Muscarinic acetylcholine receptor

Overview
NameMuscarinic acetylcholine receptor
Smed IDSMED30001335
Length (bp)1350
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Muscarinic acetylcholine receptor (SMED30001335) t-SNE clustered cells

Violin plots show distribution of expression levels for Muscarinic acetylcholine receptor (SMED30001335) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Muscarinic acetylcholine receptor (SMED30001335) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Muscarinic acetylcholine receptor (SMED30001335) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001335

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30001335SMESG000081829.1 dd_Smed_v4_14482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001335SMESG000081829.1 dd_Smed_v4_14482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001335SMESG000081829.1 dd_Smed_v4_14482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001335SMESG000081829.1 dd_Smed_v4_14482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001335SMESG000081829.1 dd_Smed_v4_14482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30001335SMESG000081829.1 dd_Smed_v4_14482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Human
Match: CHRM1 (cholinergic receptor muscarinic 1 [Source:HGNC Symbol;Acc:HGNC:1950])

HSP 1 Score: 189.119 bits (479), Expect = 3.130e-54
Identity = 150/420 (35.71%), Postives = 222/420 (52.86%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL-GYATPVYGGAALKYNHRDN------------------------------------YKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPN---CQGNLMSHGLRQSVRXXX----XXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            +Q+    +   +LSLAT  GNLLVLISF +  +L+T++NY+LLSLA +D +IG  SM LY+T+L+M  W   +  CDLWL+LDY  SNAS  NL+LIS+DRY ++T PL+YR KR+PR+  ++I L W++  +LW P I  W  + G+RTV  G+CY+QF+ S  ++T  T    + +P+ ++     +IYR T +R + L  L G  TP  GG +   + R                                        +M+S T +E     P  + + K+    P +   T Q    S  T    T              G  Q  ++K        KAA+TL+AI++AF +TW PYN+  L++ + +      +   L+  GY+LCY+NSTINP+ YA CN  FR TF  +L+C
Sbjct:   23 WQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFL-SQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSE--GEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKD----CVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLC 435          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Human
Match: CHRM1 (cholinergic receptor muscarinic 1 [Source:HGNC Symbol;Acc:HGNC:1950])

HSP 1 Score: 188.734 bits (478), Expect = 3.384e-54
Identity = 150/420 (35.71%), Postives = 222/420 (52.86%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL-GYATPVYGGAALKYNHRDN------------------------------------YKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPN---CQGNLMSHGLRQSVRXXX----XXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            +Q+    +   +LSLAT  GNLLVLISF +  +L+T++NY+LLSLA +D +IG  SM LY+T+L+M  W   +  CDLWL+LDY  SNAS  NL+LIS+DRY ++T PL+YR KR+PR+  ++I L W++  +LW P I  W  + G+RTV  G+CY+QF+ S  ++T  T    + +P+ ++     +IYR T +R + L  L G  TP  GG +   + R                                        +M+S T +E     P  + + K+    P +   T Q    S  T    T              G  Q  ++K        KAA+TL+AI++AF +TW PYN+  L++ + +      +   L+  GY+LCY+NSTINP+ YA CN  FR TF  +L+C
Sbjct:   23 WQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFL-SQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSE--GEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKD----CVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLC 435          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Human
Match: CHRM5 (cholinergic receptor muscarinic 5 [Source:HGNC Symbol;Acc:HGNC:1954])

HSP 1 Score: 179.489 bits (454), Expect = 5.195e-50
Identity = 99/236 (41.95%), Postives = 147/236 (62.29%), Query Frame = 1
Query:   49 NPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKN 756
            N  P      ++++  + +  ++SL T  GN+LV+ISF +  QL+T++NYYLLSLA +D +IGI SM LY+T+++M  W   S  CDLWL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+P++  I+I L W+I  +LW P I  W  + GKRTVP  +C +QF+   T +T  T    + IP+ ++ +   +IYR T  R K+L  L  +  V      K  HR  +++
Sbjct:   18 NHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPT-ITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRS 252          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Human
Match: CHRM5 (cholinergic receptor muscarinic 5 [Source:HGNC Symbol;Acc:HGNC:1954])

HSP 1 Score: 179.489 bits (454), Expect = 5.195e-50
Identity = 99/236 (41.95%), Postives = 147/236 (62.29%), Query Frame = 1
Query:   49 NPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKN 756
            N  P      ++++  + +  ++SL T  GN+LV+ISF +  QL+T++NYYLLSLA +D +IGI SM LY+T+++M  W   S  CDLWL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+P++  I+I L W+I  +LW P I  W  + GKRTVP  +C +QF+   T +T  T    + IP+ ++ +   +IYR T  R K+L  L  +  V      K  HR  +++
Sbjct:   18 NHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPT-ITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRS 252          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Human
Match: CHRM3 (cholinergic receptor muscarinic 3 [Source:HGNC Symbol;Acc:HGNC:1952])

HSP 1 Score: 177.563 bits (449), Expect = 6.429e-49
Identity = 92/217 (42.40%), Postives = 141/217 (64.98%), Query Frame = 1
Query:   40 NETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
            + T  DP      +Q++  + +  IL+L T  GN+LV++SF +  QL+T++NY+LLSLA +D +IG+ISM L++T++IM  W   +  CDLWL++DY  SNAS  NL++IS+DRY ++T PLTYR KR+ ++  ++I L W+I  +LW P I  W    GKRTVP G+C++QF+   T +T  T    + +P+ I+ +   +IY+ T  R K L  L
Sbjct:   53 DGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPT-ITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGL 268          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Celegans
Match: gar-3 (Muscarinic acetylcholine receptor gar-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9U7D5])

HSP 1 Score: 161.384 bits (407), Expect = 1.422e-43
Identity = 103/291 (35.40%), Postives = 169/291 (58.08%), Query Frame = 1
Query:   82 QILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKN---LQTLGYATPVY------------GGAALKYNHRDNYKNMDSSTDTEISNRNPKEK-----CIKKVHKFQPNSLILTPQNLNYSSVTSSN 894
            ++++  +I  + +L T+ GNL+V++SF I+ QL+TISNY+L SLAV+D  IG+IS+P+++ +  +Q W    T C  WL +DY +SNAS  NL+LIS+DRY ++T PL+YR +R+ +K + +I  T+II  +LW P I  WP I+GK T   G C VQF++++  +T+ T    + +P+ I+ +   ++Y  T+ R K    LQ   ++                 G+  K N++D Y  ++ S     S+RN K K     C  K +    +S      NL+ +S++SS+
Sbjct:   64 RMVMIVVIGAMFALVTSLGNLMVMVSFKIDKQLQTISNYFLFSLAVADIAIGVISIPMFTYYTAIQKWDLGYTMCQFWLCIDYLMSNASVLNLLLISFDRYFSVTRPLSYRPRRTTKKALTMIACTYIISLILWPPWIISWPYIEGKFTAEPGTCVVQFLQTNPYVTVGTAVAAFYLPVTIMCILYTRVYWETQKRQKEFGKLQATQFSRRSMKRDVSSTSIIKSSGSMRKKNNQDGY--VEDSVTPCTSSRNSKRKSWLRNCTGKSNSSSEDSSEAVAMNLDDTSLSSSH 352          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Celegans
Match: gar-3 (Muscarinic acetylcholine receptor gar-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9U7D5])

HSP 1 Score: 161.384 bits (407), Expect = 1.422e-43
Identity = 103/291 (35.40%), Postives = 169/291 (58.08%), Query Frame = 1
Query:   82 QILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKN---LQTLGYATPVY------------GGAALKYNHRDNYKNMDSSTDTEISNRNPKEK-----CIKKVHKFQPNSLILTPQNLNYSSVTSSN 894
            ++++  +I  + +L T+ GNL+V++SF I+ QL+TISNY+L SLAV+D  IG+IS+P+++ +  +Q W    T C  WL +DY +SNAS  NL+LIS+DRY ++T PL+YR +R+ +K + +I  T+II  +LW P I  WP I+GK T   G C VQF++++  +T+ T    + +P+ I+ +   ++Y  T+ R K    LQ   ++                 G+  K N++D Y  ++ S     S+RN K K     C  K +    +S      NL+ +S++SS+
Sbjct:   64 RMVMIVVIGAMFALVTSLGNLMVMVSFKIDKQLQTISNYFLFSLAVADIAIGVISIPMFTYYTAIQKWDLGYTMCQFWLCIDYLMSNASVLNLLLISFDRYFSVTRPLSYRPRRTTKKALTMIACTYIISLILWPPWIISWPYIEGKFTAEPGTCVVQFLQTNPYVTVGTAVAAFYLPVTIMCILYTRVYWETQKRQKEFGKLQATQFSRRSMKRDVSSTSIIKSSGSMRKKNNQDGY--VEDSVTPCTSSRNSKRKSWLRNCTGKSNSSSEDSSEAVAMNLDDTSLSSSH 352          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Celegans
Match: gar-3 (Muscarinic acetylcholine receptor gar-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9U7D5])

HSP 1 Score: 159.458 bits (402), Expect = 1.095e-42
Identity = 93/255 (36.47%), Postives = 150/255 (58.82%), Query Frame = 1
Query:   82 QILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSL 846
            ++++  +I  + +L T+ GNL+V++SF I+ QL+TISNY+L SLAV+D  IG+IS+P+++ +  +Q W    T C  WL +DY +SNAS  NL+LIS+DRY ++T PL+YR +R+ +K + +I  T+II  +LW P I  WP I+GK T   G C VQF++++  +T+ T    + +P+ I+ +   ++Y  T+ R K    L  AT  +    +      +++N                K  KKV KF   S+
Sbjct:   64 RMVMIVVIGAMFALVTSLGNLMVMVSFKIDKQLQTISNYFLFSLAVADIAIGVISIPMFTYYTAIQKWDLGYTMCQFWLCIDYLMSNASVLNLLLISFDRYFSVTRPLSYRPRRTTKKALTMIACTYIISLILWPPWIISWPYIEGKFTAEPGTCVVQFLQTNPYVTVGTAVAAFYLPVTIMCILYTRVYWETQKRQKEFGKL-QATQTWASDVVDRPSTQSFRN---------------SKMWKKVKKFSRRSM 302          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 100.908 bits (250), Expect = 4.106e-23
Identity = 102/365 (27.95%), Postives = 183/365 (50.14%), Query Frame = 1
Query:  136 GNLLVLISFCIEGQLRTI-SNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIG-YLIPLFIIIVFAIQIYRVT-RH----------RNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKC---IKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRR 1182
            GNLLV+++   + +LR    N+ ++SLAV+D L+G++ MPL  T+ I+  W   +  C++WL+LD     AS  ++  IS DRY ++T PLTY   R+P +  I I ++WI+  L+  P I+ W     +    +G+C V    S+ L  +L  ++G + IP+ I+I+   +IY +T RH          R+  L  L   +       ++Y   +N   ++   +  ++NR+   K    ++K+ +  P   +    + N++S  +S+ T    +        R   + K    +A   L  I+ AF ++W P+ L  +I  +   ++ P +    + F ++L Y NS INP++Y   N  F+R
Sbjct:   38 GNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGW-----RPERAEGECSV----STDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKIALDTNHNSPPASDLTRKLEEKKFCEKRKR---KLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGH-EAPPLV----FKFFFWLGYCNSGINPVIYTVFNREFKR 385          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Celegans
Match: gar-2 (Muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 96.6709 bits (239), Expect = 1.089e-22
Identity = 66/192 (34.38%), Postives = 112/192 (58.33%), Query Frame = 1
Query:   97 SLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLI-MQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDG-KRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRH 666
            +L    LS+ T  GNL VL+S+ ++  +R  +NY++ SLA+SD LIG+  +P+Y+ F +    W +    CDLWLS+DY V  AS   ++ I+ DRY ++  P TYR  R+P + ++II+  W++ ++L++  I+ +    G  R + + +CYVQFM +  L   +  +  Y   LF+++     IYR  + 
Sbjct:    9 ALFMLFLSIVTVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLIGLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMTNPYLNMGMYISY-YWTTLFVMLYLYWGIYRAAKK 199          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Fly
Match: mAChR-A (gene:FBgn0000037 transcript:FBtr0072367)

HSP 1 Score: 187.963 bits (476), Expect = 5.008e-52
Identity = 100/236 (42.37%), Postives = 147/236 (62.29%), Query Frame = 1
Query:   85 ILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNR 792
            +++   +A ILS  T  GN++V+ISF I+ QL+TISNY+L SLA++DF IG ISMPL++   I+ +WP     CD WL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+  +  ++I   W I  LLW P IY WP I+GKRTVP+ +CY+QF+E++  +T  T    +  P+ I+     +I+R T+ R K+L              L+   +D+ K  +SS +  + N 
Sbjct:  104 MVVMGFVAAILSTVTVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIGAISMPLFAVTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNRAAVMIGAAWGISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYITFGTALAAFYFPVTIMCFLYWRIWRETKKRQKDLPN------------LQAGKKDSSKRSNSSDENTVVNH 327          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Fly
Match: mAChR-A (gene:FBgn0000037 transcript:FBtr0072368)

HSP 1 Score: 187.963 bits (476), Expect = 5.131e-52
Identity = 100/236 (42.37%), Postives = 147/236 (62.29%), Query Frame = 1
Query:   85 ILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNR 792
            +++   +A ILS  T  GN++V+ISF I+ QL+TISNY+L SLA++DF IG ISMPL++   I+ +WP     CD WL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+  +  ++I   W I  LLW P IY WP I+GKRTVP+ +CY+QF+E++  +T  T    +  P+ I+     +I+R T+ R K+L              L+   +D+ K  +SS +  + N 
Sbjct:  104 MVVMGFVAAILSTVTVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIGAISMPLFAVTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNRAAVMIGAAWGISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYITFGTALAAFYFPVTIMCFLYWRIWRETKKRQKDLPN------------LQAGKKDSSKRSNSSDENTVVNH 327          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Fly
Match: mAChR-B (gene:FBgn0037546 transcript:FBtr0344726)

HSP 1 Score: 107.457 bits (267), Expect = 1.601e-24
Identity = 86/268 (32.09%), Postives = 135/268 (50.37%), Query Frame = 1
Query:  127 TACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGY----LIPLFI----IIVFAIQIYRVTRHRNKNLQTL-----GYATPVYGGAA-----------LKYNHRDNYKNMDSSTDTEI------SNRNPKEKCIKKVHKFQPN 840
            T  GN+LVL++F ++  +R  SNY++ SLA +D LIG +SMP Y+ +++  +W      CDLWLS+DYTV   S   ++LI+ DRY ++     YR  R+  + I ++ +TWII ALL+   I+ W    GKR +  G+C VQF++     T L   IGY    LI LF+    I   A  + + +  + + +Q++     G  + + G AA            K     +  ++DS+  T I         NP     ++V K  P 
Sbjct:  147 TVGGNILVLLAFIVDRNIRQPSNYFIASLAATDMLIGTVSMPFYTIYVLKGYWDLGPMLCDLWLSVDYTVCLVSQYTVLLITIDRYCSVKIAAKYRSWRTRTRVIYMVTITWIIPALLFFISIFGWEHFTGKRDLLPGQCAVQFLKDPIFNTALI--IGYYWTTLIVLFVLYAGIYKTAYDMQKRSEAKQRKMQSMVALSAGAMSGMAGHAAGIGVIEEKILKTKVELAGDQTDLDSACTTVIKRLSGSGQANPLAVATEEVEKMTPE 412          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Fly
Match: mAChR-B (gene:FBgn0037546 transcript:FBtr0081789)

HSP 1 Score: 105.916 bits (263), Expect = 5.688e-24
Identity = 76/212 (35.85%), Postives = 119/212 (56.13%), Query Frame = 1
Query:  127 TACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGY----LIPLFI----IIVFAIQIYRVTRHRNKNLQTL-----GYATPVYGGAA 723
            T  GN+LVL++F ++  +R  SNY++ SLA +D LIG +SMP Y+ +++  +W      CDLWLS+DYTV   S   ++LI+ DRY ++     YR  R+  + I ++ +TWII ALL+   I+ W    GKR +  G+C VQF++     T L   IGY    LI LF+    I   A  + + +  + + +Q++     G  + + G AA
Sbjct:  147 TVGGNILVLLAFIVDRNIRQPSNYFIASLAATDMLIGTVSMPFYTIYVLKGYWDLGPMLCDLWLSVDYTVCLVSQYTVLLITIDRYCSVKIAAKYRSWRTRTRVIYMVTITWIIPALLFFISIFGWEHFTGKRDLLPGQCAVQFLKDPIFNTALI--IGYYWTTLIVLFVLYAGIYKTAYDMQKRSEAKQRKMQSMVALSAGAMSGMAGHAA 356          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0334508)

HSP 1 Score: 93.9745 bits (232), Expect = 2.656e-20
Identity = 50/132 (37.88%), Postives = 74/132 (56.06%), Query Frame = 1
Query:   40 NETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRK 435
             E     F+  P   I + S++  I+ L T  GN+LV I+ C+  +LR   NY L+SLA+SD  + ++ MP+   + +++ W F    CD+W+S D     AS  NL  IS DRY  +T PL Y  KR+PR+
Sbjct:  148 EEFAAGEFVLPPLTSIFV-SIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRR 278          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Zebrafish
Match: chrm5a (cholinergic receptor, muscarinic 5a [Source:ZFIN;Acc:ZDB-GENE-080723-32])

HSP 1 Score: 183.341 bits (464), Expect = 4.901e-52
Identity = 148/449 (32.96%), Postives = 235/449 (52.34%), Query Frame = 1
Query:   76 FYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL----------GYATP-----VYGGAAL-------KYNHRDNYKNMD---------SSTDTEISNRNPKEKC--------------------------IKKV--HKFQPNSL--------ILTPQNLNYSSVTSSNS-----TIPNCQGNLMSHGLRQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
             ++++  + ++ I+S  T  GN+LV++SF +  QL+T++NYYLLSLA +D +IG+ SM LY+++++M +W   S  CDLWL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+P++  I+I L W++  +LW P I  W    GKRTVP+ +C +QF  S  ++T  T    +  P+ ++ +   +IY+ T  R K+L  L          G A P      +G   +         +H +  K +D         +S++ E  + N +E C                           KK   +KF+P  +           P   ++SS  S N+     +     G L     ++         KAA+TL+AI++AF +TW PYN+  LI+ +     +  I   L+  GY+LCY+NST+NP+ YA CN  F++TF  +L+C
Sbjct:   22 LWEVIAIATVSAIVSFITIIGNILVMLSFKVNSQLKTVNNYYLLSLAFADLIIGVFSMNLYTSYILMGYWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLVSFILWAPPILCWQYFVGKRTVPERQCQIQFF-SEPVITFGTAIAAFYFPVSVMTILYCRIYKETERRTKDLAELQGINSSTNSSGDAQPQKIRSCFGCKHVSNTSRTQALSHTNAAKTLDDQLTNFNSYASSEEEDRSGNFQESCRHQENKSESYEEENFFPTPVKASPTKTKKCVSYKFKPKDVSPLKNTNGDAKPGASSFSSAESVNAPSSSSSSKPIDGTLKCQITKRKRMVLIKEKKAAQTLSAILLAFILTWTPYNIMVLISTF----CSDCIPLSLWHLGYWLCYVNSTVNPMCYALCNKTFQKTFRMLLLC 465          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Zebrafish
Match: CR812847.1 (pep chromosome:GRCz11:CHR_ALT_CTG14_1_19:24256795:24262094:1 gene:ENSDARG00000112321.1 transcript:ENSDART00000181335.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR812847.1)

HSP 1 Score: 176.792 bits (447), Expect = 2.070e-50
Identity = 141/401 (35.16%), Postives = 219/401 (54.61%), Query Frame = 1
Query:   34 MNNETNPD-PFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPK---EKCIKKVHKFQPNSLILTPQNLNYSSVTSS---NSTIPNCQGNLMSHGLRQ---SVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            MN+    D P      ++  + + I   LSL T  GN+LV+ISF +   LRT+SNY+LLSLAV+D ++G ISM LY+T++++  W   +  CD+WL++DY  SNAS  NL+ IS DRY ++  PLTYR KR+P++ +I+I L W I  ++W P I  W  I G+RTV + +C +QF+ S  ++T  T    + +P+ +++    ++YR T  R++ L          G  A +     N   +  +  T +  R  K     C KK  + +  S   +  N  + S + +   N         L++ G R             KAA+TL+AI++AF VTW PYN+  L++ +     +  +   L+  GY+LCY+NST+NP+ YA CN  FR TF  +L+C
Sbjct:    1 MNDFKKGDSPIPGFISWKTAMITFITVPLSLITITGNVLVMISFRVNPLLRTVSNYFLLSLAVADVILGSISMNLYTTYILLNGWTLGNLACDVWLAVDYVASNASVMNLLAISIDRYLSVMRPLTYRAKRTPKRAMIMISLAWTISFVIWAPAILFWQYIVGERTVQENECSIQFL-SEPVITFGTAIAAFYLPVSVMVALYWRVYRETEKRSQKLA---------GLMASQGGRTGNASQVGFTVKTLLPGRCVKGIWTACWKKQREREDISNSYSAANKPHDSESPNSLMNPATTQASALLLNAGQRSRKARTSSLIKEKKAARTLSAILLAFIVTWTPYNIMVLVSTF----CDNCVPERLWKLGYWLCYVNSTVNPLCYALCNKHFRVTFRALLLC 387          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Zebrafish
Match: chrm3a (cholinergic receptor, muscarinic 3a [Source:ZFIN;Acc:ZDB-GENE-090410-4])

HSP 1 Score: 180.644 bits (457), Expect = 2.779e-50
Identity = 93/221 (42.08%), Postives = 145/221 (65.61%), Query Frame = 1
Query:   55 DPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGG 717
            DP      +Q+++  +   +LSL T  GN+LV++SF +  QL+T++NY+LLSLAV+D +IG+ISM LY+ +++M  W   +  CDLWL++DY  SNAS  NL++IS+DRY ++T PLTYR KR+ ++  ++I L W +  +LW P I  W    G+RTVPQ KCY+QF+ S  ++T  T    + +P+ I+ V   +IY+ T +R++ L  L  +   +GG
Sbjct:   58 DPLGGHSLWQVILIVVFTGLLSLITIIGNILVMVSFKVNRQLKTVNNYFLLSLAVADLIIGVISMNLYTAYIVMGQWAMGNWACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWFVSLILWAPAILFWQYFVGQRTVPQDKCYIQFL-SEPIITFCTAMAAFYLPVTIMSVLYWRIYKETENRSRELAGLQGSGGRFGG 277          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Zebrafish
Match: chrm1a (cholinergic receptor, muscarinic 1a [Source:ZFIN;Acc:ZDB-GENE-090410-9])

HSP 1 Score: 176.022 bits (445), Expect = 6.221e-50
Identity = 141/397 (35.52%), Postives = 217/397 (54.66%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL--------GYATPV-------YGGAALKYNHRDNYKNMDSSTDTE---ISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQ---SVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            ++  + + I   LSL T  GN+LV+ISF +   LRT+SNY+LLSLAV+D ++G ISM LY+T++++  W   +  CD+WL++DY  SNAS  NL+ IS DRY ++  PLTYR KR+P++ +I+I L W I  ++W P I  W  I G+RTV + +C +QF+ S  ++T  T    + +P+ +++    ++YR T  R++ L  L        G A+ V         G  +K      +K      D      +N +P+    K      PNSL + P     S++             L++ G R             KAA+TL+AI++AF VTW PYN+  L++ +     +  +   L+  GY+LCY+NST+NP+ YA CN  FR TF  +L+C
Sbjct:   20 WKTAMITFITVPLSLITITGNVLVMISFRVNPLLRTVSNYFLLSLAVADVILGSISMNLYTTYILLNGWTLGNLACDVWLAVDYVASNASVMNLLAISIDRYLSVMRPLTYRAKRTPKRAMIMISLAWTISFVIWAPAILFWQYIVGERTVQENECSIQFL-SEPVITFGTAIAAFYLPVSVMVALYWRVYRETEKRSQKLAGLMASQGGRTGNASQVGFTVKTLLPGRCVKGIWTACWKKQREREDISNSYATNNHPQSAANKPHDSESPNSL-MNPATTQASAL-------------LLNAGQRSRKARTSSLIKEKKAARTLSAILLAFIVTWTPYNIMVLVSTF----CDNCVPERLWKLGYWLCYVNSTVNPLCYALCNKHFRVTFRALLLC 397          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Zebrafish
Match: chrm5b (cholinergic receptor, muscarinic 5b [Source:ZFIN;Acc:ZDB-GENE-041001-169])

HSP 1 Score: 172.94 bits (437), Expect = 4.629e-48
Identity = 94/216 (43.52%), Postives = 143/216 (66.20%), Query Frame = 1
Query:   52 PDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL-GY 696
            PDP+  L   +++  + ++ I+SL T  GN+LV++SF +  QL+T++NYYLLSLA +D +IG+ SM LY+ +++M +W   +T CDLWL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+P++  I+I + W+I  +LW P I  W    G+R VP  +C +QF  S  ++T  T    + +P+ I+ +   +IY+ T  R KNL  L GY
Sbjct:   19 PDPYSLL---EVITIATVSAIVSLITIVGNVLVMLSFKVNSQLKTVNNYYLLSLAFADLIIGVFSMNLYTCYILMGYWSLGNTACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGMAWLISFILWAPPILCWQYFVGERKVPLDQCQIQFF-SEPIITFGTAIAAFYVPVSIMTILYCKIYKETEKRTKNLAELQGY 230          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Xenopus
Match: CHRM1 (cholinergic receptor, muscarinic 1 [Source:NCBI gene;Acc:100490434])

HSP 1 Score: 173.711 bits (439), Expect = 4.432e-48
Identity = 92/212 (43.40%), Postives = 138/212 (65.09%), Query Frame = 1
Query:   55 DPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
            DP      +++++  +   ILSL T  GN+LVL++F +   L+T++NY+LLSLA +D +IG +SM LY+T+++M  W     +CDLWL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+PR+  I+I + W I  +LW P I  W  I G+RTV    CY+QF  S  ++T  T    + +P+ I+I+   ++YR T +R+K L  L
Sbjct:   37 DPLGGHAVWEVVLIVITTGILSLVTVIGNVLVLLAFKVNSDLKTVNNYFLLSLACADIIIGALSMNLYTTYIVMGRWALGPVSCDLWLALDYVASNASVMNLLIISFDRYFSITRPLTYRAKRTPRRAAIMIGMAWFISFVLWAPAIIFWQYIVGERTVEATDCYIQFF-SQPIITFGTAIAAFYLPVTIMIILYWRVYRETENRSKELAGL 247          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Xenopus
Match: slitrk3 (SLIT and NTRK like family member 3 [Source:Xenbase;Acc:XB-GENE-964617])

HSP 1 Score: 171.4 bits (433), Expect = 4.265e-47
Identity = 91/225 (40.44%), Postives = 142/225 (63.11%), Query Frame = 1
Query:   34 MNNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPV 708
            +NN     P  A   ++++  + ++ I+SL T  GN+LV++SF +  QL+T++NYYLLSLA +D +IGI SM LY++++++  W   S  CDLWL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+P++  ++I L W I  +LW P I  W    G RTVP  +C +QF+    ++T  T    + +P+ ++ +   +IY+ T  R K+L  L  +  V
Sbjct:    8 LNNSNGTVPLKAHSLWEVITIATVSAIVSLITIVGNILVMVSFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTSYILIGHWSLGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGLMIGLAWFISFILWAPAILCWQYFVGGRTVPPEECQIQFL-YEPIITFGTAIAAFYLPVSVMTILYCRIYKETEKRTKDLAELQGSESV 231          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Xenopus
Match: ENSXETT00000048394.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:59937956:59939943:1 gene:ENSXETG00000020181.1 transcript:ENSXETT00000048394.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.777 bits (421), Expect = 2.944e-45
Identity = 91/218 (41.74%), Postives = 138/218 (63.30%), Query Frame = 1
Query:   37 NNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
             N T  D       +Q+ + +  + I++L T  GN+LV+++F +  QL+T++NY+LLSLA +D +IG+ISM L++T++IM  W   S  CDLWL +DY  SNAS  NL++IS+DRY ++T PLTYR KR+ ++  I+I L WII  +LW P I  W    GKRTVP  +C++QF  +  ++T  T    + +P+ I+ +   +IY+ T  R K L  L
Sbjct:   33 GNYTERDYLGGHTVWQVFLIASFSGIIALVTVIGNILVILAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMDHWIMGSLACDLWLMIDYVASNASVMNLLVISFDRYFSITRPLTYRTKRTTKRAGIMIGLAWIISFILWAPAILFWQYFVGKRTVPSDECFIQFF-TEPIITFGTAIAAFYLPVSIMTILYWRIYKETEKRTKELAGL 249          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Xenopus
Match: CHRM2 (cholinergic receptor, muscarinic 2 [Source:NCBI gene;Acc:100485603])

HSP 1 Score: 159.458 bits (402), Expect = 4.109e-43
Identity = 85/216 (39.35%), Postives = 134/216 (62.04%), Query Frame = 1
Query:   34 MNNETNPDPFMALPF--YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNK 675
            +N  +  +  M  P+   +++   ++A  LSL T  GN+LV++S  +   L+T++NY+L SLA +D +IG+ SM LY+ + ++ +WP     CDLWL+LDY VSNAS  NL++IS+DRY  +T PLTY  +R+ +   ++I   W++  +LW P I  W  I G RTVP+G+CY+QF  S+  +T  T    + +P+ I+ V   QI R ++ R K
Sbjct:    7 VNVSSTNETMMGSPYKTVEVVFIVIVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPIGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVRRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGGRTVPEGECYIQFF-SNAAVTFGTAIAAFYLPVIIMTVLYWQISRASKSRIK 221          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Xenopus
Match: krcc1 (lysine-rich coiled-coil 1 [Source:Xenbase;Acc:XB-GENE-1016025])

HSP 1 Score: 137.117 bits (344), Expect = 2.682e-35
Identity = 118/396 (29.80%), Postives = 202/396 (51.01%), Query Frame = 1
Query:   76 FYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRS-PRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKN----LQTLGYATPVYGGAALKYNHRDN-------YKNMD--SSTDTEISNRNPKEKCIKKVHKFQPNSL---ILTPQNLNYSSVTSSN--STIPNCQGNL--MSHGLRQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRIL 1200
            F   +  +++  +L ++T  GN LV+++F ++  LRT +NY+LL+LA+SDF +G + +PLY  +++   W F  + C LWL LDY +  +S  N+VLISYDR+ ++T  ++YR ++S  R  ++ + + WI+  LL+ P I  W  I G   +P G+C+ +F  +   L +    + +  P   +  F + IY   + R K     LQ     T      A     R +       ++ M     +D + + +  + + +++V   + NSL    +T    + S+  S N  S+ P+ +  +  +S G+ Q  R      K AK+LA I+ AF + W PY L  +I    R    P      Y   ++L ++NS +NPILY  C+  F+R F +IL
Sbjct:   23 FSWTVFLAVLMGVLIVSTVLGNALVMLAFVVDSSLRTQNNYFLLNLAISDFFVGALCIPLYVPYVLTGRWGFGRSVCKLWLVLDYLLCTSSVFNIVLISYDRFISVTRAVSYRAQQSNSRHAVLKMTMVWILAFLLYGPAIITWEYIAGGSIIPDGECFAEFFYNWYFL-MTASTLEFFTPFISVTYFNVSIYMNIQKRTKARLDLLQEAQSHTNTDNIKAPPEKARSSSLKCWKLHQKMARFGGSDHQKTIKLTESEMMERVRGMKRNSLNGSTVTAMGKSRSARRSFNESSSTPSLEKKMRVVSQGIAQRFR-LSRDKKVAKSLAVIVCAFGLCWAPYTLLMIIRAACRGHCVPN---YWYEASFWLLWVNSAVNPILYPLCHNSFKRAFRKIL 413          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Mouse
Match: Chrm1 (cholinergic receptor, muscarinic 1, CNS [Source:MGI Symbol;Acc:MGI:88396])

HSP 1 Score: 187.963 bits (476), Expect = 4.846e-54
Identity = 147/420 (35.00%), Postives = 219/420 (52.14%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL-GYATPVYGGAALKYNHRDN------------------------------------YKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRXXX-------XXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            +Q+    +   +LSLAT  GNLLVLISF +  +L+T++NY+LLSLA +D +IG  SM LY+T+L+M  W   +  CDLWL+LDY  SNAS  NL+LIS+DRY ++T PL+YR KR+PR+  ++I L W++  +LW P I  W  + G+RTV  G+CY+QF+ S  ++T  T    + +P+ ++     +IYR T +R + L  L G  TP  GG +   + R                                        +M+S T +E     P  + + K+    P +   T Q    S  T    T             R   +             KAA+TL+AI++AF +TW PYN+  L++ + +      +   L+  GY+LCY+NST+NP+ YA CN  FR TF  +L+C
Sbjct:   23 WQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFL-SQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSE--GEEPGSEVVIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKD----CVPETLWELGYWLCYVNSTVNPMCYALCNKAFRDTFRLLLLC 435          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Mouse
Match: Chrm1 (cholinergic receptor, muscarinic 1, CNS [Source:MGI Symbol;Acc:MGI:88396])

HSP 1 Score: 187.963 bits (476), Expect = 4.846e-54
Identity = 147/420 (35.00%), Postives = 219/420 (52.14%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL-GYATPVYGGAALKYNHRDN------------------------------------YKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRXXX-------XXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            +Q+    +   +LSLAT  GNLLVLISF +  +L+T++NY+LLSLA +D +IG  SM LY+T+L+M  W   +  CDLWL+LDY  SNAS  NL+LIS+DRY ++T PL+YR KR+PR+  ++I L W++  +LW P I  W  + G+RTV  G+CY+QF+ S  ++T  T    + +P+ ++     +IYR T +R + L  L G  TP  GG +   + R                                        +M+S T +E     P  + + K+    P +   T Q    S  T    T             R   +             KAA+TL+AI++AF +TW PYN+  L++ + +      +   L+  GY+LCY+NST+NP+ YA CN  FR TF  +L+C
Sbjct:   23 WQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFL-SQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSE--GEEPGSEVVIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKD----CVPETLWELGYWLCYVNSTVNPMCYALCNKAFRDTFRLLLLC 435          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Mouse
Match: Chrm3 (cholinergic receptor, muscarinic 3, cardiac [Source:MGI Symbol;Acc:MGI:88398])

HSP 1 Score: 179.489 bits (454), Expect = 7.583e-50
Identity = 92/218 (42.20%), Postives = 143/218 (65.60%), Query Frame = 1
Query:   37 NNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
            +N+T+ DP      +Q++  + +   L+L T  GN+LV+++F +  QL+T++NY+LLSLA +D +IG+ISM L++T++IM  W   +  CDLWLS+DY  SNAS  NL++IS+DRY ++T PLTYR KR+ ++  ++I L W+I  +LW P I  W    GKRTVP G+C++QF+   T +T  T    + +P+ I+ +   +IY+ T  R K L  L
Sbjct:   51 SNDTSSDPLGGHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPT-ITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGL 267          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Mouse
Match: Chrm3 (cholinergic receptor, muscarinic 3, cardiac [Source:MGI Symbol;Acc:MGI:88398])

HSP 1 Score: 179.489 bits (454), Expect = 7.583e-50
Identity = 92/218 (42.20%), Postives = 143/218 (65.60%), Query Frame = 1
Query:   37 NNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
            +N+T+ DP      +Q++  + +   L+L T  GN+LV+++F +  QL+T++NY+LLSLA +D +IG+ISM L++T++IM  W   +  CDLWLS+DY  SNAS  NL++IS+DRY ++T PLTYR KR+ ++  ++I L W+I  +LW P I  W    GKRTVP G+C++QF+   T +T  T    + +P+ I+ +   +IY+ T  R K L  L
Sbjct:   51 SNDTSSDPLGGHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPT-ITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGL 267          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Mouse
Match: Chrm2 (cholinergic receptor, muscarinic 2, cardiac [Source:MGI Symbol;Acc:MGI:88397])

HSP 1 Score: 176.792 bits (447), Expect = 8.687e-50
Identity = 143/443 (32.28%), Postives = 217/443 (48.98%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHR--NKNLQTLGYATPVY------------------GGAALKYNHRDNYK------------------NMDSST---------DTEIS--------------NRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNL------MSHGLRQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            ++++   L+A  LSL T  GN+LV++S  +   L+T++NY+L SLA +D +IG+ SM LY+ + ++ +WP     CDLWL+LDY VSNAS  NL++IS+DRY  +T PLTY  KR+ +   ++I   W++  +LW P I  W  I G RTV  G+CY+QF  S+  +T  T    + +P+ I+ V    I R ++ R   +  + +    PV                   G   L++N   N K                  + DS++         D EI+              + N ++ CIK V K Q      TP +     V SS       Q  +      M+    +         K  +T+ AI++AF +TW PYN+  LIN +      P I   ++  GY+LCY+NSTINP  YA CN  F++TF  +L+C
Sbjct:   21 FEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFF-SNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRIVKPNNNNMPGGDGGLEHNKIQNGKAPRDGGTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDDNSRQTCIKIVTKTQKGDA-CTPTSTTVELVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCA----PCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMC 457          
BLAST of Muscarinic acetylcholine receptor vs. UniProt/SwissProt
Match: sp|P56489|ACM1_MACMU (Muscarinic acetylcholine receptor M1 OS=Macaca mulatta OX=9544 GN=CHRM1 PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 2.378e-55
Identity = 148/420 (35.24%), Postives = 223/420 (53.10%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL-GYATP------------------------------------VYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPN---CQGNLMSHGLRQSVRXXX----XXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            +Q+    +   +LSLAT  GNLLVLISF +  +L+T++NY+LLSLA +D +IG  SM LY+T+L+M  W   +  CDLWL+LDY  SNAS  NL+LIS+DRY ++T PL+YR KR+PR+  ++I L W++  +LW P I  W  + G+RTV  G+CY+QF+ S  ++T  T    + +P+ ++     +IYR T +R + L  L G  TP                                    +    + K +  ++  +M+S T +E     P  + + K+    P +   T Q    S  T    T              G  Q  ++K        KAA+TL+AI++AF +TW PYN+  L++ + +      +   L+  GY+LCY+NSTINP+ YA CN  FR TF  +L+C
Sbjct:   23 WQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFL-SQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRPPRLLQAYSWKEDEEEDEGSMESLTSSE--GEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKD----CVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLC 435          
BLAST of Muscarinic acetylcholine receptor vs. UniProt/SwissProt
Match: sp|P11229|ACM1_HUMAN (Muscarinic acetylcholine receptor M1 OS=Homo sapiens OX=9606 GN=CHRM1 PE=1 SV=2)

HSP 1 Score: 189.119 bits (479), Expect = 1.503e-53
Identity = 150/420 (35.71%), Postives = 222/420 (52.86%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL-GYATPVYGGAALKYNHRDN------------------------------------YKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPN---CQGNLMSHGLRQSVRXXX----XXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            +Q+    +   +LSLAT  GNLLVLISF +  +L+T++NY+LLSLA +D +IG  SM LY+T+L+M  W   +  CDLWL+LDY  SNAS  NL+LIS+DRY ++T PL+YR KR+PR+  ++I L W++  +LW P I  W  + G+RTV  G+CY+QF+ S  ++T  T    + +P+ ++     +IYR T +R + L  L G  TP  GG +   + R                                        +M+S T +E     P  + + K+    P +   T Q    S  T    T              G  Q  ++K        KAA+TL+AI++AF +TW PYN+  L++ + +      +   L+  GY+LCY+NSTINP+ YA CN  FR TF  +L+C
Sbjct:   23 WQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFL-SQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSE--GEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKD----CVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLC 435          
BLAST of Muscarinic acetylcholine receptor vs. UniProt/SwissProt
Match: sp|Q5R949|ACM1_PONAB (Muscarinic acetylcholine receptor M1 OS=Pongo abelii OX=9601 GN=CHRM1 PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.281e-53
Identity = 150/420 (35.71%), Postives = 221/420 (52.62%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL-GYATPVYGGAALKYNHRDN------------------------------------YKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPN---CQGNLMSHGLRQSVRXXX----XXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            +Q+    +   +LSLAT  GNLLVLISF +  +L+T++NY+LLSLA +D +IG  SM LY+T+L+M  W   +  CDLWL+LDY  SNAS  NL+LIS+DRY ++T PL+YR KR+PR+  ++I L W++  +LW P I  W  + G+RTV  G+CY+QF+ S  ++T  T    + +P+ ++     +IYR T  R + L  L G  TP  GG +   + R                                        +M+S T +E     P  + + K+    P +   T Q    S  T    T              G  Q  ++K        KAA+TL+AI++AF +TW PYN+  L++ + +      +   L+  GY+LCY+NSTINP+ YA CN  FR TF  +L+C
Sbjct:   23 WQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFL-SQPIITFGTAMAAFYLPVTVMCTLYWRIYRETESRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPGTPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSE--GEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKD----CVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLC 435          
BLAST of Muscarinic acetylcholine receptor vs. UniProt/SwissProt
Match: sp|P12657|ACM1_MOUSE (Muscarinic acetylcholine receptor M1 OS=Mus musculus OX=10090 GN=Chrm1 PE=1 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 3.390e-53
Identity = 147/420 (35.00%), Postives = 219/420 (52.14%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL-GYATPVYGGAALKYNHRDN------------------------------------YKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRXXX-------XXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            +Q+    +   +LSLAT  GNLLVLISF +  +L+T++NY+LLSLA +D +IG  SM LY+T+L+M  W   +  CDLWL+LDY  SNAS  NL+LIS+DRY ++T PL+YR KR+PR+  ++I L W++  +LW P I  W  + G+RTV  G+CY+QF+ S  ++T  T    + +P+ ++     +IYR T +R + L  L G  TP  GG +   + R                                        +M+S T +E     P  + + K+    P +   T Q    S  T    T             R   +             KAA+TL+AI++AF +TW PYN+  L++ + +      +   L+  GY+LCY+NST+NP+ YA CN  FR TF  +L+C
Sbjct:   23 WQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFL-SQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSE--GEEPGSEVVIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKD----CVPETLWELGYWLCYVNSTVNPMCYALCNKAFRDTFRLLLLC 435          
BLAST of Muscarinic acetylcholine receptor vs. UniProt/SwissProt
Match: sp|P16395|ACM1_DROME (Muscarinic acetylcholine receptor DM1 OS=Drosophila melanogaster OX=7227 GN=mAChR-A PE=2 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 5.143e-51
Identity = 100/236 (42.37%), Postives = 147/236 (62.29%), Query Frame = 1
Query:   85 ILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNR 792
            +++   +A ILS  T  GN++V+ISF I+ QL+TISNY+L SLA++DF IG ISMPL++   I+ +WP     CD WL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+  +  ++I   W I  LLW P IY WP I+GKRTVP+ +CY+QF+E++  +T  T    +  P+ I+     +I+R T+ R K+L              L+   +D+ K  +SS +  + N 
Sbjct:  104 MVVMGFVAAILSTVTVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIGAISMPLFAVTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNRAAVMIGAAWGISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYITFGTALAAFYFPVTIMCFLYWRIWRETKKRQKDLPN------------LQAGKKDSSKRSNSSDENTVVNH 327          
BLAST of Muscarinic acetylcholine receptor vs. TrEMBL
Match: A0A193KUE7 (GCR018 OS=Schmidtea mediterranea OX=79327 GN=gcr018 PE=2 SV=1)

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 396/398 (99.50%), Postives = 396/398 (99.50%), Query Frame = 1
Query:   34 MNNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILICGRSKSNT 1227
            MNNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKTIIIILLTWIICALLWTPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRKKPSSSKAAKTLAAIIIAFFVTWFPYNLFTLINLYSRSKSNPTIGTLLYGFGYYLCYLNSTINPI YAYCNIMFRRTFWRILICGR KSNT
Sbjct:    1 MNNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKTIIIILLTWIICALLWTPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRKKPSSSKAAKTLAAIIIAFFVTWFPYNLFTLINLYSRSKSNPTIGTLLYGFGYYLCYLNSTINPIWYAYCNIMFRRTFWRILICGRYKSNT 398          
BLAST of Muscarinic acetylcholine receptor vs. TrEMBL
Match: A0A3Q1BWW5 (Muscarinic acetylcholine receptor OS=Amphiprion ocellaris OX=80972 PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.118e-60
Identity = 152/418 (36.36%), Postives = 234/418 (55.98%), Query Frame = 1
Query:   37 NNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALK----------------------------YNHRDNYKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
             NET  D     P +Q+++  L+  +LSL T  GN+LV++SF +  QL+T++NY+LLSLAV+D +IG+ISM LY+ +L+M +W   +  CDLWL++DY  SNAS  NL++IS+DRY ++T PLTYR KR+ ++  I+I L W +  +LW P I +W  I G+RTVP  +CY+QF+ S  ++T  T    + +P+ I+ V   +IY+ T++R+K L  L   +   GG   K                             ++ D++ N D++   + S  +  E C  K    Q       P +   +++    +     Q   ++   R S+       KAA+TL+AI++AF +TW PYN+  LIN + +      I   L+  GY+LCY+NST+NP+ YA CN  FR TF  IL+C
Sbjct:   14 GNETVLDSLGGHPVWQVVLIVLLTGMLSLVTIIGNILVVVSFKVNRQLKTVNNYFLLSLAVADLIIGVISMNLYTAYLVMGYWAMGNWACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGIMIGLAWFVSLVLWAPAILLWKYIKGERTVPPDECYIQFL-SEPIITFCTAMAAFYLPVTIMSVLYWRIYKETQNRSKELAGL-QGSGARGGTGEKGQNNGGERADFVRQTGSSRSCSSYELTRLSNSDSWNNNDAAISLDQSGSSEDEDCGGKEMISQTTKSPSVPLSFKEAAMAKRFAARARTQ---ITKRKRMSL---VKEKKAAQTLSAILLAFIITWTPYNIMVLINAFCKV----CIPETLWAVGYWLCYVNSTVNPMCYALCNKTFRTTFKMILLC 419          
BLAST of Muscarinic acetylcholine receptor vs. TrEMBL
Match: A0A3S0ZH40 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_017501 PE=3 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 8.017e-58
Identity = 106/239 (44.35%), Postives = 167/239 (69.87%), Query Frame = 1
Query:   82 QILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKN---LQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISN 789
            ++++ S++ T+L++ T+ GNLLV+++F I+  L+T+SNY+LLSLAV+D  IGI+SMPLY+ +L+M +WP  +  CD+WLSLDYT+SNAS ANL++IS DRY ++T PLTYR KR+PR+   +I   W+I +++WTP I+ WP I+GKR+VP  +CY+QF+ ++  +T++T    + IP+ I+ V   QIYR T+ R K+   LQ +   +        +  H+ + K+M SS +   S+
Sbjct:   12 EVVLISIVVTLLAIVTSGGNLLVIVAFKIDKNLQTVSNYFLLSLAVADLTIGIVSMPLYTVYLLMGYWPLKAIMCDIWLSLDYTMSNASVANLIIISVDRYLSVTRPLTYRAKRTPRRAATMIGFAWVISSVMWTPWIFAWPKIEGKRSVPDNECYIQFLTTNQYITVITAMFAFYIPVIIMSVLYFQIYRETQKRQKDLPKLQGMHKKSKKLKQHPHQPGHQASKKSMASSDEEAQSS 250          

HSP 2 Score: 62.003 bits (149), Expect = 1.987e-6
Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 1
Query: 1009 FFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            F +TW PYN+F ++ ++     N TI  + Y   Y     NSTINP+ YA CN+ FRRTFWRIL C
Sbjct:  666 FIITWTPYNIFAVVKVFCNGCVNETIYAIGYWMCYI----NSTINPLCYALCNVNFRRTFWRILTC 727          
BLAST of Muscarinic acetylcholine receptor vs. TrEMBL
Match: T1EHX8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Helobdella robusta OX=6412 GN=20196178 PE=3 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.043e-57
Identity = 162/404 (40.10%), Postives = 239/404 (59.16%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQF-WPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWP-IIDGKRTVPQGKCYVQFMESST----LLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPV---YGGAALKYNHRDNY--------KNMDSSTDTEISNRNPKEKCIKK---VHKFQPNSLILTPQNLNY---SSVTSSNSTIPNCQGNLMSHGLRQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILICGRSKS 1221
            Y+I + S+I   ++LAT  GNLLV+ISF IE QLRTISN +LLSLAV+D  IG+ S+PLYS +L++ + WP     CD+WLSLDYT+SNAS ANL+LIS+DRY ++T PLTYR  R+P K  I+I L WII  LLWTP I IWP + + KR+  +  CY+ F+++++    +LT +T    + IP+F++ +   +IYR T  R K    L    P        +   N  DN+        +    +   +I N    +  I++    ++ +P  + + P++L     + + + +    N  G + S   +   ++     KAAKTL+AI++AF +TW PYN+F L+  +     +PT+    Y  GY+LCYLNSTINP+ YA CN +FR +F RIL C   K+
Sbjct:    1 YKITLLSIIIICIALATTGGNLLVMISFKIEPQLRTISNCFLLSLAVADITIGLFSIPLYSMYLLLGYNWPLGLFVCDVWLSLDYTMSNASVANLLLISFDRYFSVTRPLTYRAHRTPVKAGIMIALAWIISILLWTPWIMIWPRVSEEKRS--KNDCYIAFLDNTSTGGIVLTFVTAFGAFFIPVFVMCILYFKIYRETEKRKKTFVGLLGGDPGTKDKSNDSYDRNKEDNFNKENILQNRTKQINQTNKIDNNGHNQSLIRQKSNENETKPQKIPIIPRHLFTKMPNKIVAHDKISTNKFGTISSQTRK---KRTGQDQKAAKTLSAILLAFIITWTPYNIFVLVQAFFPCAIHPTL----YAVGYWLCYLNSTINPVCYALCNELFRSSFLRILRCQWRKT 395          
BLAST of Muscarinic acetylcholine receptor vs. TrEMBL
Match: V3ZKL6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_134322 PE=3 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.129e-57
Identity = 136/365 (37.26%), Postives = 217/365 (59.45%), Query Frame = 1
Query:   52 PDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNP-KEKCIK--KVHK--------------FQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRXXX-XXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKS--NPTI 1086
            P  ++     +++I S +  +LSL TA GNLLV+ +F I+ +L+T+SNY+LLSLAV+D  IG++SMPLY+ +L+M+ WP     CD+WLSLDYT+SNAS ANL++IS+DRY ++T PLTYR KR+P++   +I   W+I ALLWTP I+ WP I+GKR VP   CY+QF++++  +T++T    + +P+ I+ +   +IYR TR R K+L  L             Y    + ++  +   + + +RN  K KC+   K+ +                 N+ ++     +Y  V++S S   +   ++     ++  ++      KAAKTL AI++AF +TW PYN+FT++  Y  +    NPT+
Sbjct:   81 PGEYVPRSTLEVVIISFLVVLLSLMTAGGNLLVIWAFKIDRRLQTVSNYFLLSLAVADISIGVVSMPLYTVYLLMEHWPLGPLLCDIWLSLDYTMSNASVANLIIISFDRYLSVTRPLTYRAKRTPKRAGWMIGCAWVISALLWTPWIFAWPYIEGKRRVPHDDCYIQFLKTNQYITIITAMAAFYVPVSIMTIIYYKIYRETRKRQKDLVGLQ-----------GYWSLSDKRSPSTELSSYLRHRNSCKRKCLSCFKIDRDSDAEESSSSDQPPSPGNTNVIVSDCHSYIPVSTSESMARSPSNHIPKTSFKRVKKETIRQDQKAAKTLTAILLAFIITWTPYNIFTIVEAYCTNPPCINPTL 434          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Cavefish
Match: chrm3b (cholinergic receptor, muscarinic 3b [Source:ZFIN;Acc:ZDB-GENE-090410-5])

HSP 1 Score: 191.43 bits (485), Expect = 7.617e-56
Identity = 142/386 (36.79%), Postives = 220/386 (56.99%), Query Frame = 1
Query:   85 ILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTE------ISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILICGRSKSN 1224
            ++I  L+   LSL T  GN+LVL+SF +  QL+T++NYYLLSLA +D +IG++SM LY+T+LIM  W   +  CDLWL++DY  SNAS  NL++IS+DRY ++T PLTYR KR+ ++ + +I L W I  +LW P I  W    G+RTV  G+CY+QF+ S  ++T  T    + +P+ I+ V   +IY+ T +R+K+L  L   +   G    + N  +    M  +  +       + +++  E+  +      P S   +P ++  ++     ++    Q N      ++         KAA+TL+AI+ AF +TW PYN+  L+N +     +  I   L+  GY+LCY+NST+NP+ YA CN  FR TF  IL+C   K  
Sbjct:   26 VIIIVLLTGSLSLVTIIGNILVLVSFKVNKQLKTVNNYYLLSLAFADLIIGVLSMNLYTTYLIMGKWALGNWACDLWLAIDYVASNASVMNLLVISFDRYFSVTRPLTYRAKRTTKRAMTMIGLAWSISFVLWAPAILFWQFFVGERTVLPGECYIQFL-SEPIITFCTAIAAFYLPVTIMTVLYWRIYKETENRSKDLAGLK-GSGNQGKQGNQGNQEEATAMMPPTGTSRHFRFWMLGHKSGGEEEEECAESSSPAS--KSPLSIKDTAAAKRFASKAKTQAN------KRKKMSLVKEKKAAQTLSAILFAFIITWTPYNIMVLVNTF----CDDCIPATLWALGYWLCYVNSTVNPMCYALCNKTFRTTFKMILLCQWDKQK 397          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Cavefish
Match: chrm1a (cholinergic receptor, muscarinic 1a [Source:ZFIN;Acc:ZDB-GENE-090410-9])

HSP 1 Score: 177.563 bits (449), Expect = 1.013e-50
Identity = 130/395 (32.91%), Postives = 216/395 (54.68%), Query Frame = 1
Query:   34 MNNETN--PDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKCIKK--VHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            ++N TN   +P      +++ + +LI   LS+ T  GN+LV++SF +   LRT+SNY+LLSLAV+D ++G ISM LY+T++++  W   +  CD+WL++DY  SNAS  NL+ IS+DRY ++T PLTYR  R+ ++  ++I L W +  +LW P I  W  I G+RTV + +C +QF+ S  ++T  T    + +P+ +++    ++YR T  R++ L   G      G     +N   N   +      E S+R  +E  +K   + +F  +   +     + S   +  S  P     +      +++             +AI++AF VTW PYN+  L++ +     +  +   L+  GY+LCY+NST+NP+ YA CN  FR TF  +L+C
Sbjct:   10 LSNVTNDTAEPAGGPITWRMAMITLITVPLSVITIIGNILVIVSFRVNPLLRTVSNYFLLSLAVADLILGTISMNLYTTYILLGRWTLGNLACDVWLAVDYVASNASVMNLLAISFDRYLSVTRPLTYRASRTTKRAALMISLAWGVSFILWAPAILFWQHIVGERTVAEDQCSIQFL-SEPVITFGTAIAAFYLPVCVMVALYWKVYRETEKRSQQLA--GLMASRGGDTKKPWNDCINAYKLG-----ETSSRGEEEVSLKLDFMDQFHQHFSTMDTPGSSLSQTRAQRSRKPRSWSLVREKKAARTL-------------SAILLAFIVTWTPYNIMVLVSTF----CDDCVPEGLWQLGYWLCYVNSTVNPVCYALCNKQFRVTFKALLLC 379          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Cavefish
Match: chrm5a (muscarinic acetylcholine receptor M5 [Source:NCBI gene;Acc:103025843])

HSP 1 Score: 176.022 bits (445), Expect = 4.703e-49
Identity = 97/235 (41.28%), Postives = 149/235 (63.40%), Query Frame = 1
Query:   76 FYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTE 780
             ++++  + ++ I+SL T  GN+LV++SF +  QL+T++NYYLLSLA +D +IG+ SM LY+++++M +W   S  CDLWL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+PR+  I+I L W++  +LW P I  W    GKRTVP+ +C +QF  S  ++T  T    + IP+ ++ +   +IY+ T  R K+L  L              NH     + DS+TDT+
Sbjct:   25 LWEVITIATVSAIVSLITIIGNVLVMVSFKVNSQLKTVNNYYLLSLAFADLIIGVFSMNLYTSYILMGYWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPRRAGIMIGLAWLVSFVLWAPPILCWQYFVGKRTVPERQCQIQFF-SEPVITFGTAIAAFYIPVSVMTILYCRIYKETERRTKDLAELQ-----------GVNH-----STDSTTDTK 242          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Cavefish
Match: ENSAMXT00000026803.2 (pep primary_assembly:Astyanax_mexicanus-2.0:3:12526447:12529953:-1 gene:ENSAMXG00000026077.2 transcript:ENSAMXT00000026803.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.17 bits (435), Expect = 1.030e-47
Identity = 98/260 (37.69%), Postives = 155/260 (59.62%), Query Frame = 1
Query:   55 DPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGK----CYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKN-MDSSTDTEISNRNPKEKCIKK 819
            DP    P +++++  L+   LS  T  GNLLV+ISF +  QLRTISNYYLLSLAV+D ++G +SM LY+ ++I   W      CDLWL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+P++  ++I L W++   LW P I +WP +DGK+   + +    C + F+ +   LT  T    + +P+ I+I+   +IY    +R K L     +     G ++K + R +++N   SS ++ +   + K + + +
Sbjct:   24 DPLGGHPIWEVVLIVLVTGPLSFITILGNLLVVISFRVNSQLRTISNYYLLSLAVADLILGTVSMNLYTAYIIKGQWMLGHLACDLWLALDYVASNASVMNLLVISFDRYFSVTRPLTYRAKRTPKRAAVLITLAWVVSFALWAPAILLWPHVDGKQPGEEDEEVKDCSIPFL-AVPPLTFGTAIAAFYLPVSIMIILYWRIYWEIENRAKGLAKFVGSVSSSAGNSIKEDKRPSHQNSAQSSLNSSMERHSEKHQGVTR 282          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Cavefish
Match: chrm5b (cholinergic receptor, muscarinic 5b [Source:ZFIN;Acc:ZDB-GENE-041001-169])

HSP 1 Score: 171.4 bits (433), Expect = 1.798e-47
Identity = 87/211 (41.23%), Postives = 140/211 (66.35%), Query Frame = 1
Query:   76 FYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPV 708
             ++++  + ++ ++SL T  GN+LV++SF +  QL+T++NYYLLSLA +D +IG+ SM LY+++++M +W   +  CDLWL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+P++  I+I + W++  +LW P I  W    G+RTVP  +C +QF  S  ++T  T    + IP+ ++ +   +IY+ T  R K+L  L   T V
Sbjct:   15 LWEVITIATVSAVVSLITIVGNILVMLSFKVNSQLKTVNNYYLLSLAFADLIIGVFSMNLYTSYIVMGYWALGNLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGMAWLVSFVLWAPPIICWQYFVGERTVPPDQCQIQFF-SEPVITFGTAIAAFYIPVSVMTILYCRIYKETEKRTKDLAELQGLTSV 224          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Sea Lamprey
Match: CHRM3 (cholinergic receptor muscarinic 3 [Source:HGNC Symbol;Acc:HGNC:1952])

HSP 1 Score: 171.014 bits (432), Expect = 6.093e-48
Identity = 87/212 (41.04%), Postives = 138/212 (65.09%), Query Frame = 1
Query:   55 DPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
            DP       ++++   +  I+SL T  GN+LV+++F +  QL+T++NY+LLSLAV+D +IG++SM LY+T++IM  W      CDLWL +DY  SNAS  NL++IS+DRY ++T PL Y+ KR+ ++  ++I L W++  +LW P I  W  +DGKRTVP  +C++QF+ S   +T  T    + +P+ I++V   +IY  T+ R + L  L
Sbjct:    2 DPLGGHTVLEVIVIGTLTGIVSLLTIVGNILVMVAFKVNRQLKTVNNYFLLSLAVADLIIGVVSMNLYTTYIIMSRWALGQAACDLWLVVDYVASNASVMNLLVISFDRYLSITRPLKYKAKRTTKRVALMIGLAWVVSLVLWGPAILFWQYVDGKRTVPDNECFIQFL-SVPAITFGTAIAAFYLPVTIMMVLYWRIYLETQKRTRELAGL 212          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Sea Lamprey
Match: CHRM3 (cholinergic receptor muscarinic 3 [Source:HGNC Symbol;Acc:HGNC:1952])

HSP 1 Score: 169.474 bits (428), Expect = 2.672e-47
Identity = 90/212 (42.45%), Postives = 137/212 (64.62%), Query Frame = 1
Query:   55 DPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
            DP       +++   L   ++SLAT  GN+LVL+SF +  QL T++NYYLLSLAV+D +IGI SM L++ ++IM  W   S  CDLWL+LDY  SNAS  NL++IS+DR+ ++T PLTYR KR+P +  ++I L W++  +LW P I  W  I G+RTVP  +C +QF+ S  ++T  T    + +P+ I+     +I++  ++R ++L  L
Sbjct:   50 DPLGGHSVLEVVGIGLFTGVMSLATIVGNVLVLVSFKVNKQLHTVNNYYLLSLAVADLIIGIFSMNLFTCYMIMGHWALGSLACDLWLALDYVASNASVMNLLVISFDRFFSITRPLTYRAKRTPHRAALLIGLAWVVSFVLWAPAILFWQYIVGERTVPPDECRIQFL-SEPIITFCTAIAAFYLPVTIMATIYWRIFKEIQNRARDLAML 260          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Sea Lamprey
Match: chrm5b (cholinergic receptor, muscarinic 5b [Source:ZFIN;Acc:ZDB-GENE-041001-169])

HSP 1 Score: 164.081 bits (414), Expect = 1.737e-45
Identity = 87/193 (45.08%), Postives = 128/193 (66.32%), Query Frame = 1
Query:  112 ILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
            + SL T  GN LV++SF +  QL+T+SNY+LLSLA +D ++G+ SM LY+ +++   W   +  CDLWL+LDY  SNAS  NL+ IS+DRY ++T PL Y+ KR+ R+  I+I L W +  +LW P I  W  + GKRTVPQ +CY+QF+ S  ++T  T    + +P+ I++V   +IYR TR R++   TL
Sbjct:   39 MFSLITVVGNTLVMLSFRVSRQLKTVSNYFLLSLAAADLIVGLFSMNLYTAYILTGRWAMGAVMCDLWLTLDYVASNASVMNLLAISFDRYFSITRPLKYKAKRTKRRASIMIGLAWAVSLVLWAPAILFWQHMVGKRTVPQDQCYIQFL-SEPIITFGTAIAAFYLPITIMMVLYWRIYRETRRRSRQFATL 230          

HSP 2 Score: 46.595 bits (109), Expect = 8.908e-6
Identity = 30/66 (45.45%), Postives = 43/66 (65.15%), Query Frame = 1
Query: 1009 FFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
            F VTW PYN+  L++ +     +  +   L+  GY+LCY+NST+NP+ YA CN+ FR+TF  IL C
Sbjct:  457 FIVTWTPYNIMVLVSTFC----DDCVPKKLWHLGYWLCYVNSTVNPMCYALCNMHFRKTFKTILSC 518          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Sea Lamprey
Match: chrm4a (cholinergic receptor, muscarinic 4a [Source:ZFIN;Acc:ZDB-GENE-090410-6])

HSP 1 Score: 125.946 bits (315), Expect = 5.354e-32
Identity = 76/185 (41.08%), Postives = 116/185 (62.70%), Query Frame = 1
Query:  115 LSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHR 669
            LSL T  GN LV+IS C+  +L+T+++Y++ SLA +D +IG  SM +Y+ ++    WP  +  CDLWLS+DY  SNAS  NL++IS DR+  ++ P TY  +R+ R   I+I   W++  LLW P I +W  ++G RTVPQ  CY+QF  S+   TL T    + +P+ ++ +  + I R +R R
Sbjct:   44 LSLLTVLGNALVIISICVNRRLQTVNSYFIFSLACADLIIGAFSMNVYAVYVWRGAWPLGAALCDLWLSIDYVASNASVMNLLIISCDRFLCVSRPHTYPARRTARAAAIVIAAAWLLSLLLWAPAIVLWQFVEGVRTVPQDACYIQFF-SNPAATLGTAIAAFYLPVAVMCILYLYILRASRCR 227          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 8.654e-18
Identity = 60/200 (30.00%), Postives = 107/200 (53.50%), Query Frame = 1
Query:   88 LIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHR-NKNLQ 684
            +I SL  T L L    GN  V+ +  +E  L+ ++NY + SLAV+D L+ I+ +P+ + + ++  W      CD++++LD     +S  +L +I+ DRY  +T P+ Y  KR+PR+ +I+I LTW++   +  P +  W   +  R  P   C +      T+ +       + IPL +++V   +I+R  R R  KN++
Sbjct:   37 VISSLCLTALILCAIFGNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGWRTPE-DRADPNA-CKISQDHGYTIYSTFG---AFYIPLILMLVLYSRIFRAARFRIRKNVK 231          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Nematostella
Match: EDO35211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM55])

HSP 1 Score: 88.5817 bits (218), Expect = 1.311e-19
Identity = 59/209 (28.23%), Postives = 104/209 (49.76%), Query Frame = 1
Query:   85 ILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWP---IIDGKR----TVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
            +++ S +  +L + T  GN LV  +F +   LRT++NY+++SLA++D L+G +SMPL+ T+L+ Q+ P NS    LWL  D   + AS  NL +IS DR+  +T P  Y  K + ++  +               ++++W     +   R     +P  +   QF   S   T       + +PL ++I    +I+ V R +   ++ L
Sbjct:    1 VVLASGLLALLIVGTIFGNSLVCAAFYLFRDLRTVTNYFVVSLAIADLLVGFVSMPLWFTYLVFQWPPQNSEIYALWLCFDIATATASIMNLAVISVDRFYAITLPFQYSQKITKKRACLA--------------IVFVWLYAFAVSSSRAISFAIPSRESRAQF---SFGYTFFVATASFFVPLPVMIYCYTRIFSVARVQAAKIREL 192          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Nematostella
Match: EDO40999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M0])

HSP 1 Score: 78.9518 bits (193), Expect = 4.221e-16
Identity = 45/102 (44.12%), Postives = 62/102 (60.78%), Query Frame = 1
Query:  136 GNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMP--LYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCK-RSPR 432
            GNLLV ++     +LR+++NY + SLAVSD L+  +SMP  +Y T  +M  W    + C  W+ +D   S AS  NL LI+ DRY  L+CP +YR K R PR
Sbjct:   47 GNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMC-WDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPR 147          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Nematostella
Match: EDO28603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T607])

HSP 1 Score: 78.5666 bits (192), Expect = 5.128e-16
Identity = 45/102 (44.12%), Postives = 62/102 (60.78%), Query Frame = 1
Query:  136 GNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMP--LYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCK-RSPR 432
            GNLLV ++     +LR+++NY + SLAVSD L+  +SMP  +Y T  +M  W    + C  W+ +D   S AS  NL LI+ DRY  L+CP +YR K R PR
Sbjct:   36 GNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMC-WDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPR 136          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Nematostella
Match: EDO47619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLK3])

HSP 1 Score: 75.8702 bits (185), Expect = 1.321e-15
Identity = 55/192 (28.65%), Postives = 94/192 (48.96%), Query Frame = 1
Query:  109 TILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQ-FWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNL 681
             +L + T  GN+LV  SF +  +LRTI NY+++SL+ +D L+ +++MP +    +    W F       W  +D     AS  NL+ +S DR+  +T P  Y    SP K  + I+  W+    +    +  WP   GK    QGK Y+     ++          +L PL +++V  ++IY V R++ + +
Sbjct:    7 AMLIVFTLIGNVLVCASFALFRELRTICNYFVVSLSAADILVALLAMPFWCALQVTSNMWMFGLELQLFWSCMDILCGTASIMNLMAVSIDRHIAITMPFYYETVMSPIKAKLTIMFVWLYAITISCLRLVQWP---GK----QGKVYMNIAAFAS----------FLCPLTVMVVMYLRIYLVARYQVRRI 181          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Nematostella
Match: EDO35450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLG6])

HSP 1 Score: 76.6406 bits (187), Expect = 1.432e-15
Identity = 56/194 (28.87%), Postives = 98/194 (50.52%), Query Frame = 1
Query:  130 ACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMP--LYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXX-XXXXXXXXXPLIYIWPIIDGKRTVP----QGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
             CGNLLV  +     +LRT++NY+++SLAVSD L+  +SMP  ++ T   M  W    + C+ W+ +D   S+AS  NL +IS DR+  L+ PLTY    + R+ ++ I +       +        W      + +P    + K Y  F+ +          +G+ +PL ++++    +++V  H+ + LQ L
Sbjct:   24 VCGNLLVCGAILSYRRLRTVTNYFIISLAVSDLLVAGLSMPFRIHHTLHSMC-WDLGISVCEFWIFVDLVCSSASICNLSMISVDRFLALSYPLTYPSIMTKRRGLLAIAMVWGYSLLISALSFTLPWSPDGLMQDIPACSLKDKYYYTFVIT----------VGFFLPLVVLVIAYSLVFKVALHQARKLQLL 206          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Medaka
Match: ENSORLT00000036897.1 (muscarinic acetylcholine receptor M1-like [Source:NCBI gene;Acc:101171981])

HSP 1 Score: 190.274 bits (482), Expect = 6.747e-55
Identity = 148/415 (35.66%), Postives = 224/415 (53.98%), Query Frame = 1
Query:   79 YQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNL-------------QTLGYATPVYGGAALKYNHRDNYKNMD----SSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGL-------------RQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC---GRSKSN 1224
            Y ++I   +   LS+ T  GN+LVLISF I   L+T++NYYLLSLA +D +IG +SM LY+T++IM  W      CDLWL++DY  SNAS  NL++IS+DRY ++T PLTYR KR+ ++T+ +I L W I  +LW P I  W  + G+RTVP  +CY+QF+ +  + T  T    + +P+ ++     +IY+ T  R K++             QT+   +   G  ++K N R+    +     SS+        P EK +++             +        +S+S +P     +    L             +    KK +  KAA+TL+AI++AF +TW PYN+  LIN + ++     I   L+  GY+LCY+NST+NP+ YA CN  FR TF  IL+C   GR K +
Sbjct:   40 YVVIIIVFLTGSLSVITVVGNILVLISFKINKTLKTVNNYYLLSLAFADLIIGTLSMNLYTTYIIMGHWALGPVLCDLWLAIDYVASNASVMNLLIISFDRYFSVTRPLTYRAKRTTKRTMAMIGLAWSISFVLWAPAILFWQYVVGERTVPPEECYIQFL-TEPVTTFCTAIAAFYLPVTVMAFLFWKIYQETEKRAKDIQSLKGSCASTNLNQTVSEMSEGVGEGSIKSNQRNTSVKLHLVRTSSSRKLCHQDGPFEKSVEEEENKDLEQTSTIKRQHGSPLFKASSSNLPGLTMTIKDAALAKRFALRAKPEINKHKNEKKANEKKAARTLSAILLAFMMTWLPYNIMVLINTFCQN----CIPEALWALGYWLCYVNSTVNPMCYALCNKTFRTTFRAILMCQWNGRKKPH 449          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Medaka
Match: ENSORLT00000022971.2 (muscarinic acetylcholine receptor M1-like [Source:NCBI gene;Acc:101171981])

HSP 1 Score: 184.496 bits (467), Expect = 6.966e-53
Identity = 150/422 (35.55%), Postives = 231/422 (54.74%), Query Frame = 1
Query:   85 ILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNL-------------QTLGYATPVYGGAALKYNHRDNYKNMD---SSTDTEISN-----RNPK----EKCIKKVHKFQPNSLILT---PQNLNYSSVTSSNSTIPNCQGNLMSHGL-------------RQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC---GRSK 1218
            ++I   +   LS+ T  GN+LVLISF I   L+T++NYYLLSLA +D +IG +SM LY+T++IM  W      CDLWL++DY  SNAS  NL++IS+DRY ++T PLTYR KR+ ++T+ +I L W I  +LW P I  W  + G+RTVP  +CY+QF+ +  + T  T    + +P+ ++     +IY+ T  R K++             QT+   +   G  ++K N R+    +    +S+  ++ +     R+P+    +K  K V + +   L  T    +        +S+S +P     +    L             +    KK +  KAA+TL+AI++AF +TW PYN+  LIN + ++     I   L+  GY+LCY+NST+NP+ YA CN  FR TF  IL+C   GR K
Sbjct:   14 VIIIVFLTGSLSVITVVGNILVLISFKINKTLKTVNNYYLLSLAFADLIIGTLSMNLYTTYIIMGHWALGPVLCDLWLAIDYVASNASVMNLLIISFDRYFSVTRPLTYRAKRTTKRTMAMIGLAWSISFVLWAPAILFWQYVVGERTVPPEECYIQFL-TEPVTTFCTAIAAFYLPVTVMAFLFWKIYQETEKRAKDIQSLKGSCASTNLNQTVSEMSEGVGEGSIKSNQRNTSVKLHLVRTSSSRKLCHQDGPARDPRGSDFDKFEKSVEEEENKDLEQTSTIKRQHGSPLFKASSSNLPGLTMTIKDAALAKRFALRAKPEINKHKNEKKANEKKAARTLSAILLAFMMTWLPYNIMVLINTFCQN----CIPEALWALGYWLCYVNSTVNPMCYALCNKTFRTTFRAILMCQWNGRKK 430          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Medaka
Match: chrm5b (cholinergic receptor, muscarinic 5b [Source:ZFIN;Acc:ZDB-GENE-041001-169])

HSP 1 Score: 180.644 bits (457), Expect = 3.323e-51
Identity = 143/435 (32.87%), Postives = 234/435 (53.79%), Query Frame = 1
Query:   76 FYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL--------------GYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRN----------------------------------PKEKCIKK--VHKFQPNS--------LILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILIC 1206
             ++++  + ++ I+SL T  GN+LV++SF +  QL+T++NYYLLSLA +D +IG++SM LY+T+++M +W   +  CDLWL++DY  SNAS  NL++IS+DRY ++T PLTYR KR+P++  I+I L W+I  +LW P I  W    G+R VP  +C +QF+ +  ++T  T    +  P+ ++ +   +IY+ T+ R K+L  L                AT     +   +   D   +++S T +E    +                                  P++K  +K   +KF+P S            P+ L  ++  SS+++ P     L +   ++         KAA+TL+AI++AF +TW PYN+  LI+ +        I T L+  GY+LCY+NSTINP+ YA CN  F++TF  +L+C
Sbjct:   19 LWEVITIATVSAIVSLITIIGNMLVMLSFKVNSQLKTVNNYYLLSLAFADLIIGVLSMNLYTTYILMGYWSLGNLACDLWLAVDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAAIMIGLAWLISFVLWAPPILCWQYFVGERKVPTDQCQIQFL-TEPVITFGTAIAAFYFPVSVMTILYCRIYKETQKRTKDLAELQGNQNQASWSSSNQSNATRTTSRSDDSWAKVDQITSLNSYTSSEEEEHHISKDTPQGSFKEQQGQSSTNGQAPDLTEDQYFSSPQKKSQRKSISYKFKPGSKGKSPASPAPHPPEQLEKNASPSSSTSKP-MDTALKNQITKRKRMVLVKEKKAAQTLSAILLAFILTWTPYNIMVLISTFCAD----CIPTSLWHLGYWLCYVNSTINPMCYALCNKTFQKTFRMLLLC 447          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Medaka
Match: chrm3a (muscarinic acetylcholine receptor M3 [Source:NCBI gene;Acc:101164585])

HSP 1 Score: 181.8 bits (460), Expect = 1.957e-50
Identity = 96/212 (45.28%), Postives = 143/212 (67.45%), Query Frame = 1
Query:   55 DPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
            DP    P +Q+++  L+   LSL T  GN+LV++SF +  QL+T++NY+LLSLAV+D +IGIISM LY+++LIM +W   +  CD+WL++DY  SNAS  NL++IS+DRY ++T PLTYR KR+ R+  I+I L W +  +LW P I +W    G+RTVP  +CY+QF  S  + T  T    + +P+ I+ V   +IY+ T++R+K L  L
Sbjct:   67 DPLGGHPVWQVVLIVLLTGTLSLVTIIGNILVVVSFKVNRQLKTVNNYFLLSLAVADLIIGIISMNLYTSYLIMGYWAMGNWACDIWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTRRAGIMIGLAWFVSFVLWAPAILLWQYFVGERTVPPNECYIQFF-SEPITTFCTAMAAFYLPVTIMSVLYWRIYKETQNRSKELAGL 277          
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Medaka
Match: chrm5a (muscarinic acetylcholine receptor M5 [Source:NCBI gene;Acc:101169892])

HSP 1 Score: 175.252 bits (443), Expect = 8.179e-49
Identity = 89/205 (43.41%), Postives = 139/205 (67.80%), Query Frame = 1
Query:   76 FYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTL 690
             ++++  + ++ I+S+ T  GN+LV++SF +  QL+T++NYYLLSLA +D +IG+ SM LY+++++M +W   S  CDLWL+LDY  SNAS  NL++IS+DRY ++T PLTYR KR+PR+  I+I L W++  +LW P I  W    GKRTVP+ +C +QF  S  ++T  T    + IP+ ++ +   +IY+ T  R K+L  L
Sbjct:   25 LWEVITIATVSAIVSIITIVGNILVMLSFKVNSQLKTVNNYYLLSLAAADLIIGVFSMNLYTSYILMGYWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPRRAAIMIGLAWLVSLILWAPPILCWQYFVGKRTVPERQCQIQFF-SEPVITFGTAIAAFYIPVSVMTILYCRIYKETEKRTKDLAEL 228          
BLAST of Muscarinic acetylcholine receptor vs. Planmine SMEST
Match: SMESG000081829.1 (SMESG000081829.1)

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 398/398 (100.00%), Postives = 398/398 (100.00%), Query Frame = 1
Query:   34 MNNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRXXXXXXXXXXXXXXXXXXFFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILICGRSKSNT 1227
            MNNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKTIIIILLTWIICALLWTPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRKKPSSSKAAKTLAAIIIAFFVTWFPYNLFTLINLYSRSKSNPTIGTLLYGFGYYLCYLNSTINPILYAYCNIMFRRTFWRILICGRSKSNT
Sbjct:    1 MNNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKTIIIILLTWIICALLWTPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSHGLRQSVRKKPSSSKAAKTLAAIIIAFFVTWFPYNLFTLINLYSRSKSNPTIGTLLYGFGYYLCYLNSTINPILYAYCNIMFRRTFWRILICGRSKSNT 398          
BLAST of Muscarinic acetylcholine receptor vs. Planmine SMEST
Match: SMESG000033753.1 (SMESG000033753.1)

HSP 1 Score: 188.734 bits (478), Expect = 1.929e-54
Identity = 102/212 (48.11%), Postives = 147/212 (69.34%), Query Frame = 1
Query:   34 MNNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHR 669
            +NN T       L   +I+IYS ++ I+   T  GN+LV++ FC +  LR +SNY+L+SLAVSD  IG+ISMPLY+TFLI+  WPF++T C++WL++DYTVSNAS ANL +IS DRY ++  P++YR KR+ +K I  I+  W++ AL+W PLI + P++    ++P G+CYVQF+    +LT+L  ++ Y IP  II V  IQIYR T+ R
Sbjct:    2 LNNSTIISSPQKLNVTEIIIYSFLSFIVIFITIAGNILVIVGFCYKKSLRFLSNYFLISLAVSDLFIGVISMPLYTTFLILDKWPFSNTICNIWLTVDYTVSNASVANLFIISLDRYLSVKSPISYRIKRTNKKVIKWIICAWVVSALIWVPLINVIPVMFKSHSIPFGECYVQFLFFLPILTVLVSSLVYFIPTIIIAVLYIQIYRTTQTR 213          
BLAST of Muscarinic acetylcholine receptor vs. Planmine SMEST
Match: SMESG000018810.1 (SMESG000018810.1)

HSP 1 Score: 147.902 bits (372), Expect = 6.259e-39
Identity = 97/205 (47.32%), Postives = 137/205 (66.83%), Query Frame = 1
Query:  229 LIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKCIKKVHKFQPNS 843
            +IG++SMPLY+ +L++  WP     CDLWLS+DYT+SNAS ANL++IS DRY ++T PLTYR KR+ +K  I I + WII ALLWTPLIY+WPIIDGKR V   +CY+QF++SS LLTLLT ++ Y IP+ II +   +IYR T  R K L+ +        G  +K +++ +  +  S+     S  NP +  IKK++  + +S
Sbjct:    1 MIGLVSMPLYTGYLVVGEWPLPYYICDLWLSIDYTMSNASVANLLIISIDRYCSVTRPLTYRIKRTSKKVSIWIGIAWIISALLWTPLIYLWPIIDGKRHVKPKECYIQFIQSSYLLTLLTASLAYFIPVTIISILYFRIYRETNLRQKVLKKM-------HGLPIKTSYQSSNGSRCSNNHKNHSRENPFQNLIKKINSLRSSS 198          

HSP 2 Score: 62.003 bits (149), Expect = 4.086e-10
Identity = 42/73 (57.53%), Postives = 54/73 (73.97%), Query Frame = 1
Query: 1009 FFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILICGRSKSNT 1227
            FF+TW PYN+FT+IN +   ++ P IGT +Y  GY+LCYLNST+NP+LYA CN+ FR+TF  IL C  SK  T
Sbjct:  376 FFITWTPYNIFTVINAFYTVETQP-IGTTVYNLGYWLCYLNSTVNPLLYALCNVTFRKTFIAILTCSISKIRT 447          
BLAST of Muscarinic acetylcholine receptor vs. Planmine SMEST
Match: SMESG000018810.1 (SMESG000018810.1)

HSP 1 Score: 139.813 bits (351), Expect = 5.377e-36
Identity = 94/199 (47.24%), Postives = 131/199 (65.83%), Query Frame = 1
Query:  247 MPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEISNRNPKEKCIKKVHKFQPNS 843
            MPLY+ +L++  WP     CDLWLS+DYT+SNAS ANL++IS DRY ++T PLTYR KR+ +K  I I + WII ALLWTPLIY+WPIIDGKR V   +CY+QF++SS LLTLLT ++ Y IP+ II +   +IYR T  R K L+ +        G  +K +++ +  +  S+     S  NP +  IKK++  + +S
Sbjct:    1 MPLYTGYLVVGEWPLPYYICDLWLSIDYTMSNASVANLLIISIDRYCSVTRPLTYRIKRTSKKVSIWIGIAWIISALLWTPLIYLWPIIDGKRHVKPKECYIQFIQSSYLLTLLTASLAYFIPVTIISILYFRIYRETNLRQKVLKKM-------HGLPIKTSYQSSNGSRCSNNHKNHSRENPFQNLIKKINSLRSSS 192          

HSP 2 Score: 62.003 bits (149), Expect = 4.348e-10
Identity = 42/73 (57.53%), Postives = 54/73 (73.97%), Query Frame = 1
Query: 1009 FFVTWFPYNLFTLINLYSRSKSNPTIXXXXXXXXXXXXXXNSTINPILYAYCNIMFRRTFWRILICGRSKSNT 1227
            FF+TW PYN+FT+IN +   ++ P IGT +Y  GY+LCYLNST+NP+LYA CN+ FR+TF  IL C  SK  T
Sbjct:  370 FFITWTPYNIFTVINAFYTVETQP-IGTTVYNLGYWLCYLNSTVNPLLYALCNVTFRKTFIAILTCSISKIRT 441          
BLAST of Muscarinic acetylcholine receptor vs. Planmine SMEST
Match: SMESG000061178.1 (SMESG000061178.1)

HSP 1 Score: 131.339 bits (329), Expect = 2.721e-33
Identity = 82/210 (39.05%), Postives = 127/210 (60.48%), Query Frame = 1
Query:   34 MNNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLRTISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYTVSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKXXXXXXXXXXXXXXXXXPLIYIWPIIDG-KRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIVFAIQIYRVT 660
            M+N+ N   F +L     +  S+++T++S+ T  GN+LV+ SF +E +LRT SNY + SLAV+D +IG++SM +Y+T+L+++ WPF +  CDLWLSLDY+V   S   +  I+ DRY ++  P  Y   R  RK +III + W+I  L++  LI  W  I G K    +G+C+ +F  SS L  +L     + I L ++I   I IY + 
Sbjct:    1 MDNKLNA-TFFSLKLETKIFLSILSTLVSICTILGNVLVIFSFFVESKLRTSSNYLIASLAVTDLIIGLLSMNIYTTYLLLEIWPFGNFVCDLWLSLDYSVCLVSQYTVFTITMDRYFSVRIPAFYHNWRRERKMLIIIFVIWLIPVLIFFTLIMAWSKISGLKSNRKEGECFAEF-ASSPLFNILFTITYFWITLIVMIGIYIAIYSIA 208          
The following BLAST results are available for this feature:
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRM13.130e-5435.71cholinergic receptor muscarinic 1 [Source:HGNC Sym... [more]
CHRM13.384e-5435.71cholinergic receptor muscarinic 1 [Source:HGNC Sym... [more]
CHRM55.195e-5041.95cholinergic receptor muscarinic 5 [Source:HGNC Sym... [more]
CHRM55.195e-5041.95cholinergic receptor muscarinic 5 [Source:HGNC Sym... [more]
CHRM36.429e-4942.40cholinergic receptor muscarinic 3 [Source:HGNC Sym... [more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gar-31.422e-4335.40Muscarinic acetylcholine receptor gar-3 [Source:U... [more]
gar-31.422e-4335.40Muscarinic acetylcholine receptor gar-3 [Source:U... [more]
gar-31.095e-4236.47Muscarinic acetylcholine receptor gar-3 [Source:U... [more]
octr-14.106e-2327.95OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
gar-21.089e-2234.38Muscarinic acetylcholine receptor gar-2 [Source:U... [more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mAChR-A5.008e-5242.37gene:FBgn0000037 transcript:FBtr0072367[more]
mAChR-A5.131e-5242.37gene:FBgn0000037 transcript:FBtr0072368[more]
mAChR-B1.601e-2432.09gene:FBgn0037546 transcript:FBtr0344726[more]
mAChR-B5.688e-2435.85gene:FBgn0037546 transcript:FBtr0081789[more]
5-HT72.656e-2037.88gene:FBgn0004573 transcript:FBtr0334508[more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrm5a4.901e-5232.96cholinergic receptor, muscarinic 5a [Source:ZFIN;A... [more]
CR812847.12.070e-5035.16pep chromosome:GRCz11:CHR_ALT_CTG14_1_19:24256795:... [more]
chrm3a2.779e-5042.08cholinergic receptor, muscarinic 3a [Source:ZFIN;A... [more]
chrm1a6.221e-5035.52cholinergic receptor, muscarinic 1a [Source:ZFIN;A... [more]
chrm5b4.629e-4843.52cholinergic receptor, muscarinic 5b [Source:ZFIN;A... [more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRM14.432e-4843.40cholinergic receptor, muscarinic 1 [Source:NCBI ge... [more]
slitrk34.265e-4740.44SLIT and NTRK like family member 3 [Source:Xenbase... [more]
ENSXETT00000048394.12.944e-4541.74pep primary_assembly:Xenopus_tropicalis_v9.1:5:599... [more]
CHRM24.109e-4339.35cholinergic receptor, muscarinic 2 [Source:NCBI ge... [more]
krcc12.682e-3529.80lysine-rich coiled-coil 1 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrm14.846e-5435.00cholinergic receptor, muscarinic 1, CNS [Source:MG... [more]
Chrm14.846e-5435.00cholinergic receptor, muscarinic 1, CNS [Source:MG... [more]
Chrm37.583e-5042.20cholinergic receptor, muscarinic 3, cardiac [Sourc... [more]
Chrm37.583e-5042.20cholinergic receptor, muscarinic 3, cardiac [Sourc... [more]
Chrm28.687e-5032.28cholinergic receptor, muscarinic 2, cardiac [Sourc... [more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56489|ACM1_MACMU2.378e-5535.24Muscarinic acetylcholine receptor M1 OS=Macaca mul... [more]
sp|P11229|ACM1_HUMAN1.503e-5335.71Muscarinic acetylcholine receptor M1 OS=Homo sapie... [more]
sp|Q5R949|ACM1_PONAB2.281e-5335.71Muscarinic acetylcholine receptor M1 OS=Pongo abel... [more]
sp|P12657|ACM1_MOUSE3.390e-5335.00Muscarinic acetylcholine receptor M1 OS=Mus muscul... [more]
sp|P16395|ACM1_DROME5.143e-5142.37Muscarinic acetylcholine receptor DM1 OS=Drosophil... [more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUE70.000e+099.50GCR018 OS=Schmidtea mediterranea OX=79327 GN=gcr01... [more]
A0A3Q1BWW51.118e-6036.36Muscarinic acetylcholine receptor OS=Amphiprion oc... [more]
A0A3S0ZH408.017e-5844.35G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
T1EHX81.043e-5740.10G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
V3ZKL61.129e-5737.26G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrm3b7.617e-5636.79cholinergic receptor, muscarinic 3b [Source:ZFIN;A... [more]
chrm1a1.013e-5032.91cholinergic receptor, muscarinic 1a [Source:ZFIN;A... [more]
chrm5a4.703e-4941.28muscarinic acetylcholine receptor M5 [Source:NCBI ... [more]
ENSAMXT00000026803.21.030e-4737.69pep primary_assembly:Astyanax_mexicanus-2.0:3:1252... [more]
chrm5b1.798e-4741.23cholinergic receptor, muscarinic 5b [Source:ZFIN;A... [more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRM36.093e-4841.04cholinergic receptor muscarinic 3 [Source:HGNC Sym... [more]
CHRM32.672e-4742.45cholinergic receptor muscarinic 3 [Source:HGNC Sym... [more]
chrm5b1.737e-4545.08cholinergic receptor, muscarinic 5b [Source:ZFIN;A... [more]
chrm4a5.354e-3241.08cholinergic receptor, muscarinic 4a [Source:ZFIN;A... [more]
ENSPMAT00000009127.18.654e-1830.00pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352111.311e-1928.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409994.221e-1644.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286035.128e-1644.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476191.321e-1528.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354501.432e-1528.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036897.16.747e-5535.66muscarinic acetylcholine receptor M1-like [Source:... [more]
ENSORLT00000022971.26.966e-5335.55muscarinic acetylcholine receptor M1-like [Source:... [more]
chrm5b3.323e-5132.87cholinergic receptor, muscarinic 5b [Source:ZFIN;A... [more]
chrm3a1.957e-5045.28muscarinic acetylcholine receptor M3 [Source:NCBI ... [more]
chrm5a8.179e-4943.41muscarinic acetylcholine receptor M5 [Source:NCBI ... [more]
back to top
BLAST of Muscarinic acetylcholine receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081829.10.000e+0100.00SMESG000081829.1[more]
SMESG000033753.11.929e-5448.11SMESG000033753.1[more]
SMESG000018810.16.259e-3947.32SMESG000018810.1[more]
SMESG000018810.15.377e-3647.24SMESG000018810.1[more]
SMESG000061178.12.721e-3339.05SMESG000061178.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001335 ID=SMED30001335|Name=Muscarinic acetylcholine receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1350bp
CTAAATGCAAAACAAAACTATATTGAAAGATAAATGAATAATGAAACTAA
TCCTGATCCGTTTATGGCATTGCCATTTTATCAGATTCTGATCTATTCTT
TGATTGCAACTATTCTTAGTTTGGCCACAGCTTGTGGCAATCTTCTTGTT
CTCATTTCTTTTTGTATTGAAGGTCAGCTAAGGACAATTAGTAATTATTA
TCTTCTTTCTTTGGCCGTTTCAGACTTTCTTATTGGAATTATTTCAATGC
CACTTTATTCCACATTTCTTATTATGCAGTTCTGGCCATTTAATTCTACA
ACTTGTGATTTGTGGTTATCACTTGACTATACAGTATCGAATGCTTCATC
GGCAAATCTAGTTCTTATATCTTATGACCGATATAAAACCCTTACTTGTC
CATTGACGTATAGATGCAAAAGATCACCAAGAAAAACTATAATTATTATT
CTATTAACATGGATAATTTGTGCACTATTATGGACTCCCTTGATTTATAT
CTGGCCAATTATTGATGGAAAAAGAACAGTGCCACAGGGTAAATGTTATG
TGCAATTTATGGAATCCAGCACACTGCTAACTCTGCTCACCTGTGCAATT
GGATATTTAATACCTCTCTTTATCATCATTGTTTTCGCAATACAAATATA
TCGCGTAACTCGGCATCGAAATAAAAATCTTCAAACTTTAGGTTACGCGA
CTCCGGTTTATGGAGGAGCAGCTTTGAAATACAATCATCGAGACAATTAT
AAGAACATGGATTCTTCGACCGACACTGAAATCAGTAATAGAAATCCAAA
AGAAAAATGTATTAAAAAAGTTCACAAATTTCAACCGAATTCTCTTATTC
TCACTCCACAAAATTTAAATTATTCGAGTGTCACTTCAAGCAATTCAACA
ATACCAAATTGTCAAGGTAATTTGATGAGCCATGGACTAAGACAGTCAGT
GCGAAAAAAGCCTTCCTCTAGCAAAGCCGCCAAAACTCTTGCAGCAATAA
TCATTGCATTTTTCGTCACGTGGTTTCCATATAATCTTTTTACACTTATA
AATTTATATTCTCGGTCAAAGTCCAATCCCACCATAGGGACACTTCTTTA
TGGTTTTGGCTATTATTTATGTTATTTGAATTCCACAATCAATCCAATAT
TGTATGCTTATTGCAATATTATGTTTCGTAGAACATTTTGGAGAATTCTA
ATATGCGGCCGGTCTAAGAGCAACACAAGTCGTTTCTCTTCAATGCCATC
GAATGCTTCTTCTAGTTGAATATAGATCATCTCGTTGATATGATTCTAGT
TCTGTAAATCTTCATCTAAATGTCGTTATTTTGTGAAAACCTTTGCAAAG
back to top

protein sequence of SMED30001335-orf-1

>SMED30001335-orf-1 ID=SMED30001335-orf-1|Name=SMED30001335-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MNNETNPDPFMALPFYQILIYSLIATILSLATACGNLLVLISFCIEGQLR
TISNYYLLSLAVSDFLIGIISMPLYSTFLIMQFWPFNSTTCDLWLSLDYT
VSNASSANLVLISYDRYKTLTCPLTYRCKRSPRKTIIIILLTWIICALLW
TPLIYIWPIIDGKRTVPQGKCYVQFMESSTLLTLLTCAIGYLIPLFIIIV
FAIQIYRVTRHRNKNLQTLGYATPVYGGAALKYNHRDNYKNMDSSTDTEI
SNRNPKEKCIKKVHKFQPNSLILTPQNLNYSSVTSSNSTIPNCQGNLMSH
GLRQSVRKKPSSSKAAKTLAAIIIAFFVTWFPYNLFTLINLYSRSKSNPT
IGTLLYGFGYYLCYLNSTINPILYAYCNIMFRRTFWRILICGRSKSNTSR
FSSMPSNASSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000995Musac_Ach_rcpt
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
GO:0030054cell junction
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: molecular function
TermDefinition
GO:0016907G-protein coupled acetylcholine receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0001696gastric acid secretion
GO:0007165signal transduction
GO:0007213G-protein coupled acetylcholine receptor signaling pathway
GO:0015872dopamine transport
GO:0019226transmission of nerve impulse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000995Muscarinic acetylcholine receptor familyPRINTSPR00243MUSCARINICRcoord: 20..32
score: 33.44
coord: 377..391
score: 51.3
coord: 68..78
score: 52.96
coord: 99..108
score: 63.91
coord: 118..132
score: 49.86
coord: 346..364
score: 32.27
coord: 41..49
score: 38.65
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 134..155
score: 21.18
coord: 315..339
score: 30.21
coord: 20..44
score: 22.8
coord: 98..120
score: 28.97
coord: 356..382
score: 32.54
coord: 53..74
score: 33.84
coord: 183..206
score: 22.11
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 35..374
e-value: 1.8E-60
score: 204.5
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 104..120
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 23..211
e-value: 7.6E-56
score: 191.9
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 280..400
e-value: 5.0E-22
score: 80.4
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 16..256
NoneNo IPR availablePANTHERPTHR24247:SF204MUSCARINIC ACETYLCHOLINE RECEPTOR DM1coord: 16..256
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 256..392
NoneNo IPR availablePANTHERPTHR24247:SF204MUSCARINIC ACETYLCHOLINE RECEPTOR DM1coord: 256..392
NoneNo IPR availableCDDcd150497tmA_mAChRcoord: 18..385
e-value: 2.49662E-82
score: 251.47
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 7..409
NoneNo IPR availableTMHMMTMhelixcoord: 355..377
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
NoneNo IPR availableTMHMMTMhelixcoord: 135..157
NoneNo IPR availableTMHMMTMhelixcoord: 55..77
NoneNo IPR availableTMHMMTMhelixcoord: 92..114
NoneNo IPR availableTMHMMTMhelixcoord: 181..203
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 35..374
score: 42.639