI+GEYC+T ++I++ +  + + LG +P+VE+E+K+ +GE   EE    AP   +      VT  GTY TQ+AL++++P+K+        RP L+  L   DF    +L+  L KV      ALR    + ++  +++NSF AE MLI+A++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L  M+  +  E  ++ +  ES  + R V   +Q D P+ F  L  KNEM    D+F L++  A+G+T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PASC+ + +R+MW EFEWENKVTVNT I DL+ YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP     + PV GH+RIRAKSQGMA+++G+KI+ +QK+
Sbjct:    1 MTAAENVCYTLINVTNDSEPPSEVSLKTDLEKGEIKAKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGKLLQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKESELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVHTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLIELKEHPTHERVLQDLVMDILRVLTTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVTEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DTNEAAAAD-VLEFVREAIQRFDNLRPLIIEKMLEVFHAIKTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVENELKKEAGEVKPEEEVTAAPAPKL------VTEMGTYVTQSALSTSRPSKKEED-----RPPLRGFLMDGDFYVAASLATTLTKV------ALRYVALAEDK--RRQNSFVAEAMLIMATVLHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRRSLSHMLAVR-LEEEKLSQKKES--EKRNV--TVQADDPISFMQLTAKNEMASKEDQFQLSLLAAMGNTQR--KEATDPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENKVTVNTNITDLNDYLLHILKSTNMKCLTPEKALSGICGFMAANLYARSIFGEDALANVSIEKPIHLGVDAPVNGHIRIRAKSQGMALSLGDKINLSQKR 950          
BLAST of Coatomer subunit beta vs. Ensembl Zebrafish
Match: copb1 (coatomer protein complex, subunit beta 1 [Source:NCBI gene;Acc:338138])

HSP 1 Score: 1083.55 bits (2801), Expect = 0.000e+0
Identity = 568/984 (57.72%), Postives = 730/984 (74.19%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGE-NNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKP---PGNEPVTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            +  ++  CYTLIN+ N+S+ PSE  LK DL+  +IK KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +GKL QEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQVHTFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRL+ L+E+  HE+ LQ LVMD+LR+L++ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LIIEK++E +  I+  ++ R  +WI+GEYC+T ++I++ +  + + LG +P+VE+E+K+ +GE   EE    AP   +      VT  GTY TQ+AL++++P+K+        RP L+  L   DF    +L+  L KV      ALR    + ++  +++NSF AE MLI+A++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L  M+  +  E  ++ +  ES  + R V   +Q D P+ F  L  KNEM    D+F L++  A+G+T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PASC+ + +R+MW EFEWENKVTVNT I DL+ YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP     + PV GH+RIRAKSQGMA+++G+KI+ +QK+
Sbjct:    1 MTAAENVCYTLINVTNDSEPPSEVSLKTDLEKGEIKAKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGKLLQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKESELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVHTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLIELKEHPTHERVLQDLVMDILRVLTTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVTEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DTNEAAAAD-VLEFVREAIQRFDNLRPLIIEKMLEVFHAIKTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVENELKKEAGEVKPEEEVTAAPAPKL------VTEMGTYVTQSALSTSRPSKKEED-----RPPLRGFLMDGDFYVAASLATTLTKV------ALRYVALAEDK--RRQNSFVAEAMLIMATVLHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRRSLSHMLAVR-LEEEKLSQKKES--EKRNV--TVQADDPISFMQLTAKNEMASKEDQFQLSLLAAMGNTQR--KEATDPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENKVTVNTNITDLNDYLLHILKSTNMKCLTPEKALSGICGFMAANLYARSIFGEDALANVSIEKPIHLGVDAPVNGHIRIRAKSQGMALSLGDKINLSQKR 950          
BLAST of Coatomer subunit beta vs. Ensembl Zebrafish
Match: CU929160.1 (pep chromosome:GRCz11:21:7298687:7325703:1 gene:ENSDARG00000110056.1 transcript:ENSDART00000187746.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU929160.1)

HSP 1 Score: 63.1586 bits (152), Expect = 7.976e-11
Identity = 44/147 (29.93%), Postives = 78/147 (53.06%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYK 517
            +D    + LK+ L+S    LK  A+KRV+ +I NG+  + L   V++ V   +N  +KKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++ P ++  +M +I +       YVR+ A  AI  +Y+
Sbjct:   39 ADYKKNEDLKEMLESNKESLKLEAMKRVVGLIANGKNASELFPAVVKNV-ASKNIELKKLVYVY--LVRYAEEQQDLA---LLSISTFQRALKDPNQLIRASALRVLSSIRVPIIVPIMMLAIKEAATDLSPYVRKTAAHAIQKLYR 179          
BLAST of Coatomer subunit beta vs. Ensembl Zebrafish
Match: AP3B2 (adaptor related protein complex 3 beta 2 subunit [Source:NCBI gene;Acc:100000165])

HSP 1 Score: 58.151 bits (139), Expect = 5.363e-8
Identity = 38/123 (30.89%), Postives = 66/123 (53.66%), Query Frame = 2
Query:  134 LKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAI 502
            LK  A+KR++ MI  G+  ++L   V++ V  C+N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++   ++  +M +I +       YVR+ A  AI
Sbjct:    9 LKLEAMKRIVAMIARGKNASDLFPAVVKNVA-CKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRGLKDPNQLIRASALRVLSSIRVTIIVPIMMLAIKEAASDMSPYVRKTAAHAI 125          
BLAST of Coatomer subunit beta vs. Ensembl Zebrafish
Match: ap3d1 (adaptor related protein complex 3 subunit delta 1 [Source:ZFIN;Acc:ZDB-GENE-050208-437])

HSP 1 Score: 54.299 bits (129), Expect = 8.733e-7
Identity = 87/410 (21.22%), Postives = 173/410 (42.20%), Query Frame = 2
Query:   98 KLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY----KNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTC-----LDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSP-SVRYEXXXXXXXXXXXXXXXXXXXXCYIDL-------ILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVL------------RKE----VIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPT 1228
            ++K +L+  +I +K NA+ ++  +   G  ++     ++  VM     T K++  L      +  + G     ++L  +  RKDL  PN++  G  L  L     P++   L   I+  + H   Y+R+ AVL ++ ++    ++     P   EK+     ++ D   +  A  ++   ++     YLS       L    T   +L + I++L   +    P+   + I  + NL+ S+S  S+ YE   T+I +  + ++     S  I L       ++++SD N+K + L  +  + + H K +Q+    +L+ L   D  +R + L L   +++ +   E++  L            R E    +I ICS  N     + + Y   LV        R+  +I +
Sbjct:   42 EIKQELKQDNIAVKANAVCKLTYLQMLGYDVSWAAFNIVE-VMSSSKFTYKRIGYL---AASQCFHEG--TDVIMLTTNQIRKDLSSPNQYDTGVALTGLSCFVTPDLARDLANDIMTLMSHTKPYIRKKAVLIMYKVFLKYPESLRPAFPRLKEKL-----EDPDPGVQSAAVNVICELARRNPKNYLSLAPLFFKLMTSSTNNWVL-IKIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECVNTVIAVLISLSSGMPNHSASIQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTHPKSVQSHKDLILQCLDDKDESIRLRALDLLYGMVSKKNLMEIVKKLMLHVDKAEGTTYRDELLTKIIDICSQSNYQYITNFEWYISILVELTRLEGTRHGHLIAS 439          
BLAST of Coatomer subunit beta vs. Ensembl Xenopus
Match: copb1 (coatomer protein complex subunit beta 1 [Source:NCBI gene;Acc:100216235])

HSP 1 Score: 1081.24 bits (2795), Expect = 0.000e+0
Identity = 568/990 (57.37%), Postives = 731/990 (73.84%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACK--VTADGTYATQTALTSTKPNKRTS-----SAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPP--GNE-PVTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            +  ++  CYTLIN+P +S+ PSE  LK DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +GKL QEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRLV L+++  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L L+L+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REA+Q++   + LI+EK++E +  I+  ++ R  +WI+GEYC+T ++I + +  + + LG VP+VE E+K+ SGE       L P+  VT    +  VT  GTYATQ+AL+S++P K+       +     RP L+  L   DF    +L+  L K+  R    ++E         +K+NSF AE ML++A++++LGKS L    +  D +DR+  CLK L++ +  + +     CR  L  M++++  E  ++ +  ES  + R V   +QPD P+ F  L  KNE     D+F L++  A+G T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQT DTLQ+ T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PASC+ + +R+MW EFEWENKVTVNT I DL++YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP   G E PVTGH+RIRAKSQGMA+++G+KI+ +QK+
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEITLKADLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGKLLQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLVELKDHPSHERVLQDLVMDILRVLSTPDLEVRKKTLQLALELVSSRNVEELVIVLKKEVIK---TNNVTEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DSNEAAAAD-VLEFVREAVQRFDNLRPLIVEKMLEVFHAIKSVKIYRAALWILGEYCSTKEDINSVMTEVRRSLGEVPIVETELKKESGE-------LKPEEDVTVGPTQKLVTEMGTYATQSALSSSRPAKKEEERVILTYAWTYRPPLRGFLLDGDFYVAASLATTLTKIALRYVALVQEK--------RKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNEIFNKECRQSLSHMLSAK-LEEEKLSQKKES--EKRNV--TVQPDDPISFMQLTAKNETASKEDQFQLSLLAAMGTTQR--KEAADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTGDTLQSCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDTEFRQMWAEFEWENKVTVNTNITDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQKK 960          
BLAST of Coatomer subunit beta vs. Ensembl Xenopus
Match: copb1 (coatomer protein complex subunit beta 1 [Source:NCBI gene;Acc:100216235])

HSP 1 Score: 963.37 bits (2489), Expect = 0.000e+0
Identity = 509/888 (57.32%), Postives = 654/888 (73.65%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACK--VTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKV 2677
            +  ++  CYTLIN+P +S+ PSE  LK DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +GKL QEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRLV L+++  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L L+L+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REA+Q++   + LI+EK++E +  I+  ++ R  +WI+GEYC+T ++I + +  + + LG VP+VE E+K+ SGE       L P+  VT    +  VT  GTYATQ+AL+S++P K+       +RP L+  L   DF    +L+  L K+  R    ++E         +K+NSF AE ML++A++++LGKS L    +  D +DR+  CLK L++ +  + +     CR  L  M++++  E  ++ +  ES  + R V   +QPD P+ F  L  KNE     D+F L++  A+G T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQT DTLQ+ T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PASC+ + +R+MW EFEWENKV
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEITLKADLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGKLLQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLVELKDHPSHERVLQDLVMDILRVLSTPDLEVRKKTLQLALELVSSRNVEELVIVLKKEVIK---TNNVTEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DSNEAAAAD-VLEFVREAVQRFDNLRPLIVEKMLEVFHAIKSVKIYRAALWILGEYCSTKEDINSVMTEVRRSLGEVPIVETELKKESGE-------LKPEEDVTVGPTQKLVTEMGTYATQSALSSSRPAKKEE-----ERPPLRGFLLDGDFYVAASLATTLTKIALRYVALVQEK--------RKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNEIFNKECRQSLSHMLSAK-LEEEKLSQKKES--EKRNV--TVQPDDPISFMQLTAKNETASKEDQFQLSLLAAMGTTQR--KEAADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTGDTLQSCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDTEFRQMWAEFEWENKV 853          
BLAST of Coatomer subunit beta vs. Ensembl Xenopus
Match: ap3b2 (adaptor related protein complex 3 subunit beta 2 [Source:NCBI gene;Acc:100158619])

HSP 1 Score: 67.0106 bits (162), Expect = 1.424e-10
Identity = 46/146 (31.51%), Postives = 76/146 (52.05%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            SD      LK+ L S    LK  A+KR++ MI  G+  ++L   V++ V  C+N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++ P ++  +M +I +       YVR+ A  AI  +Y
Sbjct:   32 SDFKRHDDLKEMLDSNKDSLKLEAMKRIVAMIARGKNTSDLFPAVVKNVA-CKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRGLKDPNQLIRASALRVLSSIRVPIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLY 171          
BLAST of Coatomer subunit beta vs. Ensembl Xenopus
Match: ap3b2 (adaptor related protein complex 3 subunit beta 2 [Source:NCBI gene;Acc:100158619])

HSP 1 Score: 67.0106 bits (162), Expect = 1.750e-10
Identity = 46/146 (31.51%), Postives = 76/146 (52.05%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            SD      LK+ L S    LK  A+KR++ MI  G+  ++L   V++ V  C+N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++ P ++  +M +I +       YVR+ A  AI  +Y
Sbjct:   32 SDYKRHDDLKEMLDSNKDSLKLEAMKRIVAMIARGKNTSDLFPAVVKNVA-CKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRGLKDPNQLIRASALRVLSSIRVPIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLY 171          
BLAST of Coatomer subunit beta vs. Ensembl Xenopus
Match: ap3b2 (adaptor related protein complex 3 subunit beta 2 [Source:NCBI gene;Acc:100158619])

HSP 1 Score: 67.0106 bits (162), Expect = 1.760e-10
Identity = 46/146 (31.51%), Postives = 76/146 (52.05%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            SD      LK+ L S    LK  A+KR++ MI  G+  ++L   V++ V  C+N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++ P ++  +M +I +       YVR+ A  AI  +Y
Sbjct:   32 SDFKRHDDLKEMLDSNKDSLKLEAMKRIVAMIARGKNTSDLFPAVVKNVA-CKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRGLKDPNQLIRASALRVLSSIRVPIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLY 171          
BLAST of Coatomer subunit beta vs. Ensembl Mouse
Match: Copb1 (coatomer protein complex, subunit beta 1 [Source:MGI Symbol;Acc:MGI:1917599])

HSP 1 Score: 1093.57 bits (2827), Expect = 0.000e+0
Identity = 568/985 (57.66%), Postives = 732/985 (74.31%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACK--VTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEP---VTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            +  ++  CYTLIN+P +S+ PSE  LK+DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +G+L  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRLV L+E+  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LI+EK++E +  I+  ++ R  +WI+GEYC+T ++I++ +  + + LG +P+VE EIK+ +GE       L P+  +T    +  VT  GTYATQ+AL+S++P K+        RP L+  L   DF    +L+  L K+  R    ++E         KK+NSF AE ML++A++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L +M++++  E  ++ +  ES  + R V   +QPD P+ F  L  KNEMN   D+F L++  A+G+T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PA+C+ + +R+MW EFEWENKVTVNT + DL+ YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP    P   VTGH+RIRAKSQGMA+++G+KI+ +QK+
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLVELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DSNEAAAAD-VLEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIKKEAGE-------LKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEED-----RPPLRGFLLDGDFFVAASLATTLTKIALRYVALVQEK--------KKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSQMLSAK-LEEEKLSQKKES--EKRNV--TVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQR--KEAADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENKVTVNTNMTDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKK 950          
BLAST of Coatomer subunit beta vs. Ensembl Mouse
Match: Ap3b2 (adaptor-related protein complex 3, beta 2 subunit [Source:MGI Symbol;Acc:MGI:1100869])

HSP 1 Score: 65.0846 bits (157), Expect = 4.165e-10
Identity = 45/146 (30.82%), Postives = 76/146 (52.05%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            SD      LK+ L +    LK  A+KR++ MI  G+  ++L   V++ V  C+N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++ P ++  +M +I +       YVR+ A  AI  +Y
Sbjct:   34 SDYKRHDDLKEMLDTNKDSLKLEAMKRIVAMIARGKNASDLFPAVVKNVA-CKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRGLKDPNQLIRASALRVLSSIRVPIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLY 173          
BLAST of Coatomer subunit beta vs. Ensembl Mouse
Match: Ap3b2 (adaptor-related protein complex 3, beta 2 subunit [Source:MGI Symbol;Acc:MGI:1100869])

HSP 1 Score: 65.0846 bits (157), Expect = 4.249e-10
Identity = 45/146 (30.82%), Postives = 76/146 (52.05%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            SD      LK+ L +    LK  A+KR++ MI  G+  ++L   V++ V  C+N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++ P ++  +M +I +       YVR+ A  AI  +Y
Sbjct:   34 SDYKRHDDLKEMLDTNKDSLKLEAMKRIVAMIARGKNASDLFPAVVKNVA-CKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRGLKDPNQLIRASALRVLSSIRVPIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLY 173          
BLAST of Coatomer subunit beta vs. Ensembl Mouse
Match: Ap3b1 (adaptor-related protein complex 3, beta 1 subunit [Source:MGI Symbol;Acc:MGI:1333879])

HSP 1 Score: 61.6178 bits (148), Expect = 5.101e-9
Identity = 44/146 (30.14%), Postives = 76/146 (52.05%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            SD    + LK  L+S     K +A+KR++ MI  G+  + L   V++ V   +N  +KKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++ P ++  +M +I +       YVR+NA  AI  +Y
Sbjct:   39 SDWKKNEDLKQMLESNKDSAKLDAMKRIVGMIAKGKNASELFPAVVKNVA-SKNIEIKKLVYVY--LVRYAEEQQDLA---LLSISTFQRALKDPNQLIRASALRVLSSIRVPIIVPVMMLAIKEASADLSPYVRKNAAHAIQKLY 178          
BLAST of Coatomer subunit beta vs. Ensembl Mouse
Match: Ap3d1 (adaptor-related protein complex 3, delta 1 subunit [Source:MGI Symbol;Acc:MGI:107734])

HSP 1 Score: 53.5286 bits (127), Expect = 1.490e-6
Identity = 88/408 (21.57%), Postives = 172/408 (42.16%), Query Frame = 2
Query:   98 KLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY----KNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTC-----LDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSP-SVRYEXXXXXXXXXXXXXXXXXXXXCYIDL-------ILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVL------------RKE----VIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMI 1222
            ++K +L+  +I +K NA+ ++  +   G  I+     +I  VM     T K++  L      +  + G     ++L  +  RKDL  P+++  G  L  L     P++   L   I+  + H   Y+R+ AVL ++ ++    ++     P   EK+     ++ D   +  A  ++   ++     YLS       L    T   +L + I++L   +    P+   + I  + NL+ S+S  S+ YE   T+I +  + ++     S  I L       ++++SD N+K + L  +  + + H K +Q+    +L+ L   D  +R + L L   +++ +   E++  L            R E    +I ICS  N     + + Y   LV        R+  +I
Sbjct:   42 EIKQELKQDNIAVKANAVCKLTYLQMLGYDISWAAFNIIE-VMSASKFTFKRVGYL---AASQCFHEG--TDVIMLTTNQIRKDLSSPSQYDTGVALTGLSCFVTPDLARDLANDIMTLMSHTKPYIRKKAVLIMYKVFLKYPESLRPAFPRLKEKL-----EDPDPGVQSAAVNVICELARRNPKNYLSLAPLFFKLMTSSTNNWVL-IKIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECVNTVIAVLISLSSGMPNHSASIQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTHPKSVQSHKDLILQCLDDKDESIRLRALDLLYGMVSKKNLMEIVKKLMTHVDKAEGTTYRDELLTKIIDICSQSNYQHITNFEWYISILVELTRLEGTRHGHLI 437          
BLAST of Coatomer subunit beta vs. UniProt/SwissProt
Match: sp|Q5ZIA5|COPB_CHICK (Coatomer subunit beta OS=Gallus gallus OX=9031 GN=COPB1 PE=2 SV=1)

HSP 1 Score: 1098.96 bits (2841), Expect = 0.000e+0
Identity = 574/985 (58.27%), Postives = 736/985 (74.72%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACK--VTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPP--GNE-PVTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            +  ++  CYTLIN+P +S+ PSE  LK+DL+  D+KLKT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +G+L QEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRLV L+E+  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LI+EK++E +  I+  ++ R  +WI+GEYC+T ++I++ +  + + LG +P+VE EIK+ +GE       L P+  VT    +  VT  GTYATQ+AL+S++P K+        RP L+  L   DF    +L+  L K+  R    ++E         KK+NSF AE ML++A++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L  M++++  E  ++ +  ES  + R V   +QPD P+ F  L  KNEM+   D+F L++  A+G+T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PASC+ + +R+MW EFEWENKVTVNT I DL++YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP   G E PVTGH+RIRAKSQGMA+++G+KI+ +QK+
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKLKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLVELKEHPSHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVTEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DNNEAAAAD-VLEFVREAIQRFDNLRPLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIKKEAGE-------LKPEEEVTVGPVQKLVTEMGTYATQSALSSSRPTKKEED-----RPPLRGFLLDGDFFVAASLATTLTKIALRYVSLVQEK--------KKQNSFIAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAK-LEEEKLSQKKES--EKRNV--TVQPDDPISFMQLTAKNEMSSKEDQFQLSLLAAMGNTQR--KEAADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENKVTVNTNIIDLNEYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQKK 950          
BLAST of Coatomer subunit beta vs. UniProt/SwissProt
Match: sp|A0JN39|COPB_BOVIN (Coatomer subunit beta OS=Bos taurus OX=9913 GN=COPB1 PE=1 SV=1)

HSP 1 Score: 1095.88 bits (2833), Expect = 0.000e+0
Identity = 571/985 (57.97%), Postives = 734/985 (74.52%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACK--VTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKP--PGNE-PVTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            +  ++  CYTLIN+P +S+ PSE  LK+DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +G+L  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRL+ L+E+  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LI+EK++E +  I+  ++ R  +WI+GEYC+T D+I++ +  + + LG +P+VE EIK+ +GE       L P+  +T    +  VT  GTYATQ+AL+S++P K+       +RP L+  L   DF    +L+  L K+  R    ++E         KK+NSF AE ML++A++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L  M++++  E  ++ +  ES  + R V   +QPD P+ F  L  KNEMN   D+F L++  A+G+T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PA+C+ + +R+MW EFEWENKVTVNT I DL+ YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP   G E PVTGH+RIRAKSQGMA+++G+KI+ +QK+
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DSNEAAAAD-VLEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKDDIQSVMTEVRRSLGEIPIVESEIKKEAGE-------LKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEE-----ERPPLRGFLLDGDFFVAASLATTLTKIALRYVALVQEK--------KKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAK-LEEEKLSQKKES--EKRNV--TVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQR--KEAADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENKVTVNTNIVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIQQGPEAPVTGHIRIRAKSQGMALSLGDKINLSQKK 950          
BLAST of Coatomer subunit beta vs. UniProt/SwissProt
Match: sp|Q9JIF7|COPB_MOUSE (Coatomer subunit beta OS=Mus musculus OX=10090 GN=Copb1 PE=1 SV=1)

HSP 1 Score: 1093.57 bits (2827), Expect = 0.000e+0
Identity = 568/985 (57.66%), Postives = 732/985 (74.31%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACK--VTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEP---VTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            +  ++  CYTLIN+P +S+ PSE  LK+DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +G+L  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRLV L+E+  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LI+EK++E +  I+  ++ R  +WI+GEYC+T ++I++ +  + + LG +P+VE EIK+ +GE       L P+  +T    +  VT  GTYATQ+AL+S++P K+        RP L+  L   DF    +L+  L K+  R    ++E         KK+NSF AE ML++A++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L +M++++  E  ++ +  ES  + R V   +QPD P+ F  L  KNEMN   D+F L++  A+G+T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PA+C+ + +R+MW EFEWENKVTVNT + DL+ YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP    P   VTGH+RIRAKSQGMA+++G+KI+ +QK+
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLVELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DSNEAAAAD-VLEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIKKEAGE-------LKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEED-----RPPLRGFLLDGDFFVAASLATTLTKIALRYVALVQEK--------KKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSQMLSAK-LEEEKLSQKKES--EKRNV--TVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQR--KEAADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENKVTVNTNMTDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKK 950          
BLAST of Coatomer subunit beta vs. UniProt/SwissProt
Match: sp|P23514|COPB_RAT (Coatomer subunit beta OS=Rattus norvegicus OX=10116 GN=Copb1 PE=1 SV=1)

HSP 1 Score: 1093.18 bits (2826), Expect = 0.000e+0
Identity = 568/985 (57.66%), Postives = 732/985 (74.31%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACK--VTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEP---VTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            +  ++  CYTLIN+P +S+ PSE  LK+DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +G+L  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRLV L+E+  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LI+EK++E +  I+  ++ R  +WI+GEYC+T ++I++ +  + + LG +P+VE EIK+ +GE       L P+  +T    +  VT  GTYATQ+AL+S++P K+        RP L+  L   DF    +L+  L K+  R    ++E         KK+NSF AE ML++A++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L +M++++  E  ++ +  ES  + R V   +QPD P+ F  L  KNEMN   D+F L++  A+G+T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PA+C+ + +R+MW EFEWENKVTVNT + DL+ YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP    P   VTGH+RIRAKSQGMA+++G+KI+ +QK+
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFENLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLVELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DSNEAAAAD-VLEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVESEIKKEAGE-------LKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEED-----RPPLRGFLLDGDFFVAASLATTLTKIALRYVALVQEK--------KKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSQMLSAK-LEEEKLSQKKES--EKRNV--TVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQR--KEAADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENKVTVNTNVTDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKK 950          
BLAST of Coatomer subunit beta vs. UniProt/SwissProt
Match: sp|P53618|COPB_HUMAN (Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3)

HSP 1 Score: 1091.26 bits (2821), Expect = 0.000e+0
Identity = 568/988 (57.49%), Postives = 732/988 (74.09%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACK--VTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEP---VTGHVRIRAKSQGMAVTMGEKISAAQKQMPV 2968
            +  ++  CYTLIN+P +S+ PSE  LK+DL+  D+K KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +G+L  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRL+ L+E+  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LI+EK++E +  I+  ++ R  +WI+GEYC+T ++I++ +  I + LG +P+VE EIK+ +GE       L P+  +T    +  VT  GTYATQ+AL+S++P K+        RP L+  L   DF    +L+  L K+  R    ++E         KK+NSF AE ML++A++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L  M++++  E  ++ +  ES  + R V   +QPD P+ F  L  KNEMN   D+F L++  A+G+T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PA+C+ + +R+MW EFEWENKVTVNT + DL+ YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP    P   VTGH+RIRAKSQGMA+++G+KI+ +QK+  +
Sbjct:    1 MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DNNEAAAAD-VLEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIKKEAGE-------LKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEED-----RPPLRGFLLDGDFFVAASLATTLTKIALRYVALVQEK--------KKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAK-LEEEKLSQKKES--EKRNV--TVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQR--KEAADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI 953          
BLAST of Coatomer subunit beta vs. TrEMBL
Match: A0A430QUW4 (Coatomer subunit beta OS=Schistosoma bovis OX=6184 GN=DC041_0008500 PE=4 SV=1)

HSP 1 Score: 1273.46 bits (3294), Expect = 0.000e+0
Identity = 641/1014 (63.21%), Postives = 789/1014 (77.81%), Query Frame = 2
Query:   29 MTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNEN--------------GDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENN----------EESALLAPDGGV-TSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGK-------SREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKT-GESLIQ-TRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEPVTGHVRIRAKSQGMAVTMGEKISAAQKQMPV 2968
            M SDQ CYTL+ L +E+   +EQKLKDDLQ+ +  +K  ALK +I +I NGEK  NLLM VIRFVMP Q+H +KKLLLLFWEVVPKY  +GKL  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPE+LEP+MPSI QCLEHRH+YVRRNAVLAIFTIYKNF  LIPDAPEKI  FL+QEQD+SCKRNAFMMLLH SQ TAL+YL++CLD+V  FGDILQLIIVELIYKVC + P ER RFIRC+Y+LLQSSS +VRYEAAGTL TL+SA +AIKA ASCYI+LILKESDNNVKLIVL RL  LR+ HE+ LQ L+MD+++I+++SD+EVR+KTL L +DL+T RTAEELI + RKE+IK CS                  D   DE +YR+ LV+TIY  C+R+PE++P++VPT+CE+LTYE E  +   A+E CKFLRE ++++PQ K+ I+EKLM+ +P+I  RE LRH +WI GEYCTT +EI +F+ LI QV+G +PLV++E++R +G+ N          + S L++ D  V  S A +VTADGTYATQ+A T  + NK +SS   IKRP LQ++LF   +MPGV LS  LVK+F R S  L++          ++ +II KENSFAAECMLIIASMI+L  S LLPH V PD LDRMW CLK LADR   +L+A +   R  L EM+  Q++ER+   K   + LI+  + + ++ + D+P+ FSLL  + E  + +DRFDLT+SQALG  G       D ++TSKLSKV QLTGFSDP+YAEAYVHVNQ+DI+LD+ VVNQT DTLQNLT+EL+TLGDL+LVEKPSPLT+ P DF NIKANIKVSS+ENGIIFGNI YDV G++GE  C+VLNDIHIDI+EYI+PA+C+ S +R+MW+EFEWENKVTVNT+IKDL  YL+ IT +TN+RCLTP EAL G+CDYLCVTLYAK+IFGEHVLAN+CLEK   ++PVTGHVRIRAK+QGMAVTMGE++S+ QK  PV
Sbjct:   22 MASDQICYTLVGLSSEAKTYTEQKLKDDLQNSNDNVKREALKELIRLIINGEKFPNLLMTVIRFVMPSQDHMIKKLLLLFWEVVPKYSPDGKLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPELLEPIMPSIQQCLEHRHAYVRRNAVLAIFTIYKNFESLIPDAPEKILRFLEQEQDSSCKRNAFMMLLHVSQSTALDYLTSCLDEVQNFGDILQLIIVELIYKVCLAKPSERLRFIRCIYSLLQSSSAAVRYEAAGTLTTLSSAPSAIKAAASCYINLILKESDNNVKLIVLSRLTDLRQYHERILQDLIMDIVQIINASDMEVRQKTLNLTMDLVTARTAEELIKIFRKELIKACSTNTRPSASASDGEKSSADDQNSDESVYRFSLVHTIYDICLRFPEVLPSIVPTVCEILTYE-EIGDTRAANEACKFLREILERFPQRKADILEKLMQIFPSIIGRETLRHLVWIFGEYCTTYEEINSFMTLIRQVIGELPLVDEELRRQAGQVNSVDSSAENQSQPSVLISGDVNVGVSPAQRVTADGTYATQSAFT-LRSNKDSSSVNAIKRPVLQAALFESHYMPGVVLSACLVKLFYRYSLLLKQEQMKTVKDECTKTKIISKENSFAAECMLIIASMIHLATSQLLPHQVNPDHLDRMWICLKILADRRPEVLEAFEHTSRGCLTEMLAYQESERKNNAKARNQGLIEHQKQLAELNRADAPIKFSLLTGQTEFGDTVDRFDLTLSQALGAGGK--GSAGDAYATSKLSKVHQLTGFSDPVYAEAYVHVNQFDILLDVLVVNQTKDTLQNLTLELSTLGDLRLVEKPSPLTIAPQDFANIKANIKVSSTENGIIFGNISYDVRGSSGETTCIVLNDIHIDIMEYIMPATCTPSEFRQMWSEFEWENKVTVNTQIKDLFTYLSQITSHTNLRCLTPTEALSGDCDYLCVTLYAKTIFGEHVLANLCLEKAEADQPVTGHVRIRAKTQGMAVTMGERVSSCQKNWPV 1031          
BLAST of Coatomer subunit beta vs. TrEMBL
Match: A0A3Q0KKR9 (Coatomer subunit beta OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1272.69 bits (3292), Expect = 0.000e+0
Identity = 641/1016 (63.09%), Postives = 793/1016 (78.05%), Query Frame = 2
Query:   29 MTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICS--------------NENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENN----------EESALLAPDGGV-TSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALR---------ESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKT-GESLIQ-TRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEPVTGHVRIRAKSQGMAVTMGEKISAAQKQMPV 2968
            M SDQ CYTL+ L +E+   +EQKLKDDLQ+ +  +K  ALK +I +I NGEK  NLLM VIRFVMP Q+H +KKLLLLFWEVVPKY ++GKL  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPE+LEP+MPSI QCLEHRH+YVRRNAVLAIFTIYKNF  LIPDAPEKI  FL+QEQD+SCKRNAFMMLLH SQ TAL+YL++CLD+V  FGDILQLIIVELIYKVC + P ER RFIRC+Y+LLQSSS +VRYEAAGTL TL+SA +AIKA ASCYI+LILKESDNNVKLIVL RL  LR+ HE+ LQ L+MD+++I+++SD+EVR+KTL L +DL+T RTAEELI + RKE+IK CS              +   D   DE +YR+ LV+TIY  C+R+PE++P++VPT+CE+LTYE E  +   A+E CKFLRE ++++PQ K+ I+EKLM+ +P+I  RE LRH +WI GEYCTT +EI +F+ LI QV+G +PLV++E++R + + N          + S L++ D  V  + A +VTADGTYATQ+ALT  + NK +SS   IKRP LQ++LF   +MPGV LS  LVK+F R S  L+         ES KS+  I  KENSFAAECMLIIASM++L  S LLPH V PD LDRMW CLK LADR   +L+A +   R  L EM+  Q++ER+   K   + LI+  + + ++ + D+P+ FSLL  + E  + +DRFDLT+SQALG  G    +  D ++TSKLSKV QLTGFSDP+YAEAYVHVNQ+DI+LD+ VVNQT DTLQNLT+EL+TLGDL+LVEKPSPLT+ P DF +IKANIKVSS+ENGIIFGNI YDV G++GE  C+VLNDIHIDI+EYI+PA+C+ S +R+MW+EFEWENKVTVNT+IKDL  YL+ IT++TN+RCLTP EAL G+CDYLCVTLYAK+IFGEHVLAN+CLEK   ++PVTGHVRIRAK+QGMAVTMGE++S+ QK  PV
Sbjct:    1 MASDQICYTLVGLSSETKTYTEQKLKDDLQNSNDNVKREALKELIRLIINGEKFPNLLMTVIRFVMPSQDHMIKKLLLLFWEVVPKYSSDGKLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPELLEPIMPSIQQCLEHRHAYVRRNAVLAIFTIYKNFESLIPDAPEKILRFLEQEQDSSCKRNAFMMLLHVSQSTALDYLTSCLDEVQNFGDILQLIIVELIYKVCLAKPSERLRFIRCIYSLLQSSSAAVRYEAAGTLTTLSSAPSAIKAAASCYINLILKESDNNVKLIVLSRLTDLRQYHERILQDLIMDIVQIINASDMEVRQKTLNLTMDLVTARTAEELIKIFRKELIKACSTNTRPSAPASDGEKSSGDDQNSDESVYRFSLVHTIYDICLRFPEVLPSIVPTICEILTYE-EIGDTRAANEACKFLREILERFPQRKAEILEKLMQIFPSIVGRETLRHLVWIFGEYCTTYEEINSFMTLIRQVIGELPLVDEELRRQASQANPVDSSAENQSQPSVLISGDVNVGVNPAQRVTADGTYATQSALT-LRSNKDSSSVNAIKRPVLQAALFESHYMPGVVLSACLVKLFYRYSLILKQEQMKTVKDESTKSK--ITSKENSFAAECMLIIASMVHLATSQLLPHQVNPDHLDRMWICLKILADRRPEVLEAFEHTSRDCLTEMLTYQESERKNNAKARNQGLIEHQKQLAELNRADAPIKFSLLTGQTEFGDTVDRFDLTLSQALGAGGK--GNAGDAYATSKLSKVHQLTGFSDPVYAEAYVHVNQFDILLDVLVVNQTKDTLQNLTLELSTLGDLRLVEKPSPLTIAPQDFASIKANIKVSSTENGIIFGNISYDVRGSSGETTCIVLNDIHIDIMEYIMPATCTPSEFRQMWSEFEWENKVTVNTQIKDLFTYLSQITRHTNLRCLTPTEALSGDCDYLCVTLYAKTIFGEHVLANLCLEKAEADQPVTGHVRIRAKTQGMAVTMGERVSSCQKNWPV 1010          
BLAST of Coatomer subunit beta vs. TrEMBL
Match: A0A094ZET5 (Coatomer subunit beta OS=Schistosoma haematobium OX=6185 GN=MS3_00385 PE=4 SV=1)

HSP 1 Score: 1270.76 bits (3287), Expect = 0.000e+0
Identity = 642/1014 (63.31%), Postives = 788/1014 (77.71%), Query Frame = 2
Query:   29 MTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNEN--------------GDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKR---------ISGENNEE-SALLAPDGGV-TSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGK-------SREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKT-GESLIQ-TRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEPVTGHVRIRAKSQGMAVTMGEKISAAQKQMPV 2968
            M SDQ CYTL+ L +E+   +EQKLKDDLQ+ +  +K  ALK +I +I NGEK  NLLM VIRFVMP Q+H +KKLLLLFWEVVPKY ++GKL  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPE+LEP+MPSI QCLEHRH+YVRRNAVLAIFTIYKNF  LIPDAPEKI  FL+QEQD+SCKRNAFMMLLH SQ TAL+YL++CLD+V  FGDILQLIIVELIYKVC   P ER RFIRC+Y+LLQSSS +VRYEAAGTL TL+SA +AIKA ASCYI+LILKESDNNVKLIVL RL  LR+ HE+ LQ L+MD+++I+++SD+EVR+KTL L +DL+T RTAEELI + RKE+IK CS                  D   DE +YR+ LV+TIY  C+R+PE++P++VPT+CE+LTYE E  +   A+E CKFLRE ++++PQ K+ I+EKLM+ +P+I  RE LRH +WI GEYCTT +EI +F+ LI QV+G +PLV++E++R          S EN  + S L++ D  V  S A +VTADGTYATQ+A T  + NK +SS   IKRP LQ++LF   +MPGV LS  LVK+F R S  L++          ++ +II KENSFAAECMLIIASMI+L  S LLPH V PD LDRMW CLK LADR   +L+A +   R  L EM+  Q++ER+   K   + LI+  + + ++ + D+P+ FSLL  + E  + +DRFDLT+SQALG  G       D ++TSKLSKV QLTGFSDP+YAEAYVHVNQ+DI+LD+ VVNQT DTLQNLT+EL+TLGDL+LVEKPSPLT+ P DF NIKANIKVSS+ENGIIFGNI YDV G++GE  C+VLNDIHIDI+EYI+PA+C+ S +R+MW+EFEWENKVTVNT+IKDL  YL+ IT +TN+RCLTP EAL G+CDYLCVTLYAK+IFGEHVLAN+CLEK   ++PVTGHVRIRAK+QGMAVTMGE++S+ QK  PV
Sbjct:    1 MASDQICYTLVGLSSEAKTYTEQKLKDDLQNSNDNVKREALKELIRLIINGEKFPNLLMPVIRFVMPSQDHMIKKLLLLFWEVVPKYSSDGKLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPELLEPIMPSIQQCLEHRHAYVRRNAVLAIFTIYKNFESLIPDAPEKILRFLEQEQDSSCKRNAFMMLLHVSQSTALDYLTSCLDEVQNFGDILQLIIVELIYKVCLDKPSERLRFIRCIYSLLQSSSAAVRYEAAGTLTTLSSAPSAIKAAASCYINLILKESDNNVKLIVLSRLTDLRQYHERILQDLIMDIVQIINASDMEVRQKTLNLTMDLVTARTAEELIKIFRKELIKACSTNTRPSASASDGEKSSADDQNSDESVYRFSLVHTIYDICLRFPEVLPSIVPTVCEILTYE-EIGDTRAANEACKFLREILERFPQRKADILEKLMQIFPSIIGRETLRHLVWIFGEYCTTYEEINSFMTLIRQVIGELPLVDEELRRQASQVNSVNSSAENQSQPSVLISGDVNVGVSPAQRVTADGTYATQSAFT-LRSNKDSSSVNAIKRPVLQAALFESHYMPGVVLSACLVKLFYRYSLLLKQEQMKTVKDECTKTKIISKENSFAAECMLIIASMIHLATSQLLPHQVNPDHLDRMWICLKILADRRPEVLEAFEHTSRGCLTEMLAYQESERKNNAKARNQGLIEHQKQLAELNRADAPIKFSLLTGQTEFGDTVDRFDLTLSQALGAGGK--GSAGDAYATSKLSKVHQLTGFSDPVYAEAYVHVNQFDILLDVLVVNQTKDTLQNLTLELSTLGDLRLVEKPSPLTIAPQDFANIKANIKVSSTENGIIFGNISYDVRGSSGETTCIVLNDIHIDIMEYIMPATCTPSEFRQMWSEFEWENKVTVNTQIKDLFTYLSQITSHTNLRCLTPTEALSGDCDYLCVTLYAKTIFGEHVLANLCLEKAEADQPVTGHVRIRAKTQGMAVTMGERVSSCQKNWPV 1010          
BLAST of Coatomer subunit beta vs. TrEMBL
Match: C1L5F7 (Coatomer subunit beta OS=Schistosoma japonicum OX=6182 GN=Beta-COP PE=2 SV=1)

HSP 1 Score: 1269.99 bits (3285), Expect = 0.000e+0
Identity = 641/1016 (63.09%), Postives = 792/1016 (77.95%), Query Frame = 2
Query:   29 MTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICS--------------NENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKR---------ISGEN-NEESALLAPD--GGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLS--------DALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKT-GESLIQ-TRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEPVTGHVRIRAKSQGMAVTMGEKISAAQKQMPV 2968
            M SDQ CYTLI L  E+   +EQKLK+DLQ+    +K  ALK +I +I NGEK  NLLMIVIRFVMP Q+H +KKLLLLFWEVVPKY ++GKL QEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPE+LEP+MPSI QCLEHRH+YVRRNAVLAIFTIYKNF  LIPDAP+KI  FL+QEQD+SCKRNAFMMLLH SQ TAL+YL++CLD+V  FGDILQLI+VELIYKVC + P ER RFIRC+Y+LLQS+S +VRYEAAGTL TL+SA +AIKA ASCYI+LILKESDNNVKLIVL RL  LR+ HE+ LQ L+MD+++I+++SD+EVR+KTL L +DL+T RTAEE+I + RKE+IK CS              +   D   DE +YRY LV+TIY  CVR+PE++PT+VPT+CE+LTYE E  +   A+E CKFLRE ++++PQ K+ I+EKLM+ +P++  RE LRH +WI GEYCTT +EI +F+ L+ QV+G +PLV++E++R          S EN N+ S L++ D   GVTS A +VTADGTYATQ+ALT  + NK +     IKRP LQ++LF   + PGV LSV LVK+F R S         A+ +   +  +I+ KENSFAAECMLIIASMI+L  S LLPH V PD LDRMW CLK LADR   +L+A +    + L EM+  Q++ER+   KT  + LI+  + + ++ + D+P+ FSLL    E  + +DRFDLT+SQALG  G    +  D ++TSKLSKV QLTGFSDP+YAEAYVHVNQ+DI+LD+ VVNQT DTLQNLT+EL+TLGDL+LVEKPSPLT+ P DF NIKANIKVSS+ENGIIFGNI YD+ G++GE  C+VLNDIHIDI+EYI+PA+C+ S +R+MW+EFEWENKVTVNT+IKDL  YL+ IT +TN+RCLTP EAL G+CDYLCVTLYAK+IFGEHVLAN+CLEK   ++PVTGHVRIRAK+QGMAVTMGE++S+ QK  PV
Sbjct:    1 MASDQICYTLIGLSTETKTYTEQKLKEDLQNGKDNVKREALKELIRLIINGEKFPNLLMIVIRFVMPSQDHMIKKLLLLFWEVVPKYGSDGKLLQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPELLEPIMPSIQQCLEHRHAYVRRNAVLAIFTIYKNFESLIPDAPQKILRFLEQEQDSSCKRNAFMMLLHVSQSTALDYLTSCLDEVQQFGDILQLIVVELIYKVCLAKPSERLRFIRCIYSLLQSNSAAVRYEAAGTLTTLSSAPSAIKAAASCYINLILKESDNNVKLIVLSRLTDLRQYHERILQDLIMDIVQIINASDMEVRRKTLNLTIDLVTARTAEEVIKIFRKELIKACSTNTRPSAPTSVGEKSSGDDHNSDESVYRYSLVHTIYDICVRFPEVLPTIVPTICEILTYE-EVNDTRAANEACKFLREILERFPQRKADILEKLMQIFPSVVGRETLRHLLWIFGEYCTTYEEINSFMTLVRQVIGELPLVDEELRRQGSQVNSIDSSTENRNQPSVLISGDINLGVTS-AQRVTADGTYATQSALT-LRSNKDSGPVNGIKRPVLQAALFESHYFPGVVLSVCLVKLFYRYSLILKQEQMKAVNKDESTNIKIVSKENSFAAECMLIIASMIHLATSQLLPHQVNPDHLDRMWICLKILADRRAEVLEAFERTSHSCLTEMLTYQESERKSDAKTRNQGLIEHQKQLSELNRADAPIKFSLLTGHTEFGDTVDRFDLTLSQALGSGGK--GNSGDAYATSKLSKVHQLTGFSDPVYAEAYVHVNQFDILLDVLVVNQTRDTLQNLTLELSTLGDLRLVEKPSPLTIAPQDFANIKANIKVSSTENGIIFGNISYDIHGSSGETTCIVLNDIHIDIMEYIMPATCTPSEFRQMWSEFEWENKVTVNTQIKDLFTYLSQITSHTNLRCLTPTEALLGDCDYLCVTLYAKTIFGEHVLANLCLEKSEADQPVTGHVRIRAKTQGMAVTMGERVSSCQKNWPV 1011          
BLAST of Coatomer subunit beta vs. TrEMBL
Match: A0A504YWR0 (Coatomer subunit beta OS=Fasciola gigantica OX=46835 GN=FGIG_09256 PE=4 SV=1)

HSP 1 Score: 1251.88 bits (3238), Expect = 0.000e+0
Identity = 632/1005 (62.89%), Postives = 784/1005 (78.01%), Query Frame = 2
Query:   29 MTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKIC------------SNENGD------SGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEE-----SALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRES----GKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKT-GESLIQ-TRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEPVTGHVRIRAKSQGMAVTMGEKISAAQK 2956
            M +DQ C+TLI L  E+   SEQ+LKDDLQS  I +K +ALK VI +I NGE+ +NLLM VIRFVMP Q+H VKKLLLLFWEVVPKY  +GKL QEMILVCDAYRKDLQHPNE+IRGSTLRFLCKLKEPE+LEPLMP+I QCLEHRH+YVRRNAVLAIFTIYKNF+ LIPDAPEK+  FL+QEQDASCKRNAFMMLLH SQ +ALEYL T LDQVH FGDILQLIIVELIYKVCH+ P ER RFIRC+Y LLQSSSP+VRYEAAGTLITL+SA +A+KA ASCYI+LILKESDNNVKLIVL RL  LR  HE+ LQ LVMD+++IL++SD+E+R++TL L +DL+T RTA+EL+ + +KE++K C            S+ NG+      +  DE  YRY LV+TIY   +R+P  +  ++PT+C++LTYE E  +   A E C+F+RE + ++PQ KS ++EKLM+ +P+I  +E LRH +WI GE+CT+++EI   + LI QV+G +PLV++E++R + E+ +E     SA+L+      + A +VTADGTYATQTALTS    K     +N KRP LQ++LF   ++PGV LSV LVK+F R   A+ E       S +++  +ENSFAAECML+IASM++L +S +L H V PD +DRMW CLK LADR   +L+A     RA L E++  Q+ ER++  KT  +SL Q  R   ++ + D+PV FSLL  ++E  +L DRFDLT+SQALG T   G    D ++TSKLSKV QLTGFSDP+YAEAYVHVNQ+DI+LD+ +VNQT DTLQNLT+EL+TLGDL+LVEKPSPLT+ P DF NIKANIKVSS+ENGIIFGNI YDV G+ GE  C+VLNDIHIDI+EYILPA+CS + +R+MW+EFEWENKVTVNT+IKDL  YL HITK+TN+RCLTP EAL+GECDYLCVTLYA++IFGEHVLAN+CLEK   ++PVTGHVRIRAK+QGMAVTMGEK+S +QK
Sbjct:    1 MAADQVCFTLIGLSPEAKSWSEQQLKDDLQSNSIDIKRDALKEVIRLIVNGERFSNLLMTVIRFVMPSQDHMVKKLLLLFWEVVPKYGPDGKLLQEMILVCDAYRKDLQHPNEYIRGSTLRFLCKLKEPELLEPLMPAIQQCLEHRHAYVRRNAVLAIFTIYKNFDHLIPDAPEKMLRFLEQEQDASCKRNAFMMLLHVSQSSALEYLVTRLDQVHNFGDILQLIIVELIYKVCHTKPSERLRFIRCIYTLLQSSSPAVRYEAAGTLITLSSAPSALKAAASCYINLILKESDNNVKLIVLSRLKDLRRYHERILQDLVMDIVQILAASDMEIRQQTLDLTMDLVTLRTADELVKLYKKELLKACSGTDRANAQLSVSDANGEKTNNTGNNSDEATYRYALVHTIYDISIRFPTTLANIIPTICDILTYE-EVGDSKAAVEACRFIREVLHRFPQRKSEVLEKLMQVFPSIAGQETLRHVLWIFGEFCTSLEEINTCITLIRQVIGDLPLVDEELRRQTRESGDETQEGVSAILSDVSVGPNPAQRVTADGTYATQTALTSI-VTKAGFGFKNFKRPVLQAALFDVHYLPGVVLSVCLVKLFYRYVLAVTEKEGLLTDSSKKVETRENSFAAECMLVIASMLHLAQSGILSHQVNPDHVDRMWICLKVLADRRMEVLEAFDKTSRACLAELVTYQETERKQAAKTRNQSLEQHHREEAQLHRADAPVRFSLLVGQSEFGDLEDRFDLTLSQALGAT-VKGGSVEDAYATSKLSKVRQLTGFSDPVYAEAYVHVNQFDIMLDVLIVNQTRDTLQNLTLELSTLGDLRLVEKPSPLTIAPQDFANIKANIKVSSTENGIIFGNISYDVRGSTGETTCIVLNDIHIDIMEYILPATCSPAEFRQMWSEFEWENKVTVNTQIKDLFVYLTHITKHTNLRCLTPMEALQGECDYLCVTLYARTIFGEHVLANLCLEKTEVDQPVTGHVRIRAKTQGMAVTMGEKVSTSQK 1002          
BLAST of Coatomer subunit beta vs. Ensembl Cavefish
Match: copb1 (coatomer protein complex subunit beta 1 [Source:NCBI gene;Acc:103028105])

HSP 1 Score: 1054.28 bits (2725), Expect = 0.000e+0
Identity = 560/988 (56.68%), Postives = 720/988 (72.87%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEF---IRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGE-NNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKV-TQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKP---PGNEPVTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            +  ++  CYTLIN+ N+S+ PSE  LK DL+  +IK KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +GKL QEMILVCDAYRKDLQHPNEF   I   T  +LCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQVHTFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRL+ L+E+  HE+ LQ LVMD+LR+L++ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LIIEK++E +  I+  ++ R  +WI+GEYC+T D+I++ +  + + LG +P+VE+EIK+ +GE   EE    AP   +      VT  GTY TQ+AL+S++P+K+        RP L+  L   DF    +L+  L KV  R    +++         +K+NSF AE MLI+A++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L  M+  +  E  ++ +  ES  + R V   +Q D P+ F  L  KNEM    D+F L++  A+G+T    K+ +D  + SKL+KV  Q  GFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PASC+ + +R+MW EFEWENKVTVNT I DL++YL HI  +TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP     + PV GH+RIRAKSQGMA+++G+KI+ +QK+
Sbjct:    1 MTAAENVCYTLINVTNDSEPPSEVSLKADLEKGEIKAKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGKLLQEMILVCDAYRKDLQHPNEFSVDINTHTEHYLCKLKESELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFENLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVHTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLIELKEHPTHERVLQDLVMDILRVLTTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVTEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DTNEAAAAD-VLEFVREAIQRFDNLRPLIIEKMLEVFHAIKTVKIYRGALWILGEYCSTKDDIQSVMTEVRRSLGEIPIVENEIKKEAGEVKPEEEVSAAPAQKL------VTEMGTYVTQSALSSSRPSKKEED-----RPPLRGFLMDGDFYVAASLATTLTKVALRYVAIVQDK--------RKQNSFVAEAMLIMATVLHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRRSLSHMLAVR-LEEEKLSQKKES--EKRNV--TVQADDPISFMQLTAKNEMTSKEDQFQLSLLAAMGNTQR--KEAADPLA-SKLNKVPEQPDGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENKVTVNTNISDLNEYLLHILGSTNMKCLTPEKALSGICGFMAANLYARSIFGEDALANVSIEKPIHLGPDAPVNGHIRIRAKSQGMALSLGDKINLSQKK 954          
BLAST of Coatomer subunit beta vs. Ensembl Cavefish
Match: AP3B2 (adaptor related protein complex 3 subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:567])

HSP 1 Score: 62.7734 bits (151), Expect = 1.869e-9
Identity = 45/146 (30.82%), Postives = 75/146 (51.37%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            SD      LK+ L S    LK  A+KR++ MI  G+  ++L   V++ V  C+N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++   ++  +M +I +       YVR+ A  AI  +Y
Sbjct:   34 SDYKRHDDLKEMLDSNKDSLKLEAMKRIVAMIARGKNASDLFPAVVKNVA-CKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRGLKDPNQLIRASALRVLSSIRVTIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLY 173          
BLAST of Coatomer subunit beta vs. Ensembl Cavefish
Match: ap4b1 (adaptor related protein complex 4 subunit beta 1 [Source:NCBI gene;Acc:103037901])

HSP 1 Score: 55.8398 bits (133), Expect = 1.964e-7
Identity = 47/148 (31.76%), Postives = 74/148 (50.00%), Query Frame = 2
Query:   89 SEQKLKD---DLQSPDIKLKT----NALKRVILMICNGEKINNLLMIVIRFVMPCQNHTV----KKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLA 499
            SE+ +KD    L +P+++       N + RVI  +  G  +++L M +++      + TV    KKL+ L+  +V    +   LA   +L  +  RKD   PN  +RG  LR +C L+ P + E +   IL  L  + SYVRR AVL 
Sbjct:    6 SEETVKDLKRALSNPNVQADRLRYRNYITRVIRSMTQGLDVSSLFMEMVK-----ASATVDIVQKKLVYLY--MVTYAGHKPDLA---LLAINTLRKDCADPNPMVRGLALRNMCNLRMPGITEYIQQPILSGLRDKASYVRRVAVLG 143          
BLAST of Coatomer subunit beta vs. Ensembl Sea Lamprey
Match: copb1 (coatomer protein complex, subunit beta 1 [Source:NCBI gene;Acc:338138])

HSP 1 Score: 1054.28 bits (2725), Expect = 0.000e+0
Identity = 550/992 (55.44%), Postives = 729/992 (73.49%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY--KNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKR--TSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQ-DAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATL-GDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEP---VTGHVRIRAKSQGMAVTMGEKISAAQKQMPV 2968
            +  ++  CYTLIN+P++S+ P+E  LK+DL+  DI+ KT ALK+VI+MI +G+K+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +GKL QEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRH+YVRRNAVLAI+TIY  +NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQV TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLLQSSSP+VRYEAAGTL+TL+SA  A+KA A CYIDLI+KESDNNVKLIVLDRL+ L+++  HE+ LQ LVMD+LR+L + DLEVR+KTL+L LDL+++R  EEL+ VL+KEVIK     N     D   +R  LV T++   VR+P++  +++P L E L+   E      A +V  F+REA+Q +   + LIIEK++E + +I+  ++ R  +WI+GEYC++ ++I++ +  + + +G +P+VE EIK+ +GEN  +  +      V +Q   VT  GTYATQ+AL++ +P+K+   SSA    RP L+  L   DF  G  ++  L K+  R    + +         +++NSF AE ML+++S+++LG+S L    +  D +DR+  CL+ L++ +  +       CR  L  M++++ + E+R + K  E     R V   +Q D P+ F  L  K+E +   D+F L++  A G      K+ +D  S SKLSKVTQLTGFSDP+YAEAY+H+NQYDIVLD+ VVNQTSDTLQN T+ELATL GDLKLVEKPSPLT+ P+DF NIKAN+KV+S+ENGIIFGNIVYDV+GAA + NCVVLNDIHIDI++YI PA+CS + +R+MW EFEWENKVTV+T I DL +YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP    P   VTGH+RIRAKSQGMA+++G+KI+ +QK+  V
Sbjct:    1 MTAAENVCYTLINIPSDSEPPTEISLKNDLEKGDIRAKTEALKKVIVMILSGDKLPGLLMTIIRFVLPLQDHTLKKLLLVFWEIVPKTTPDGKLLQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRTCLEHRHNYVRRNAVLAIYTIYRIRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPTERARFIRCIYNLLQSSSPAVRYEAAGTLVTLSSAPTAVKAAAQCYIDLIIKESDNNVKLIVLDRLIELKDHPSHERVLQDLVMDILRVLGTPDLEVRRKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVTEHEDTDKFRQLLVRTLHSCSVRFPDVAASIIPVLMEFLSDTNEL----AAGDVLVFVREAVQLFEGLRPLIIEKMLEVFHSIKAVKIQRGALWILGEYCSSKEDIQSVMTEVRRSIGEIPIVETEIKKAAGENKIDEEV----STVPAQKL-VTEMGTYATQSALSTARPSKKEEESSAMPCLRPPLRGFLLEGDFYVGAAMATTLTKLALRYIALVDDK--------RRQNSFVAEAMLLMSSVLHLGRSALPKKPITEDDVDRIALCLRVLSELSPLLSDIFNKECRRSLSNMLSAKLEEEKRSLKKESEK----RTVS--VQADDPITFMQLMAKSENSSKEDQFQLSLLAATGHAQK--KEAADPLS-SKLSKVTQLTGFSDPVYAEAYIHINQYDIVLDVLVVNQTSDTLQNCTLELATLGGDLKLVEKPSPLTLAPYDFANIKANVKVASTENGIIFGNIVYDVTGAASDRNCVVLNDIHIDIMDYIQPATCSDAEFRQMWAEFEWENKVTVSTNILDLMEYLKHILKSTNMKCLTPEKALLGNCGFMAANLYARSIFGEDALANVSIEKPTHLGPDASVTGHIRIRAKSQGMALSLGDKINLSQKKAAV 963          
BLAST of Coatomer subunit beta vs. Ensembl Sea Lamprey
Match: AP3B2 (adaptor related protein complex 3 subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:567])

HSP 1 Score: 65.0846 bits (157), Expect = 6.582e-11
Identity = 45/146 (30.82%), Postives = 75/146 (51.37%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            +D      LK+ L S    LK  A+KR++ M+  G+  + L   V++ V  C+N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++ P ++  +M SI +       YVR+ A  AI  +Y
Sbjct:   32 ADYKKHDDLKEMLDSNKDSLKLEAMKRIVAMVARGKNASELFPAVVKNVA-CKNLEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRALKDPNQLIRASALRVLSSIRVPIIVPIMMLSIKEAASDMSPYVRKTAAHAIPKLY 171          
BLAST of Coatomer subunit beta vs. Ensembl Yeast
Match: SEC26 (Essential beta-coat protein of the COPI coatomer; involved in ER-to-Golgi protein trafficking and maintenance of normal ER morphology; shares 43% sequence identity with mammalian beta-coat protein (beta-COP) [Source:SGD;Acc:S000002646])

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 369/988 (37.35%), Postives = 570/988 (57.69%), Query Frame = 2
Query:   35 SDQSCYTLINLPNES-DVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQ-SSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFN--GADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRIS-----GENNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADR-NFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQP-DSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGE-CNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEAL-EGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEPVTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            S Q  YTL+  P+ S +  S    +  L+    + K + +K +++ +  G  +  LLM +IRFVMP +N  +KKLL  +WE+VPK   +GKL  EMILVC+A + DLQHPNE+IRG+TLRFL KL+E E+LE ++PS+L CLE+RH+YVR+ A+LA+F+I+K    L+PDA E I++F+  E D  CKRNAF+ L    +E AL YL   +  +     +LQ + V+ I +  +  P  +A++I  +  LL  ++S  V +E A  L  L++    +    +  IDL +K SDNN+KLIVLDR+  +  N+   L+ L +D+LR+L++ DL+VR K L + +DL T+R AE+++ +L+KE+    +N + D  +    YR  L+ TI    V + EM  +VV  L + +       + N   A  +  F++E I+KYPQ ++ I+E +++    +R  +  R  +WIMGEY     EI++    I   +G VP+++ EIK+++      E NE  A   P G V      +  DGTYAT++A       K  +  E   RP ++  + + DF     L+  ++K+  +  +      K++  I    N+  AE +LI+ S++ +G+S L+   +  D L+R+   +  L D  N    K    +     ++   S    + EI K  +     +   K I+P D+P+ F   A  +  N   D  +  +  A+          +   S SKL K+  L GFSDP+YAEA +  NQ+D+VLD+ +VNQT +TL+NL V+ ATLGDLK+++ P    + PH F      +KVSS++ G+IFGNI+YD  GA GE    V+LND+H+DI++YI PA+    H+R MWN FEWENK++V +++  LH YL  + K TNM  LTP E+L E +C +L   LYAKS FGE  LAN+C+EK      V G+VRIR+K QG+A+++G++++   K+
Sbjct:    5 SSQPAYTLVFDPSPSMETYSSTDFQKALEKGSDEQKIDTMKSILVTMLEGNPMPELLMHIIRFVMPSKNKELKKLLYFYWEIVPKLAEDGKLRHEMILVCNAIQHDLQHPNEYIRGNTLRFLTKLREAELLEQMVPSVLACLEYRHAYVRKYAILAVFSIFKVSEHLLPDAKEIINSFIVAETDPICKRNAFIGLAELDRENALHYLENNIADIENLDPLLQAVFVQFIRQDANRTPALKAQYIELLMELLSTTTSDEVIFETALALTVLSANPNVLVPAVNKLIDLAVKVSDNNIKLIVLDRIQDINANNVGALEELTLDILRVLNAEDLDVRSKALDISMDLATSRNAEDVVQLLKKELQTTVNNPDQDKAM---QYRQLLIKTIRTVAVNFVEMAASVVSLLLDFIG------DLNSVAASGIIAFIKEVIEKYPQLRANILENMVQTLDKVRSAKAYRGALWIMGEYAEGESEIQHCWKHIRNSVGEVPILQSEIKKLTQNQEHTEENEVDATAKPTGPV------ILPDGTYATESAFDVKTSQKSVTDEERDSRPPIRRFVLSGDFYTAAILANTIIKLVLKFENV----SKNKTVI----NALKAEALLILVSIVRVGQSSLVEKKIDEDSLERVMTSISILLDEVNPEEKKEEVKLLEVAFLDTTKSSFKRQIEIAKKNKHKRALKDSCKNIEPIDTPISFRQFAGVDSTNVQKDSIEEDLQLAMKGDAIHA---TSSSSISKLKKIVPLCGFSDPVYAEACITNNQFDVVLDVLLVNQTKETLKNLHVQFATLGDLKIIDTPQKTNVIPHGFHKFTVTVKVSSADTGVIFGNIIYD--GAHGEDARYVILNDVHVDIMDYIKPATADDEHFRTMWNAFEWENKISVKSQLPTLHAYLRELVKGTNMGILTPSESLGEDDCRFLSCNLYAKSSFGEDALANLCIEKDSKTNDVIGYVRIRSKGQGLALSLGDRVALIAKK 964          
BLAST of Coatomer subunit beta vs. Ensembl Nematostella
Match: EDO34974 (Coatomer subunit beta [Source:UniProtKB/TrEMBL;Acc:A7SMS0])

HSP 1 Score: 1084.32 bits (2803), Expect = 0.000e+0
Identity = 554/980 (56.53%), Postives = 718/980 (73.27%), Query Frame = 2
Query:   32 TSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPG--NEPVTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
             ++Q CYTLIN+PNE + P+EQKLK+D++  D+K+KT  LK+VI MI NGEK   LLM VI+F+MP Q+HT+KKLLL+FWE+VPK   +GKL  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAV+AI+TIY+NF+FLIPDAPE +HTFL+QEQDASCKRNAFMML+H  QE ALEYLSTC+DQV+TFGDILQL+IVELIYKVCH+NP ERARFIRC+YNLL SSSP+VRYEAAGTL+TL+SA  A+K+ ASCYI+LI+KESDNNVKLIVLDRL+ L+EN  HEK LQ LVMD+LR+L+S D EVRKKTL+L LDL+T+R   E++ VL+KEV K          V+   YR  LV T++   V++P++  ++VP L E L    E      A +V  F+REAIQ++ Q K +I+EKLME +  I+  ++ RH +WI+GEY  + ++I   +  I + LG +P+V+DE+++ +G+   ++   AP     SQ   VTADGTYATQ+A +        +  ++ KRP L+  L   +F  G  ++  L K+  R           +E  + K+N F A CML+++S+++LGKS L    +  D +DR+  CL+A+A+R   +       CR  L  M+++      E     E ++        IQ D P+ F  L  K+E     D+F +++SQA+G TG     + D   +SKL+KV+QLTGFSDP+YAEAYV+VNQYDIVLD+ +VNQT+DTLQN+T+ELATLGDLKLVEKP P+ +G +DF+NIKAN+KVSS+ENGIIFGNIVYDVSG  G+ NCVVLNDIHIDI++YI+PASC+ + +R+MW EFEWENKVTVNT I DL +YL H+  +TNM CLTP +AL G C +L   LYAKSIFGE  LAN+ +EKP G  + PV GHVRIRAKSQGMA+++G+KI+ +QK+
Sbjct:    4 AAEQPCYTLINIPNEQESPTEQKLKEDIEKGDVKVKTETLKKVIQMILNGEKFPTLLMTVIKFLMPLQDHTIKKLLLIFWEIVPKTGADGKLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRTCLEHRHSYVRRNAVMAIYTIYRNFDFLIPDAPELVHTFLEQEQDASCKRNAFMMLIHVDQERALEYLSTCMDQVNTFGDILQLVIVELIYKVCHANPAERARFIRCIYNLLNSSSPAVRYEAAGTLVTLSSAPTAVKSAASCYIELIVKESDNNVKLIVLDRLIKLKENPSHEKVLQELVMDILRVLASPDPEVRKKTLQLVLDLVTSRNIHEVVAVLKKEVSK---THFESEQVEIGSYRQMLVRTLHTCSVKFPDVANSIVPLLMEFLGDSNE----QAALDVLVFVREAIQRFEQLKPVIMEKLMENFHMIKSVKIHRHALWILGEYADSKEDIMTVMEEIRKGLGDMPIVDDEMRKAAGDQG-KAGEEAPARSAASQRL-VTADGTYATQSAFSQPGAAVGLAKTDDEKRPPLRQYLLDGEFFVGAAIACTLTKLALRFL--------QKESDLTKQNVFCANCMLMMSSILHLGKSGLSKKVITDDDVDRISMCLRAVAERAPLMKDIFTVQCRQSLSSMLDANKKLEDEQKADAEKVMA-------IQADDPISFLDLLAKSESGITEDQFAVSLSQAVGATGK----KEDDLQSSKLNKVSQLTGFSDPVYAEAYVNVNQYDIVLDVLIVNQTTDTLQNVTLELATLGDLKLVEKPQPILLGANDFSNIKANVKVSSTENGIIFGNIVYDVSGGGGDRNCVVLNDIHIDIMDYIVPASCTDAEFRQMWAEFEWENKVTVNTNISDLREYLGHLIASTNMLCLTPEKALAGSCGFLAANLYAKSIFGEDALANVSIEKPYGQPDAPVVGHVRIRAKSQGMALSLGDKINLSQKK 955          
BLAST of Coatomer subunit beta vs. Ensembl Nematostella
Match: EDO27375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9F3])

HSP 1 Score: 172.555 bits (436), Expect = 3.636e-50
Identity = 82/119 (68.91%), Postives = 104/119 (87.39%), Query Frame = 2
Query: 2171 RFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNI 2527
            +F +++SQA+G TG     + D   +SKL+KV+QLTGFSDP+YAEAYV+VNQYDIVLD+ +VNQT+DTLQN+T+ELATLGDLKLVEKP P+ +G +DF+NIKAN+KVSS+ENGIIFGNI
Sbjct:    2 QFAVSLSQAVGATGK----KEDDLQSSKLNKVSQLTGFSDPVYAEAYVNVNQYDIVLDVLIVNQTTDTLQNVTLELATLGDLKLVEKPQPILLGANDFSNIKANVKVSSTENGIIFGNI 116          
BLAST of Coatomer subunit beta vs. Ensembl Nematostella
Match: EDO26999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAH2])

HSP 1 Score: 158.303 bits (399), Expect = 4.942e-45
Identity = 79/134 (58.96%), Postives = 96/134 (71.64%), Query Frame = 2
Query:  125 DIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFN 526
            D+K+KT  LK+VI MI NGEK   LLM VI+F+MP Q+HT+KKLLL+FWE+VPK   +GKL  EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE      L+  IL+ L      VR+  +  +  +  + N
Sbjct:    3 DVKVKTETLKKVIQMILNGEKFPTLLMTVIKFLMPLQDHTIKKLLLIFWEIVPKTGADGKLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE------LVMDILRVLASPDPEVRKKTLQLVLDLVTSRN 130          

HSP 2 Score: 48.9062 bits (115), Expect = 6.837e-7
Identity = 24/39 (61.54%), Postives = 32/39 (82.05%), Query Frame = 2
Query:  968 ELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEE 1084
            +L+ LVMD+LR+L+S D EVRKKTL+L LDL+T+R   E
Sbjct:   95 KLKELVMDILRVLASPDPEVRKKTLQLVLDLVTSRNIHE 133          
BLAST of Coatomer subunit beta vs. Ensembl Nematostella
Match: EDO47944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKP5])

HSP 1 Score: 72.7886 bits (177), Expect = 1.265e-15
Identity = 33/84 (39.29%), Postives = 58/84 (69.05%), Query Frame = 2
Query: 1286 GADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGE 1537
             A +V  F+REAIQ++ Q K +I+EKLME +  I+  ++ RH +WI+GEY  + ++I   +  I + LG +P+V+DE+++ +G+
Sbjct:   11 AALDVLVFVREAIQRFEQLKPVIMEKLMENFHMIKSVKIHRHALWILGEYADSKEDIMTVMEEIRKGLGDMPIVDDEMRKAAGD 94          
BLAST of Coatomer subunit beta vs. Ensembl Nematostella
Match: EDO27326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9J8])

HSP 1 Score: 69.707 bits (169), Expect = 5.706e-15
Identity = 33/52 (63.46%), Postives = 38/52 (73.08%), Query Frame = 2
Query: 2762 EALEGECDYLCVTLYAKSIFGEHVLANICLEKPPG--NEPVTGHVRIRAKSQ 2911
            +AL G C +L   LYAKSIFGE  LAN+ +EKP G  + PV GHVRIRAKSQ
Sbjct:    2 QALAGSCGFLAANLYAKSIFGEDALANVSIEKPYGQPDAPVVGHVRIRAKSQ 53          
BLAST of Coatomer subunit beta vs. Ensembl Medaka
Match: copb1 (coatomer protein complex subunit beta 1 [Source:NCBI gene;Acc:101162912])

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 568/985 (57.66%), Postives = 731/985 (74.21%), Query Frame = 2
Query:   26 LMTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLREN--HEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACK--VTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPP--GNE-PVTGHVRIRAKSQGMAVTMGEKISAAQKQ 2959
            +  ++  CYTLIN+ ++S+ PSE  LK DL+  +IK KT ALK+VI+MI NGEK+  LLM +IRFV+P Q+HT+KKLLL+FWE+VPK   +GKL QEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKE E+LEPLMP+I  CLEHRHSYVRRNAVLAI+TIY+NF  LIPDAPE IH FL  E+DASCKRNAFMML+HA Q+ AL+YLSTC+DQVHTFGDILQL+IVELIYKVCH+NP ERARFIRC++NLLQSSSP+V+YEAAGTL+TL+SA  AIKA A CYIDLI+KESDNNVKLIVLDRL+ L+++  HE+ LQ LVMD+LR+LS+ DLEVRKKTL+L LDL+++R  EEL+ VL+KEVIK     N     D   YR  LV T++   VR+P+M   V+P L E L+   +  E   AD V +F+REAIQ++   + LIIEK++E +  I+  ++ R  +WI+GEYC+T ++I++ +  + + LG +P+V++EIK+ +GE       L P+  V++   +  VT  GTY TQ+AL+S++P+K+        RP L+  L   DF    +L+  L KV  R    + +         KK+NSF AE MLI+ ++++LGKS L    +  D +DR+  CLK L++ +  +       CR  L  M+  +  E  ++ +  ES  + R V   +Q D P+ F  L  KNEM    D+F L++  A+G+T    K+ +D  + SKL+KVTQLTGFSDP+YAEAYVHVNQYDIVLD+ VVNQTSDTLQN T+ELATLGDLKLVEKPSPLT+ PHDF NIKAN+KV+S+ENGIIFGNIVYDVSGAA + NCVVL+DIHIDI++YI PASC+ + +R+MW EFEWENKVTVNT I DL++YL HI K+TNM+CLTP +AL G C ++   LYA+SIFGE  LAN+ +EKP   G E PVTGH+RIRAKSQGMA+++G+KI+ +QK+
Sbjct:    1 MTAAENVCYTLINVQSDSEPPSEVSLKADLEKGEIKAKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGKLLQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKESELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFENLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVHTFGDILQLVIVELIYKVCHANPSERARFIRCIFNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLIELKDHPTHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIK---TNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLS---DTNEAAAAD-VLEFVREAIQRFDNLRPLIIEKMLEVFHAIKTVKIYRGALWILGEYCSTKEDIQSVMTEVRRSLGEIPIVDNEIKKETGE-------LKPEDEVSAAPAQKLVTEMGTYVTQSALSSSRPSKKEED-----RPPLRGFLMDGDFYVAASLATTLTKVALRYVLIVEDK--------KKQNSFVAEAMLIMVTVLHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRKSLSHMLAVR-LEEEKLSQKKES--EKRNV--TVQADDPISFMQLTAKNEMCSKEDQFQLSLLAAMGNTQR--KEAADPLA-SKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPASCTDAEFRQMWAEFEWENKVTVNTNIVDLNEYLQHILKSTNMKCLTPEKALSGFCGFMAANLYARSIFGEDALANVSIEKPIHLGPEAPVTGHIRIRAKSQGMALSLGDKINLSQKK 950          
BLAST of Coatomer subunit beta vs. Ensembl Medaka
Match: ap3b1a (adaptor related protein complex 3 subunit beta 1 [Source:NCBI gene;Acc:101168882])

HSP 1 Score: 64.3142 bits (155), Expect = 7.226e-10
Identity = 48/163 (29.45%), Postives = 84/163 (51.53%), Query Frame = 2
Query:   68 PNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKI 556
            P E+     + LK+ L+S    LK  A+KRV+ +I  G+  + L   V++ V   +N  +KKL+ ++  +V   +    LA   +L    +++ L+ PN+FIR S LR L  ++ P ++  +M +I +       YVR+ +  AI  +Y     L PD  E++
Sbjct:   48 PKETHKAGNEDLKEMLESNKESLKLEAMKRVVGLISKGKNASELFPAVVKNVA-SKNIELKKLVYVY--LVRYAEEQQDLA---LLSISTFQRALKDPNQFIRASALRVLSSIRVPIIVPIMMLAIKEAATDLSPYVRKTSAHAIQKLYS----LDPDQKEQL 200          
BLAST of Coatomer subunit beta vs. Ensembl Medaka
Match: AP3B2 (adaptor related protein complex 3 subunit beta 2 [Source:NCBI gene;Acc:101163974])

HSP 1 Score: 62.7734 bits (151), Expect = 1.740e-9
Identity = 45/146 (30.82%), Postives = 75/146 (51.37%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            SD      LK+ L S    LK  A+KR++ MI  G+  ++L   V++ V  C+N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++   ++  +M +I +       YVR+ A  AI  +Y
Sbjct:   34 SDYKRHDDLKEMLDSNKDSLKLEAMKRIVAMIARGKNASDLFPAVVKNVA-CKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRGLKDPNQLIRASALRVLSSIRVTIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLY 173          
BLAST of Coatomer subunit beta vs. Ensembl Medaka
Match: AP3B2 (adaptor related protein complex 3 subunit beta 2 [Source:NCBI gene;Acc:101163974])

HSP 1 Score: 62.7734 bits (151), Expect = 1.904e-9
Identity = 45/146 (30.82%), Postives = 75/146 (51.37%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            SD      LK+ L S    LK  A+KR++ MI  G+  ++L   V++ V  C+N  VKKL+ ++  +V   +    LA   +L    +++ L+ PN+ IR S LR L  ++   ++  +M +I +       YVR+ A  AI  +Y
Sbjct:   34 SDYKRHDDLKEMLDSNKDSLKLEAMKRIVAMIARGKNASDLFPAVVKNVA-CKNIEVKKLVYVY--LVRYAEEQQDLA---LLSISTFQRGLKDPNQLIRASALRVLSSIRVTIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLY 173          
BLAST of Coatomer subunit beta vs. Ensembl Medaka
Match: ap3b1a (adaptor related protein complex 3 subunit beta 1 [Source:NCBI gene;Acc:101168882])

HSP 1 Score: 62.3882 bits (150), Expect = 2.667e-9
Identity = 47/160 (29.38%), Postives = 83/160 (51.88%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKI 556
            +D    + LK+ L+S    LK  A+KRV+ +I  G+  + L   V++ V   +N  +KKL+ ++  +V   +    LA   +L    +++ L+ PN+FIR S LR L  ++ P ++  +M +I +       YVR+ +  AI  +Y     L PD  E++
Sbjct:   39 ADFKKNEDLKEMLESNKESLKLEAMKRVVGLISKGKNASELFPAVVKNVA-SKNIELKKLVYVY--LVRYAEEQQDLA---LLSISTFQRALKDPNQFIRASALRVLSSIRVPIIVPIMMLAIKEAATDLSPYVRKTSAHAIQKLYS----LDPDQKEQL 188          
BLAST of Coatomer subunit beta vs. Planmine SMEST
Match: SMESG000033847.1 (SMESG000033847.1)

HSP 1 Score: 2004.18 bits (5191), Expect = 0.000e+0
Identity = 989/991 (99.80%), Postives = 990/991 (99.90%), Query Frame = 2
Query:   29 MTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEPVTGHVRIRAKSQGMAVTMGEKISAAQKQMPVVEIVEPEKLDD 3001
            MTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQN+TVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIH FLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEAAGTLITLTSAAAAIKAVASCYIDLILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEPVTGHVRIRAKSQGMAVTMGEKISAAQKQMPVVEIVEPEKLDD
Sbjct:    1 MTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNNTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHMFLDQEQDASCKRNAFMMLLHASQETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYNLLQSSSPSVRYEAAGTLITLTSAAAAIKAVASCYIDLILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFYPNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRISGENNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAENIKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKENSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTILKAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHFSLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLTGFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVEKPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLNDIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHITKNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEPVTGHVRIRAKSQGMAVTMGEKISAAQKQMPVVEIVEPEKLDD 991          
BLAST of Coatomer subunit beta vs. Planmine SMEST
Match: SMESG000041850.1 (SMESG000041850.1)

HSP 1 Score: 60.8474 bits (146), Expect = 5.737e-9
Identity = 44/147 (29.93%), Postives = 79/147 (53.74%), Query Frame = 2
Query:   77 SDVPSEQKLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVC-DAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIY 514
            SD    + LK  L+S     K +A+KR+I M+  G+   +L   V++ V+  +N  VKKL+   +  + +Y    +  Q++ L+    +++ L+ PN+ IRGS LR L  ++ P ++  +M +I + +     YVR+ A  AI  +Y
Sbjct:   39 SDPKKHEDLKVLLESNKDSAKLDAMKRIITMVAKGKDCADLFPSVVKNVV-SKNAEVKKLV---YAYLTRY---AEEKQDLALLSISTFQRALKDPNQLIRGSALRVLSSIRVPMIVPIMMLAIKESVNDMSPYVRKIAAHAIPKMY 178          
BLAST of Coatomer subunit beta vs. Planmine SMEST
Match: SMESG000074044.1 (SMESG000074044.1)

HSP 1 Score: 60.077 bits (144), Expect = 8.226e-9
Identity = 105/503 (20.87%), Postives = 203/503 (40.36%), Query Frame = 2
Query:   98 KLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLD---QEQDASCKRNAFMMLLHASQETALEYLSTC---LDQVHTFGDILQLI-IVELIYKVCHSNPQERARFIRCVYNLLQSSSP-SVRYEXXXXXXXXXXXXXXXXXXXXCYIDLILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELI----------------NVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLM-------EFYPNIRCR---EVLRHTMWIMGEYCTTIDEIENFVN-LIYQVLGSVP 1501
            ++K++L+  ++  K NA+ ++I +   G  IN     +I  VM     T K++  L         +  +    ++L  +  RKDL  PN +  G  L  L     P++   L   I+  +     Y+R+ AVL ++ ++  F    PDA       L    ++ D   +  A  ++   +++    YLS        ++T  +   LI I++L   +    P+   + I  + NL+ S+S  S+ YE   T+I      +A   +    + +++++SD N+K + L  +  + ++H K +QT    +L  L   D  +R + L L   +++ +   E++                N L  ++I+I S  N     + + Y   LV       +R  E+I                           + L  AI + P  +S  + ++        E   N +     EV+    W+ GEY   ++     ++ +I   +GS+P
Sbjct:   42 EIKNELKLDNLAAKANAINKLIYLQMLGNDINWAAFNIIE-VMSSTKFTYKRIGYL-----AAAQSFHEQTDVLMLTTNLIRKDLNSPNFYETGIALSGLACFITPDLARDLASDIMTLMTSTKPYIRKKAVLLMYKVFLKF----PDALRPAFPRLKEKLEDPDPGVQSAAVNVICELARKNPKNYLSLAPLFFKLMNTSNNNWVLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECINTVIAGIPDHSASIQLCVQKLRILIEDSDQNLKYLGLLAMTKILKSHPKSVQTHKDLILNCLDDKDESIRLRALDLLYGMISKKNIMEIVKKLMTHMDKAEGSHYRNELLIKIIEITSQNNYHYITNFEWYITILVELTRIDGIRNGELI-------------------------AAQLLDVAI-RVPTVRSFTVNQMANILHTSSELLANSKQSGVCEVIYAAAWVCGEYADYLESPRKTLDQMIQTTIGSLP 508          
BLAST of Coatomer subunit beta vs. Planmine SMEST
Match: SMESG000074044.1 (SMESG000074044.1)

HSP 1 Score: 58.151 bits (139), Expect = 3.578e-8
Identity = 107/510 (20.98%), Postives = 205/510 (40.20%), Query Frame = 2
Query:   98 KLKDDLQSPDIKLKTNALKRVILMICNGEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYVRRNAVLAIFTIYKNFNFLIPDAPEKIHTFLD---QEQDASCKRNAFMMLLHASQETALEYLSTC---LDQVHTFGDILQLI-IVELIYKVCHSNPQERARFIRCVYNLLQSSSP-SVRYEXXXXXXXXXXXXXXXXXXXXCYIDL-------ILKESDNNVKLIVLDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTAEELI----------------NVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPTVVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLM-------EFYPNIRCR---EVLRHTMWIMGEYCTTIDEIENFVN-LIYQVLGSVP 1501
            ++K++L+  ++  K NA+ ++I +   G  IN     +I  VM     T K++  L         +  +    ++L  +  RKDL  PN +  G  L  L     P++   L   I+  +     Y+R+ AVL ++ ++  F    PDA       L    ++ D   +  A  ++   +++    YLS        ++T  +   LI I++L   +    P+   + I  + NL+ S+S  S+ YE   T+I +  + ++     S  I L       ++++SD N+K + L  +  + ++H K +QT    +L  L   D  +R + L L   +++ +   E++                N L  ++I+I S  N     + + Y   LV       +R  E+I                           + L  AI + P  +S  + ++        E   N +     EV+    W+ GEY   ++     ++ +I   +GS+P
Sbjct:   42 EIKNELKLDNLAAKANAINKLIYLQMLGNDINWAAFNIIE-VMSSTKFTYKRIGYL-----AAAQSFHEQTDVLMLTTNLIRKDLNSPNFYETGIALSGLACFITPDLARDLASDIMTLMTSTKPYIRKKAVLLMYKVFLKF----PDALRPAFPRLKEKLEDPDPGVQSAAVNVICELARKNPKNYLSLAPLFFKLMNTSNNNWVLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECINTVIAVLISISSGIPDHSASIQLCVQKLRILIEDSDQNLKYLGLLAMTKILKSHPKSVQTHKDLILNCLDDKDESIRLRALDLLYGMISKKNIMEIVKKLMTHMDKAEGSHYRNELLIKIIEITSQNNYHYITNFEWYITILVELTRIDGIRNGELI-------------------------AAQLLDVAI-RVPTVRSFTVNQMANILHTSSELLANSKQSGVCEVIYAAAWVCGEYADYLESPRKTLDQMIQTTIGSLP 515          
The following BLAST results are available for this feature:
BLAST of Coatomer subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COPB10.000e+057.49coatomer protein complex subunit beta 1 [Source:HG... [more]
COPB10.000e+057.49coatomer protein complex subunit beta 1 [Source:HG... [more]
COPB10.000e+063.34coatomer protein complex subunit beta 1 [Source:HG... [more]
COPB15.648e-5967.88coatomer protein complex subunit beta 1 [Source:HG... [more]
COPB11.328e-5566.67coatomer protein complex subunit beta 1 [Source:HG... [more]
back to top
BLAST of Coatomer subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
copb-10.000e+052.17Coatomer subunit beta [Source:UniProtKB/TrEMBL;Ac... [more]
copb-10.000e+052.17Coatomer subunit beta [Source:UniProtKB/TrEMBL;Ac... [more]
apb-31.353e-831.16AP-3 complex subunit beta [Source:UniProtKB/TrEMB... [more]
apb-31.480e-831.16AP-3 complex subunit beta [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Coatomer subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
betaCOP0.000e+054.12gene:FBgn0008635 transcript:FBtr0074576[more]
rb1.612e-730.61gene:FBgn0003210 transcript:FBtr0070702[more]
rb1.612e-730.61gene:FBgn0003210 transcript:FBtr0332290[more]
rb1.612e-730.61gene:FBgn0003210 transcript:FBtr0343568[more]
g3.185e-620.75gene:FBgn0001087 transcript:FBtr0073842[more]
back to top
BLAST of Coatomer subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
copb10.000e+057.72coatomer protein complex, subunit beta 1 [Source:N... [more]
copb10.000e+057.72coatomer protein complex, subunit beta 1 [Source:N... [more]
CU929160.17.976e-1129.93pep chromosome:GRCz11:21:7298687:7325703:1 gene:EN... [more]
AP3B25.363e-830.89adaptor related protein complex 3 beta 2 subunit [... [more]
ap3d18.733e-721.22adaptor related protein complex 3 subunit delta 1 ... [more]
back to top
BLAST of Coatomer subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
copb10.000e+057.37coatomer protein complex subunit beta 1 [Source:NC... [more]
copb10.000e+057.32coatomer protein complex subunit beta 1 [Source:NC... [more]
ap3b21.424e-1031.51adaptor related protein complex 3 subunit beta 2 [... [more]
ap3b21.750e-1031.51adaptor related protein complex 3 subunit beta 2 [... [more]
ap3b21.760e-1031.51adaptor related protein complex 3 subunit beta 2 [... [more]
back to top
BLAST of Coatomer subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Copb10.000e+057.66coatomer protein complex, subunit beta 1 [Source:M... [more]
Ap3b24.165e-1030.82adaptor-related protein complex 3, beta 2 subunit ... [more]
Ap3b24.249e-1030.82adaptor-related protein complex 3, beta 2 subunit ... [more]
Ap3b15.101e-930.14adaptor-related protein complex 3, beta 1 subunit ... [more]
Ap3d11.490e-621.57adaptor-related protein complex 3, delta 1 subunit... [more]
back to top
BLAST of Coatomer subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZIA5|COPB_CHICK0.000e+058.27Coatomer subunit beta OS=Gallus gallus OX=9031 GN=... [more]
sp|A0JN39|COPB_BOVIN0.000e+057.97Coatomer subunit beta OS=Bos taurus OX=9913 GN=COP... [more]
sp|Q9JIF7|COPB_MOUSE0.000e+057.66Coatomer subunit beta OS=Mus musculus OX=10090 GN=... [more]
sp|P23514|COPB_RAT0.000e+057.66Coatomer subunit beta OS=Rattus norvegicus OX=1011... [more]
sp|P53618|COPB_HUMAN0.000e+057.49Coatomer subunit beta OS=Homo sapiens OX=9606 GN=C... [more]
back to top
BLAST of Coatomer subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QUW40.000e+063.21Coatomer subunit beta OS=Schistosoma bovis OX=6184... [more]
A0A3Q0KKR90.000e+063.09Coatomer subunit beta OS=Schistosoma mansoni OX=61... [more]
A0A094ZET50.000e+063.31Coatomer subunit beta OS=Schistosoma haematobium O... [more]
C1L5F70.000e+063.09Coatomer subunit beta OS=Schistosoma japonicum OX=... [more]
A0A504YWR00.000e+062.89Coatomer subunit beta OS=Fasciola gigantica OX=468... [more]
back to top
BLAST of Coatomer subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
copb10.000e+056.68coatomer protein complex subunit beta 1 [Source:NC... [more]
AP3B21.869e-930.82adaptor related protein complex 3 subunit beta 2 [... [more]
ap4b11.964e-731.76adaptor related protein complex 4 subunit beta 1 [... [more]
back to top
BLAST of Coatomer subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
copb10.000e+055.44coatomer protein complex, subunit beta 1 [Source:N... [more]
AP3B26.582e-1130.82adaptor related protein complex 3 subunit beta 2 [... [more]
back to top
BLAST of Coatomer subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SEC260.000e+037.35Essential beta-coat protein of the COPI coatomer; ... [more]
back to top
BLAST of Coatomer subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO349740.000e+056.53Coatomer subunit beta [Source:UniProtKB/TrEMBL;Ac... [more]
EDO273753.636e-5068.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269994.942e-4558.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479441.265e-1539.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273265.706e-1563.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coatomer subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
copb10.000e+057.66coatomer protein complex subunit beta 1 [Source:NC... [more]
ap3b1a7.226e-1029.45adaptor related protein complex 3 subunit beta 1 [... [more]
AP3B21.740e-930.82adaptor related protein complex 3 subunit beta 2 [... [more]
AP3B21.904e-930.82adaptor related protein complex 3 subunit beta 2 [... [more]
ap3b1a2.667e-929.38adaptor related protein complex 3 subunit beta 1 [... [more]
back to top
BLAST of Coatomer subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000033847.10.000e+099.80SMESG000033847.1[more]
SMESG000041850.15.737e-929.93SMESG000041850.1[more]
SMESG000074044.18.226e-920.87SMESG000074044.1[more]
SMESG000074044.13.578e-820.98SMESG000074044.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001344 ID=SMED30001344|Name=Coatomer subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=3090bp
ATCTATATAAATCTTATATGATTTATTAATGACATCTGATCAATCTTGTT
ATACTTTAATAAATTTACCTAATGAAAGTGATGTTCCATCAGAACAAAAA
TTGAAAGATGATCTTCAATCGCCGGATATTAAATTAAAAACTAATGCTTT
AAAAAGAGTAATTTTGATGATTTGCAATGGCGAAAAAATCAATAATCTTC
TCATGATAGTTATAAGATTTGTTATGCCTTGTCAAAATCACACAGTTAAA
AAGTTACTCCTGTTGTTCTGGGAAGTAGTTCCGAAATATGATAACAATGG
TAAATTAGCACAAGAAATGATTTTAGTATGTGATGCTTACCGAAAAGATC
TTCAGCATCCAAATGAATTTATCCGTGGTTCTACTTTGAGGTTTCTTTGC
AAATTAAAGGAACCTGAAGTTCTTGAACCTTTAATGCCATCTATCTTACA
ATGCTTGGAACATAGACATTCATATGTGCGTCGTAATGCAGTTTTAGCAA
TTTTTACTATTTACAAAAATTTCAATTTTTTGATACCTGATGCTCCAGAG
AAAATACATACGTTTTTAGATCAAGAGCAAGATGCATCTTGTAAGCGTAA
TGCATTTATGATGCTGCTTCATGCAAGTCAAGAAACAGCACTGGAGTATC
TGTCTACTTGTCTAGATCAAGTTCATACTTTTGGTGACATCTTACAATTA
ATCATAGTGGAATTGATATATAAAGTATGTCATTCAAATCCCCAGGAAAG
AGCCCGTTTCATTCGGTGTGTGTATAATTTACTCCAATCTAGTAGTCCAT
CTGTGAGATATGAGGCAGCTGGAACACTCATCACTTTAACTAGTGCTGCA
GCTGCGATTAAAGCTGTTGCAAGTTGTTATATTGACTTAATATTGAAAGA
AAGTGATAACAATGTTAAATTAATTGTGCTTGATAGATTAGTAGGATTGA
GAGAAAATCACGAAAAGGAATTGCAAACGCTTGTGATGGATGTTCTTAGA
ATATTAAGTTCTTCTGATTTGGAAGTTAGAAAAAAAACATTAAAACTTTG
TTTGGATTTAATGACAAATCGTACTGCTGAAGAATTAATTAATGTTCTTA
GAAAGGAAGTTATCAAGATTTGTAGTAATGAAAATGGTGACAGTGGAGTT
GATGAGAAAATGTATCGTTATTATTTGGTTAATACTATATATTTTGCATG
CGTGAGATATCCAGAAATGATTCCTACCGTGGTTCCAACGCTTTGTGAAT
TGTTGACTTATGAAATCGAATATCAGGAATTTAATGGTGCCGATGAGGTG
TGCAAGTTTTTGCGCGAAGCAATTCAGAAATATCCTCAGTATAAATCTTT
AATCATTGAGAAGTTGATGGAATTTTATCCAAATATCCGCTGTCGTGAAG
TGCTTCGACACACAATGTGGATTATGGGAGAATATTGCACAACCATTGAC
GAGATCGAAAATTTTGTCAATCTTATTTATCAAGTTCTCGGATCAGTTCC
ACTGGTTGAAGATGAAATTAAACGAATTAGCGGAGAAAACAATGAAGAAT
CTGCATTATTAGCTCCAGATGGAGGGGTAACTAGTCAGGCTTGTAAAGTT
ACAGCGGATGGCACTTATGCCACCCAGACTGCTCTAACATCAACTAAGCC
AAATAAGAGAACCTCTTCTGCCGAAAATATTAAACGACCCACTTTGCAGT
CATCACTTTTTACACCGGATTTCATGCCGGGTGTTACTCTGAGTGTGGCA
CTAGTGAAGGTGTTTTGTCGATTGTCCGATGCGCTTCGAGAATCTGGTAA
AAGTCGAGAAGAAATTATTAAAAAGGAAAATTCATTTGCTGCCGAATGTA
TGCTGATCATTGCAAGTATGATTAATCTTGGTAAATCGGATCTGCTGCCT
CATAGCGTTTGTCCAGATCTACTAGATAGGATGTGGTTTTGTCTCAAGGC
TCTCGCTGACCGCAATTTTACCATTTTGAAAGCAATGCAGAGCATGTGTC
GTGCAAAACTCATAGAAATGATTAATTCGCAAGACGCTGAGCGTCGAGAA
ATCGATAAAACCGGCGAATCTCTAATTCAAACTAGACCGGTTCCGAAAAT
AATTCAACCCGACAGTCCAGTTCATTTTTCTTTGCTAGCCAATAAGAATG
AAATGAATGAATTAATTGATCGATTTGATCTTACAATGAGTCAAGCTCTT
GGAGATACCGGAACATTTGGAAAAGATAGAAGCGATATATTTAGTACTTC
TAAACTTAGTAAAGTAACTCAATTGACGGGTTTCTCGGATCCGATCTATG
CTGAAGCGTACGTCCATGTCAACCAGTATGACATTGTACTAGACATCTTT
GTCGTAAACCAAACTTCAGATACTCTTCAAAATTTAACTGTTGAGTTGGC
TACTCTCGGAGATCTTAAATTGGTAGAAAAGCCATCTCCTCTCACTATGG
GACCTCACGATTTCACGAATATCAAGGCAAATATCAAGGTATCATCAAGT
GAAAATGGTATAATTTTTGGAAATATTGTCTATGATGTCAGCGGAGCTGC
TGGGGAATGCAATTGCGTGGTCTTGAATGATATTCATATAGATATTCTCG
AATACATTTTGCCGGCATCTTGTTCTCGTAGTCATTATAGAAAGATGTGG
AATGAATTTGAATGGGAAAACAAAGTTACGGTTAATACAAAAATCAAGGA
TCTTCATCAATACTTGAATCATATTACTAAAAATACAAATATGCGATGCC
TAACTCCACCAGAAGCCCTGGAAGGTGAATGTGATTATCTATGCGTTACT
TTGTATGCTAAGAGCATTTTCGGTGAACATGTTCTGGCAAATATCTGCTT
GGAAAAGCCGCCAGGAAATGAACCGGTTACTGGCCATGTGAGGATTCGTG
CCAAGAGTCAAGGAATGGCTGTGACAATGGGCGAGAAAATAAGTGCAGCC
CAAAAACAGATGCCAGTTGTCGAAATTGTGGAACCCGAAAAATTGGATGA
TTAGGAATCCCTGAAATAAACATTGATGTTTTTCAATAAAGATAATTTTT
GGTATTTGCTTTTGAATAAAAATTTTAAATCGAAAAAAAA
back to top

protein sequence of SMED30001344-orf-1

>SMED30001344-orf-1 ID=SMED30001344-orf-1|Name=SMED30001344-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=992bp
MTSDQSCYTLINLPNESDVPSEQKLKDDLQSPDIKLKTNALKRVILMICN
GEKINNLLMIVIRFVMPCQNHTVKKLLLLFWEVVPKYDNNGKLAQEMILV
CDAYRKDLQHPNEFIRGSTLRFLCKLKEPEVLEPLMPSILQCLEHRHSYV
RRNAVLAIFTIYKNFNFLIPDAPEKIHTFLDQEQDASCKRNAFMMLLHAS
QETALEYLSTCLDQVHTFGDILQLIIVELIYKVCHSNPQERARFIRCVYN
LLQSSSPSVRYEAAGTLITLTSAAAAIKAVASCYIDLILKESDNNVKLIV
LDRLVGLRENHEKELQTLVMDVLRILSSSDLEVRKKTLKLCLDLMTNRTA
EELINVLRKEVIKICSNENGDSGVDEKMYRYYLVNTIYFACVRYPEMIPT
VVPTLCELLTYEIEYQEFNGADEVCKFLREAIQKYPQYKSLIIEKLMEFY
PNIRCREVLRHTMWIMGEYCTTIDEIENFVNLIYQVLGSVPLVEDEIKRI
SGENNEESALLAPDGGVTSQACKVTADGTYATQTALTSTKPNKRTSSAEN
IKRPTLQSSLFTPDFMPGVTLSVALVKVFCRLSDALRESGKSREEIIKKE
NSFAAECMLIIASMINLGKSDLLPHSVCPDLLDRMWFCLKALADRNFTIL
KAMQSMCRAKLIEMINSQDAERREIDKTGESLIQTRPVPKIIQPDSPVHF
SLLANKNEMNELIDRFDLTMSQALGDTGTFGKDRSDIFSTSKLSKVTQLT
GFSDPIYAEAYVHVNQYDIVLDIFVVNQTSDTLQNLTVELATLGDLKLVE
KPSPLTMGPHDFTNIKANIKVSSSENGIIFGNIVYDVSGAAGECNCVVLN
DIHIDILEYILPASCSRSHYRKMWNEFEWENKVTVNTKIKDLHQYLNHIT
KNTNMRCLTPPEALEGECDYLCVTLYAKSIFGEHVLANICLEKPPGNEPV
TGHVRIRAKSQGMAVTMGEKISAAQKQMPVVEIVEPEKLDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR016460COPB1
IPR002553Clathrin/coatomer_adapt-like_N
IPR011710Coatomer_bsu_C
IPR011989ARM-like
IPR029446COPB1_appendage_platform_dom
IPR016024ARM-type_fold
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0016192vesicle-mediated transport
GO:0006810transport
GO:0015031protein transport
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0030117membrane coat
GO:0030126COPI vesicle coat
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0030663COPI-coated vesicle membrane
GO:0031410cytoplasmic vesicle
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029446Coatomer beta subunit, appendage platform domainPFAMPF14806Coatomer_b_Cplacoord: 847..974
e-value: 1.2E-53
score: 180.4
IPR016460Coatomer beta subunit (COPB1)PIRSFPIRSF005727Beta-COPcoord: 4..983
e-value: 0.0
score: 1142.0
IPR016460Coatomer beta subunit (COPB1)PANTHERPTHR10635COATOMER SUBUNIT BETAcoord: 7..980
IPR002553Clathrin/coatomer adaptor, adaptin-like, N-terminalPFAMPF01602Adaptin_Ncoord: 24..490
e-value: 2.8E-101
score: 339.6
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 19..504
e-value: 4.0E-83
score: 281.8
IPR011710Coatomer beta subunit, C-terminalPFAMPF07718Coatamer_beta_Ccoord: 698..840
e-value: 5.8E-55
score: 185.0
NoneNo IPR availablePANTHERPTHR10635:SF0COATOMER SUBUNIT BETAcoord: 7..980
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 26..657