Eukaryotic translation initiation factor 3 subunit G

Overview
NameEukaryotic translation initiation factor 3 subunit G
Smed IDSMED30001326
Length (bp)992
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic translation initiation factor 3 subunit G (SMED30001326) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 3 subunit G (SMED30001326) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic translation initiation factor 3 subunit G (SMED30001326) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 3 subunit G (SMED30001326) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001326

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30001326SMESG000016857.1 SmedASXL_006890SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30001326SMESG000016857.1 SmedASXL_006890SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30001326SMESG000016857.1 dd_Smed_v4_5500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30001326SMESG000016857.1 dd_Smed_v4_5500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Human
Match: EIF3G (eukaryotic translation initiation factor 3 subunit G [Source:HGNC Symbol;Acc:HGNC:3274])

HSP 1 Score: 192.2 bits (487), Expect = 2.333e-58
Identity = 102/256 (39.84%), Postives = 156/256 (60.94%), Query Frame = 1
Query:  112 NTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA--DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            N    T T    +++ K  + +  ++++T + S++V  RK +KKFG ++ DPPGPN A T + D++ M F+   +++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+     E      +       +  +G Y+PP +RD A R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   61 NGNIKTVTEYKIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 316          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Human
Match: EIF3G (eukaryotic translation initiation factor 3 subunit G [Source:HGNC Symbol;Acc:HGNC:3274])

HSP 1 Score: 161.384 bits (407), Expect = 6.957e-47
Identity = 91/237 (38.40%), Postives = 142/237 (59.92%), Query Frame = 1
Query:  112 NTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA--DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAI 792
            N    T T    +++ K  + +  ++++T + S++V  RK +KKFG ++ DPPGPN A T + D++ M F+   +++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+  ++ E  P           +  +G Y+PP +RD A R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI
Sbjct:   61 NGNIKTVTEYKIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQL-GLSTELEPVQ-------ATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAI 289          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Human
Match: EIF3G (eukaryotic translation initiation factor 3 subunit G [Source:HGNC Symbol;Acc:HGNC:3274])

HSP 1 Score: 108.612 bits (270), Expect = 1.024e-28
Identity = 52/104 (50.00%), Postives = 71/104 (68.27%), Query Frame = 1
Query:  538 SGAYLPPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            +G Y+PP +RD A R      R +S       N  E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   21 TGKYVPPSLRDGASR------RGESMQ----PNRREDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 114          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Human
Match: EIF3G (eukaryotic translation initiation factor 3 subunit G [Source:HGNC Symbol;Acc:HGNC:3274])

HSP 1 Score: 112.079 bits (279), Expect = 1.950e-28
Identity = 65/181 (35.91%), Postives = 103/181 (56.91%), Query Frame = 1
Query:  169 REILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA--DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFR 681
            R +  ++++T + S++V  RK +KKFG ++ DPPGPN A T + D++ M F+   +++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+     E      +       +  +G Y+PP +RD A R        +R+D   TIRV+NL E  +E+DL +LFR
Sbjct:   82 RIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFR 262          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Human
Match: EIF3G (eukaryotic translation initiation factor 3 subunit G [Source:HGNC Symbol;Acc:HGNC:3274])

HSP 1 Score: 80.4925 bits (197), Expect = 3.807e-17
Identity = 42/108 (38.89%), Postives = 61/108 (56.48%), Query Frame = 1
Query:  376 VKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPF 687
            V CR C+G+H+T +CPYK+ +  +Q EL EQ+     E      +       +  +G Y+PP +RD A R        +R+D   TIRV+NL E  +E+DL +LFRPF
Sbjct:  120 VSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPF 227          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Celegans
Match: eif-3.G (Eukaryotic translation initiation factor 3 subunit G [Source:UniProtKB/Swiss-Prot;Acc:Q19706])

HSP 1 Score: 127.487 bits (319), Expect = 9.950e-35
Identity = 85/248 (34.27%), Postives = 134/248 (54.03%), Query Frame = 1
Query:  127 TKTRDIFNDEDKPCREILL-YKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKF----VADEIAPIEEEKKASVQSVK--CRNCQG-EHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWS 846
            T+T   F + D    +++  +K+    V + V  RK + KFG  K +P GP  A TY+ +E+ M+F      ++I  ++E+K+ +  + +  CR+C+G +H++  CPYK        +  Q+D    E +  DK T  D   + A G  + P  R        D+ RSD   T RV+NLP+   E +L DLF   G + R F+ +D+ TGL +GFA+VTF SR DAA+AI  +N     H +L+V+W+
Sbjct:   29 TRTETAFTEVDGVRWKVVTQFKVINKRVPKVVADRKKWVKFGSCKGEPAGPQVATTYVAEEVDMQFTRNRAGEQILDVQEDKQTAKTTSREHCRHCKGNDHWSTHCPYK--------VMYQLD----EEADADKDTEKD---RMAMG--MRPDGRQ------IDRNRSDEN-TCRVTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIAELNDIRMYHMVLKVEWT 252          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Celegans
Match: eif-3.G (Eukaryotic translation initiation factor 3 subunit G [Source:UniProtKB/Swiss-Prot;Acc:Q19706])

HSP 1 Score: 127.487 bits (319), Expect = 9.950e-35
Identity = 85/248 (34.27%), Postives = 134/248 (54.03%), Query Frame = 1
Query:  127 TKTRDIFNDEDKPCREILL-YKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKF----VADEIAPIEEEKKASVQSVK--CRNCQG-EHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWS 846
            T+T   F + D    +++  +K+    V + V  RK + KFG  K +P GP  A TY+ +E+ M+F      ++I  ++E+K+ +  + +  CR+C+G +H++  CPYK        +  Q+D    E +  DK T  D   + A G  + P  R        D+ RSD   T RV+NLP+   E +L DLF   G + R F+ +D+ TGL +GFA+VTF SR DAA+AI  +N     H +L+V+W+
Sbjct:   29 TRTETAFTEVDGVRWKVVTQFKVINKRVPKVVADRKKWVKFGSCKGEPAGPQVATTYVAEEVDMQFTRNRAGEQILDVQEDKQTAKTTSREHCRHCKGNDHWSTHCPYK--------VMYQLD----EEADADKDTEKD---RMAMG--MRPDGRQ------IDRNRSDEN-TCRVTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIAELNDIRMYHMVLKVEWT 252          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Celegans
Match: eif-3.G (Eukaryotic translation initiation factor 3 subunit G [Source:UniProtKB/Swiss-Prot;Acc:Q19706])

HSP 1 Score: 127.872 bits (320), Expect = 1.081e-34
Identity = 85/248 (34.27%), Postives = 134/248 (54.03%), Query Frame = 1
Query:  127 TKTRDIFNDEDKPCREILL-YKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKF----VADEIAPIEEEKKASVQSVK--CRNCQG-EHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWS 846
            T+T   F + D    +++  +K+    V + V  RK + KFG  K +P GP  A TY+ +E+ M+F      ++I  ++E+K+ +  + +  CR+C+G +H++  CPYK        +  Q+D    E +  DK T  D   + A G  + P  R        D+ RSD   T RV+NLP+   E +L DLF   G + R F+ +D+ TGL +GFA+VTF SR DAA+AI  +N     H +L+V+W+
Sbjct:   35 TRTETAFTEVDGVRWKVVTQFKVINKRVPKVVADRKKWVKFGSCKGEPAGPQVATTYVAEEVDMQFTRNRAGEQILDVQEDKQTAKTTSREHCRHCKGNDHWSTHCPYK--------VMYQLD----EEADADKDTEKD---RMAMG--MRPDGRQ------IDRNRSDEN-TCRVTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIAELNDIRMYHMVLKVEWT 258          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Celegans
Match: rbm-3.2 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:O45713])

HSP 1 Score: 57.7658 bits (138), Expect = 1.057e-10
Identity = 29/80 (36.25%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  610 SALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            S  ++ V N P    E DL + F   GN+S   +V DR+TG  RGFA+V FT  + A +A++  NG  ++   L+V  ++
Sbjct:    2 SGFSVYVGNAPFQTTEDDLGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEFTEEAAAQRAVDQFNGVDFNGRALRVNLAQ 81          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Celegans
Match: R06C1.4 (pep chromosome:WBcel235:I:11930704:11931757:1 gene:WBGene00011059.1 transcript:R06C1.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R06C1.4)

HSP 1 Score: 56.225 bits (134), Expect = 3.903e-10
Identity = 24/81 (29.63%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  604 SDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWS 846
            +    ++ V N+P    E ++ + F   G+++   +V DR+TG  RGFA+V F+  + A +A+E +NG  ++   L+V ++
Sbjct:    2 ASQGFSVYVGNVPYQGTEEEIGNYFAAVGHVNNVRIVYDRETGRPRGFAFVEFSEEAGAQRAVEQLNGVAFNGRNLRVNYA 82          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Fly
Match: eIF3g1 (gene:FBgn0029629 transcript:FBtr0070446)

HSP 1 Score: 162.925 bits (411), Expect = 4.963e-48
Identity = 90/240 (37.50%), Postives = 133/240 (55.42%), Query Frame = 1
Query:  145 FNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFV---ADEIA--PIEEEKKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            +N +DK  + +  YK+    V ++V  R+ + KFG +KND PGPN   T + +E+ M+F+    DE A  P+ +  K      KCR C GEH++  CPYK        + ++                +  V  P SG Y+PP ++D+       + R D+A  IR+SNL E+  E+DL++L +  G  S+ +L +D+ TGL +GFAYV F  R DAA AIE +NG GYDH IL V+WS+
Sbjct:   41 YNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGDSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTK---NIAKCRICNGEHWSVNCPYKGTAMDTNMMEKK-----------ASAAAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTA-AIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSK 265          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Fly
Match: eIF3g2 (gene:FBgn0038796 transcript:FBtr0083885)

HSP 1 Score: 149.828 bits (377), Expect = 5.837e-43
Identity = 83/244 (34.02%), Postives = 133/244 (54.51%), Query Frame = 1
Query:  145 FNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA--DEIAPIEEEKKASVQSVKCRNCQGEHFTHKCPYKE---EMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRD----NAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            FND+ K  + +  +K++   V ++V  R+ + KFG +++D PGPN   T   +E+FM+F+   D     E +        KCR C GEH++  CPYK    + K++ E         A S P+             +G Y+PP M+D    +  + +   +  D +  +R+SNL E+  E+DL++L +  G  ++ +L +++ +GL +GFAYV F  R DAA AIE +NG GYDH IL V+WS+
Sbjct:   39 FNDDGKKVKVVRTFKIEKQIVPKAVARRRNWVKFGDSRSDKPGPNSQTTMASEEIFMQFIGSKDFDQTHETQLDPGKNIAKCRICNGEHWSVNCPYKGTSMDSKTVMETKANAAAAAAISDPS------------KTGKYVPPFMKDGGGISGSKNWGRGRDRDDSSAVRISNLSESMTETDLEELVKKIGPHTKMYLAREKNSGLCKGFAYVHFKFRQDAAAAIEVLNGHGYDHLILCVEWSK 270          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Fly
Match: fne (gene:FBgn0086675 transcript:FBtr0306739)

HSP 1 Score: 56.225 bits (134), Expect = 1.311e-8
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  604 SDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQW 843
            + S   I V NL    +E+ L  LF PFG +    +++D QT   +GF +VT T+  +A  AI+ +NG+   + +LQV +
Sbjct:  266 TGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSF 345          

HSP 2 Score: 48.9062 bits (115), Expect = 2.951e-6
Identity = 26/76 (34.21%), Postives = 44/76 (57.89%), Query Frame = 1
Query:  580 RPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            RP S+   S     + VS LP+   + DL+ +F  FG I  + ++ D  +GLS+G  ++ F  R++A +AI+ +NG
Sbjct:  118 RPSSE---SIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNG 190          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Fly
Match: fne (gene:FBgn0086675 transcript:FBtr0343650)

HSP 1 Score: 56.225 bits (134), Expect = 1.311e-8
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  604 SDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQW 843
            + S   I V NL    +E+ L  LF PFG +    +++D QT   +GF +VT T+  +A  AI+ +NG+   + +LQV +
Sbjct:  266 TGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSF 345          

HSP 2 Score: 48.9062 bits (115), Expect = 2.951e-6
Identity = 26/76 (34.21%), Postives = 44/76 (57.89%), Query Frame = 1
Query:  580 RPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            RP S+   S     + VS LP+   + DL+ +F  FG I  + ++ D  +GLS+G  ++ F  R++A +AI+ +NG
Sbjct:  118 RPSSE---SIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNG 190          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Fly
Match: fne (gene:FBgn0086675 transcript:FBtr0343651)

HSP 1 Score: 56.225 bits (134), Expect = 1.311e-8
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  604 SDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQW 843
            + S   I V NL    +E+ L  LF PFG +    +++D QT   +GF +VT T+  +A  AI+ +NG+   + +LQV +
Sbjct:  266 TGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSF 345          

HSP 2 Score: 48.9062 bits (115), Expect = 2.951e-6
Identity = 26/76 (34.21%), Postives = 44/76 (57.89%), Query Frame = 1
Query:  580 RPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            RP S+   S     + VS LP+   + DL+ +F  FG I  + ++ D  +GLS+G  ++ F  R++A +AI+ +NG
Sbjct:  118 RPSSE---SIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNG 190          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Zebrafish
Match: eif3g (eukaryotic translation initiation factor 3, subunit G [Source:NCBI gene;Acc:393974])

HSP 1 Score: 190.274 bits (482), Expect = 3.957e-58
Identity = 101/246 (41.06%), Postives = 154/246 (62.60%), Query Frame = 1
Query:  145 FNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA---DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
             +D+ +  + I  +K++T + S++V  RK +KKFG ++ D PGPN A T + D++FM F++   D  A  ++E    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+     E     +   +  V +  +G Y+PP +RD   R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   45 IDDDGQKFKIIRTFKIETRKASKAVARRKNWKKFGNSEYDAPGPNVATTTVSDDVFMTFISSKEDLNAQDQDEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKAAEPEPAQPV-QNKTGKYVPPSLRDGGTRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKNTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 289          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Zebrafish
Match: raver1 (ribonucleoprotein, PTB-binding 1 [Source:ZFIN;Acc:ZDB-GENE-050522-99])

HSP 1 Score: 61.2326 bits (147), Expect = 3.809e-10
Identity = 28/74 (37.84%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  628 VSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            ++NLP A  +   ++L RPFGNI R FLV    TG S+G+ +V +  +  AA+A   + G      +L V W+E
Sbjct:  169 IANLPRAFTQQQFEELVRPFGNIERCFLVHSATTGHSKGYGFVEYMKKDSAARAKSELLGKQLGSRMLYVHWTE 242          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Zebrafish
Match: raver1 (ribonucleoprotein, PTB-binding 1 [Source:ZFIN;Acc:ZDB-GENE-050522-99])

HSP 1 Score: 61.2326 bits (147), Expect = 7.461e-10
Identity = 28/74 (37.84%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  628 VSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            ++NLP A  +   ++L RPFGNI R FLV    TG S+G+ +V +  +  AA+A   + G      +L V W+E
Sbjct:  169 IANLPRAFTQQQFEELVRPFGNIERCFLVHSATTGHSKGYGFVEYMKKDSAARAKSELLGKQLGSRMLYVHWTE 242          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Zebrafish
Match: elavl3 (ELAV like neuron-specific RNA binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-980526-76])

HSP 1 Score: 54.299 bits (129), Expect = 1.795e-8
Identity = 23/62 (37.10%), Postives = 41/62 (66.13%), Query Frame = 1
Query:  622 IRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            + VS LP+   + D++ LF  +G I  + ++ D+ TG+SRG  ++ F  R++A +AI+G+NG
Sbjct:   54 LYVSGLPKTMSQKDMEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRNEAEEAIKGLNG 115          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Zebrafish
Match: elavl1a (ELAV like RNA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-990415-245])

HSP 1 Score: 55.4546 bits (132), Expect = 2.879e-8
Identity = 29/80 (36.25%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  604 SDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQW 843
            S S   I + NL + A E  L  +F PFG ++   +++D  T   +GF +VT T   +AA AI  +NG+     ILQV +
Sbjct:  238 SSSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTHYEEAAMAIASLNGYRLGDKILQVSF 317          

HSP 2 Score: 51.6026 bits (122), Expect = 5.949e-7
Identity = 28/76 (36.84%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  580 RPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            RP SD  + D+ L I  S LP+   + D++++F  +G I  + ++ D+ +GLSRG A++ F  R++A  AI+ +NG
Sbjct:   95 RPSSDSIK-DANLYI--SGLPKTMTQKDVEEMFGRYGRIINSRVLVDQASGLSRGVAFIRFDKRAEAEDAIKDLNG 167          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Xenopus
Match: eif3g (eukaryotic translation initiation factor 3 subunit G [Source:NCBI gene;Acc:549503])

HSP 1 Score: 199.519 bits (506), Expect = 1.937e-61
Identity = 109/262 (41.60%), Postives = 158/262 (60.31%), Query Frame = 1
Query:  112 NTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA--DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPA------SGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            N    T T    NDE K  + +  +K++T + S+ V  RK +KKFG ++ DPPGPN A T + D++ M F+   +++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+       S  DK+       +PA      +G Y+PP +RD   R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   47 NGKIKTITEYKLNDEGKKIKIVRTFKIETLKASKVVAHRKNWKKFGNSEYDPPGPNVATTTVSDDVLMTFITSKEDLNNQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLG-----LSTGDKEKAPGAEPEPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 303          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Xenopus
Match: eif3g (eukaryotic translation initiation factor 3 subunit G [Source:NCBI gene;Acc:549503])

HSP 1 Score: 199.519 bits (506), Expect = 2.351e-61
Identity = 109/262 (41.60%), Postives = 158/262 (60.31%), Query Frame = 1
Query:  112 NTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA--DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPA------SGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            N    T T    NDE K  + +  +K++T + S+ V  RK +KKFG ++ DPPGPN A T + D++ M F+   +++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+       S  DK+       +PA      +G Y+PP +RD   R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   50 NGKIKTITEYKLNDEGKKIKIVRTFKIETLKASKVVAHRKNWKKFGNSEYDPPGPNVATTTVSDDVLMTFITSKEDLNNQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLG-----LSTGDKEKAPGAEPEPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 306          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Xenopus
Match: eif3g (eukaryotic translation initiation factor 3 subunit G [Source:NCBI gene;Acc:549503])

HSP 1 Score: 199.519 bits (506), Expect = 2.394e-61
Identity = 109/262 (41.60%), Postives = 158/262 (60.31%), Query Frame = 1
Query:  112 NTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA--DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPA------SGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            N    T T    NDE K  + +  +K++T + S+ V  RK +KKFG ++ DPPGPN A T + D++ M F+   +++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+       S  DK+       +PA      +G Y+PP +RD   R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   48 NGKIKTITEYKLNDEGKKIKIVRTFKIETLKASKVVAHRKNWKKFGNSEYDPPGPNVATTTVSDDVLMTFITSKEDLNNQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLG-----LSTGDKEKAPGAEPEPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 304          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Xenopus
Match: elavl1 (ELAV like RNA binding protein 1 [Source:NCBI gene;Acc:448062])

HSP 1 Score: 58.9214 bits (141), Expect = 3.401e-9
Identity = 26/62 (41.94%), Postives = 40/62 (64.52%), Query Frame = 1
Query:  622 IRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            + +S LP    + D++D+F PFG I  + ++ D+ TGLSRG A++ F  RS+A +AI   NG
Sbjct:  108 LYISGLPRTMTQKDVEDMFLPFGRIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNG 169          

HSP 2 Score: 53.1434 bits (126), Expect = 2.471e-7
Identity = 27/80 (33.75%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  604 SDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQW 843
            + S   I + NL + A E  L  +F PFG ++   +++D  T   +GF +VT T+  +AA AI  +NG+      LQV +
Sbjct:  240 ASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKTLQVSF 319          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Xenopus
Match: elavl1 (ELAV like RNA binding protein 1 [Source:NCBI gene;Acc:448062])

HSP 1 Score: 58.9214 bits (141), Expect = 3.520e-9
Identity = 26/62 (41.94%), Postives = 40/62 (64.52%), Query Frame = 1
Query:  622 IRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            + +S LP    + D++D+F PFG I  + ++ D+ TGLSRG A++ F  RS+A +AI   NG
Sbjct:  118 LYISGLPRTMTQKDVEDMFLPFGRIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNG 179          

HSP 2 Score: 52.7582 bits (125), Expect = 2.930e-7
Identity = 27/80 (33.75%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  604 SDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQW 843
            + S   I + NL + A E  L  +F PFG ++   +++D  T   +GF +VT T+  +AA AI  +NG+      LQV +
Sbjct:  250 ASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKTLQVSF 329          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Mouse
Match: Eif3g (eukaryotic translation initiation factor 3, subunit G [Source:MGI Symbol;Acc:MGI:1858258])

HSP 1 Score: 192.2 bits (487), Expect = 1.882e-58
Identity = 102/256 (39.84%), Postives = 155/256 (60.55%), Query Frame = 1
Query:  112 NTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA--DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            N    T T     ++ K  + +  ++++T + S++V  RK +KKFG ++ DPPGPN A T + D++ M F+   +++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+     E      +       +  +G Y+PP +RD A R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   61 NGNIKTVTEYKIEEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQAAQSKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 316          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Mouse
Match: Elavl2 (ELAV like RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1100887])

HSP 1 Score: 55.0694 bits (131), Expect = 3.692e-9
Identity = 29/98 (29.59%), Postives = 46/98 (46.94%), Query Frame = 1
Query:  553 PPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWS 846
            P  + +N   P       DS   + V+ LP+   + +L  LF   G I    LV+D+ TG S G+ +V +    DA KAI  +NG       ++V ++
Sbjct:   18 PTTVNNNCSSPVDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYA 115          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Mouse
Match: Srsf9 (serine/arginine-rich splicing factor 9 [Source:MGI Symbol;Acc:MGI:104896])

HSP 1 Score: 55.0694 bits (131), Expect = 2.216e-8
Identity = 32/85 (37.65%), Postives = 47/85 (55.29%), Query Frame = 1
Query:  586 FSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQ 840
            ++D++  +    I V NLP   +E DL+DLF  +G I R   +K+R   +   FA+V F    DA  AI G NG+ Y  C L+V+
Sbjct:    5 WADERGGEGDGRIYVGNLPSDVREKDLEDLFYKYGRI-REIELKNRHGLVP--FAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVE 86          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Mouse
Match: Rbmx (RNA binding motif protein, X chromosome [Source:MGI Symbol;Acc:MGI:1343044])

HSP 1 Score: 51.9878 bits (123), Expect = 2.754e-8
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 1
Query:  628 VSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWS 846
            +  L     E  L+ +F  +G I    L+KDR+T  SRGFA+VTF S +DA  A   +NG   D   ++V+ +
Sbjct:   12 IGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA 84          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Mouse
Match: Elavl1 (ELAV (embryonic lethal, abnormal vision)-like 1 (Hu antigen R) [Source:MGI Symbol;Acc:MGI:1100851])

HSP 1 Score: 55.4546 bits (132), Expect = 3.248e-8
Identity = 28/80 (35.00%), Postives = 44/80 (55.00%), Query Frame = 1
Query:  604 SDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQW 843
            + S   I + NL + A E  L  +F PFG ++   +++D  T   +GF +VT T+  +AA AI  +NG+     ILQV +
Sbjct:  240 ASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSF 319          

HSP 2 Score: 55.0694 bits (131), Expect = 4.190e-8
Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  622 IRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            + +S LP    + D++D+F  FG I  + ++ D+ TGLSRG A++ F  RS+A +AI   NG
Sbjct:  108 LYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNG 169          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. UniProt/SwissProt
Match: sp|Q6DJI8|EI3GA_XENLA (Eukaryotic translation initiation factor 3 subunit G-A OS=Xenopus laevis OX=8355 GN=eif3g-a PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 3.065e-61
Identity = 109/262 (41.60%), Postives = 159/262 (60.69%), Query Frame = 1
Query:  112 NTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVAD--EIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPA------SGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            N    T T    ND+DK  + +  +K++T + S+ V  RK +KKFG ++ DPPGPN A T + D++ M F+ +  ++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+       S  DK+       +PA      +G Y+PP +RD   R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   48 NGNIKTITEYKLNDDDKTVKIVRTFKIETVKASKVVAQRKNWKKFGNSEYDPPGPNVATTTVSDDVLMTFITNKEDLNNQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLG-----LSTGDKEKAPGAEPEPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 304          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. UniProt/SwissProt
Match: sp|Q641B2|EI3GB_XENLA (Eukaryotic translation initiation factor 3 subunit G-B OS=Xenopus laevis OX=8355 GN=eif3g-b PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 3.450e-61
Identity = 109/262 (41.60%), Postives = 159/262 (60.69%), Query Frame = 1
Query:  112 NTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVAD--EIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPA------SGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            N    T T    ND+DK  + +  +K++T + S+ V  RK +KKFG ++ DPPGPN A T + D++ M F+ +  ++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+    A     DK+       +PA      +G Y+PP +RD   R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   48 NGNIKTITEYKLNDKDKKIKIVRTFKIETLKASKVVAHRKNWKKFGNSEYDPPGPNVATTTVSDDVLMTFITNKEDLNNQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTA-----DKEKAPGAEPEPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 304          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. UniProt/SwissProt
Match: sp|Q28CY2|EIF3G_XENTR (Eukaryotic translation initiation factor 3 subunit G OS=Xenopus tropicalis OX=8364 GN=eif3g PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.245e-60
Identity = 109/262 (41.60%), Postives = 158/262 (60.31%), Query Frame = 1
Query:  112 NTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA--DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPA------SGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            N    T T    NDE K  + +  +K++T + S+ V  RK +KKFG ++ DPPGPN A T + D++ M F+   +++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+       S  DK+       +PA      +G Y+PP +RD   R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   50 NGKIKTITEYKLNDEGKKIKIVRTFKIETLKASKVVAHRKNWKKFGNSEYDPPGPNVATTTVSDDVLMTFITSKEDLNNQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLG-----LSTGDKEKAPGAEPEPAQAPVSKTGKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 306          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. UniProt/SwissProt
Match: sp|Q3ZC12|EIF3G_BOVIN (Eukaryotic translation initiation factor 3 subunit G OS=Bos taurus OX=9913 GN=EIF3G PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 9.337e-58
Identity = 102/256 (39.84%), Postives = 156/256 (60.94%), Query Frame = 1
Query:  112 NTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA--DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            N    T T    +++ K  + +  ++++T + S++V  RK +KKFG ++ DPPGPN A T + D++ M F+   +++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+     E      +       +  +G Y+PP +RD A R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   61 NGNIKTVTEYRIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 316          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. UniProt/SwissProt
Match: sp|O75821|EIF3G_HUMAN (Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 1.120e-57
Identity = 102/256 (39.84%), Postives = 156/256 (60.94%), Query Frame = 1
Query:  112 NTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA--DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            N    T T    +++ K  + +  ++++T + S++V  RK +KKFG ++ DPPGPN A T + D++ M F+   +++   EEE    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+     E      +       +  +G Y+PP +RD A R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   61 NGNIKTVTEYKIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 316          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. TrEMBL
Match: T1FMX8 (Eukaryotic translation initiation factor 3 subunit G OS=Helobdella robusta OX=6412 GN=20210177 PE=3 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 1.191e-66
Identity = 113/258 (43.80%), Postives = 164/258 (63.57%), Query Frame = 1
Query:  103 FDENTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFV-ADEIAPIEEEKKASVQS--VKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINA-ESSPNDKKTTSDTVLKPAS--GAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            FDE TG         ND+ K  + I  YK++T++VS+++  RK +KKFG AKNDPPGPNPA T + +++F++FV A E+   E++  + ++   V CR C+G+H+T KCPYKE +  +QE  E     +  + +P     +S     P +  G Y+PP +R+   +     S + R D + TIRV+NL E  +ESDL DLFRPFG ISR FL KD+ +G S+GFA++ F  + DAA+AI GV+GFGYDH IL V+W++
Sbjct:   39 FDEKTGVKKVIEYKINDDGKKVKVIKTYKVETYKVSKTIAKRKTWKKFGDAKNDPPGPNPANTVISEDIFLQFVHAKELTEPEDDPLSRLKGKMVSCRICKGDHWTTKCPYKERLAPLQETLEGKKTEDTPQQAPAGAGPSSQAPSGPGAKPGKYVPPSLREGGNKKGDSMSVRGRGDDSATIRVTNLSEDTRESDLQDLFRPFGQISRIFLAKDKLSGQSKGFAFINFHHKEDAARAIAGVSGFGYDHLILNVEWAK 296          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. TrEMBL
Match: A0A433TWG3 (Eukaryotic translation initiation factor 3 subunit G OS=Elysia chlorotica OX=188477 GN=EGW08_006302 PE=3 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 4.459e-65
Identity = 115/263 (43.73%), Postives = 164/263 (62.36%), Query Frame = 1
Query:  103 FDENTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFV-------ADEIAPIEE-EKKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQELTEQ---IDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDK---KRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            F+E  G  T T    ND+ K  + I  +K++T  +S+S+  RK +KKFG A  DPPGPNPA T L +E+ M+FV       AD+  P+ +  K   V+ V+CR C+G+H+T KCPYK+ ++ +Q+  E+      I   S+P   K+T       A G Y+PP +R+ A +   +    +R D   TIRV+NL E  +ESDL +LFRPFG ISR +L KD+ TG S+GFA++ F  R DAA+AI+GV+GFGYDH IL V+W++
Sbjct:   24 FNEKKGIKTVTEYKHNDDGKVVKIIRTFKVETVRLSKSIAKRKTWKKFGAASGDPPGPNPANTVLTEEIQMQFVLNKEPTQADDDDPLSKLPKDGRVKIVQCRICKGDHWTTKCPYKDTLQPLQQKLEEGAAKPEIAPVSAPTGPKST-------AGGKYIPPTLREGANKGRGESMTMQRKDETATIRVTNLSEDTRESDLQELFRPFGPISRIYLAKDKNTGQSKGFAFINFHRREDAARAIQGVSGFGYDHLILNVEWAK 279          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. TrEMBL
Match: A0A1S3JUV0 (Eukaryotic translation initiation factor 3 subunit G OS=Lingula unguis OX=7574 GN=LOC106176312 PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.381e-64
Identity = 112/258 (43.41%), Postives = 158/258 (61.24%), Query Frame = 1
Query:  103 FDENTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVAD-EIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDK----KRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            +DE TG    T    N++ K  + +  Y+++T  V +++  RK ++KFG A NDPPGPNPA T LG+E++M FV + E+    EE    K    + V CR C+G+H+T KCPYK+ +  IQE   + D    +SS       +        G Y+PP +R+ A     D     KR D A TIRV+NL E  +E+DL +LFRPFG ISR +L KD+ TG S+GFA++ F  R DAA+AI+GV+GFGYDH IL+V+W++
Sbjct:   31 YDEATGIKKVTEYKINEDGKKVKVVKTYRVETRRVFKTIAKRKTWRKFGLAANDPPGPNPANTVLGEEVYMVFVHNKEVQDDSEEDPLAKLKGQKLVSCRICKGDHWTTKCPYKDTLGPIQETLAEGDKAPGDSS--QPAQPAPVPPPKVGGKYVPPSLREGAKTGKGDSMLPNKRGDEAATIRVTNLSEDTREADLQELFRPFGAISRIYLAKDKNTGQSKGFAFINFHRREDAARAIKGVSGFGYDHLILKVEWAK 286          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. TrEMBL
Match: A0A0B6Y8M1 (RRM domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF16968 PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 5.282e-64
Identity = 111/257 (43.19%), Postives = 165/257 (64.20%), Query Frame = 1
Query:  103 FDENTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVAD-EIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDK---KRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            FD+  G  T T    +++ K  + +  YK++   +S+S+  RK++KKFG A NDP GPNP+ T L +E+FM+F+ + E   +E+E    K  + + V+CR C+G+H+T KCPYK+ ++ +QE  E+      E+ P    T+S +      G Y+PP MR+ A +   +    +R D A TIRV+NL E  +ESDL +LFRPFG ISR +L KD+ TG S+GFA++ F  R DAA+AI+GV+GFGYDH IL V+W++
Sbjct:   39 FDDKRGLKTITEYKNSEDGKLIKVVRTYKIEVVRLSKSIAKRKMWKKFGAAANDPAGPNPSNTILTEEVFMQFIQNKEQTTVEDEDPLSKLKNQKIVQCRICKGDHWTTKCPYKDTLQPLQEKLEE-GAKKTEAPP----TSSASPAPKTGGKYIPPTMREGANKGRGESMATQRKDEAATIRVTNLSEDTRESDLQELFRPFGPISRIYLAKDKITGQSKGFAFINFHRREDAARAIQGVSGFGYDHLILNVEWAK 290          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. TrEMBL
Match: A0A0B6YAL8 (RRM domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF16972 PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 6.911e-64
Identity = 111/257 (43.19%), Postives = 165/257 (64.20%), Query Frame = 1
Query:  103 FDENTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVAD-EIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDK---KRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            FD+  G  T T    +++ K  + +  YK++   +S+S+  RK++KKFG A NDP GPNP+ T L +E+FM+F+ + E   +E+E    K  + + V+CR C+G+H+T KCPYK+ ++ +QE  E+      E+ P    T+S +      G Y+PP MR+ A +   +    +R D A TIRV+NL E  +ESDL +LFRPFG ISR +L KD+ TG S+GFA++ F  R DAA+AI+GV+GFGYDH IL V+W++
Sbjct:   39 FDDKRGLKTITEYKNSEDGKLIKVVRTYKIEVVRLSKSIAKRKMWKKFGAAANDPAGPNPSNTILTEEVFMQFIQNKEQTTVEDEDPLSKLKNQKIVQCRICKGDHWTTKCPYKDTLQPLQEKLEE-GAKKTEAPP----TSSASPAPKTGGKYIPPTMREGANKGRGESMATQRKDEAATIRVTNLSEDTRESDLQELFRPFGPISRIYLAKDKITGQSKGFAFINFHRREDAARAIQGVSGFGYDHLILNVEWAK 290          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Cavefish
Match: eif3g (eukaryotic translation initiation factor 3 subunit G [Source:NCBI gene;Acc:111191904])

HSP 1 Score: 194.512 bits (493), Expect = 8.761e-60
Identity = 103/249 (41.37%), Postives = 158/249 (63.45%), Query Frame = 1
Query:  145 FNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA---DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPA---SGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
             +++DK  + I  +K++  + S++V  RK +KKFG ++ DPPGPN A T + D+++M F++   D  A  ++E    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+      S+ + +K T     +P    +G Y+PP +RD   R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   45 IDEDDKKFKIIRTFKIENRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVYMTFISSKEDLNAQDQDEDPMSKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQL----GLSTGDKEKATEPEPAQPVQSKTGKYIPPSLRDGGTRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKNTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 289          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Cavefish
Match: eif3g (eukaryotic translation initiation factor 3 subunit G [Source:NCBI gene;Acc:111191904])

HSP 1 Score: 194.126 bits (492), Expect = 1.442e-59
Identity = 103/249 (41.37%), Postives = 158/249 (63.45%), Query Frame = 1
Query:  145 FNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA---DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPA---SGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
             +++DK  + I  +K++  + S++V  RK +KKFG ++ DPPGPN A T + D+++M F++   D  A  ++E    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+      S+ + +K T     +P    +G Y+PP +RD   R        +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   45 IDEDDKKFKIIRTFKIENRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVYMTFISSKEDLNAQDQDEDPMSKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQL----GLSTGDKEKATEPEPAQPVQSKTGKYIPPSLRDGGTRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKNTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 289          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Cavefish
Match: ENSAMXT00000032401.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:8905026:8906794:1 gene:ENSAMXG00000043026.1 transcript:ENSAMXT00000032401.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 8.805e-10
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 1
Query:  610 SALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKA 789
            ++LT+ VSNLP +A  + L++LF   G + R F+VKD+ +   RGF YVT++   DA +A
Sbjct:    2 ASLTLFVSNLPASASSAGLEELFSEVGPVKRCFVVKDKGSEKCRGFGYVTYSMAEDAQRA 61          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Cavefish
Match: raver1 (ribonucleoprotein, PTB binding 1 [Source:NCBI gene;Acc:103021593])

HSP 1 Score: 60.077 bits (144), Expect = 1.426e-9
Identity = 27/74 (36.49%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  628 VSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            ++NLP A  +   ++L RPFGN+ R FLV    TG S+G+ +V +  +  AA+A   + G      +L V W+E
Sbjct:  154 IANLPRAFTQQQFEELVRPFGNLERCFLVHSAATGHSKGYGFVEYMKKDSAARAKSELLGKQLGSRMLYVHWTE 227          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Cavefish
Match: raver1 (ribonucleoprotein, PTB binding 1 [Source:NCBI gene;Acc:103021593])

HSP 1 Score: 60.077 bits (144), Expect = 1.483e-9
Identity = 27/74 (36.49%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  628 VSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            ++NLP A  +   ++L RPFGN+ R FLV    TG S+G+ +V +  +  AA+A   + G      +L V W+E
Sbjct:  154 IANLPRAFTQQQFEELVRPFGNLERCFLVHSAATGHSKGYGFVEYMKKDSAARAKSELLGKQLGSRMLYVHWTE 227          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002832.1 (pep scaffold:Pmarinus_7.0:GL476732:699988:701739:-1 gene:ENSPMAG00000002585.1 transcript:ENSPMAT00000002832.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 4.953e-9
Identity = 25/65 (38.46%), Postives = 37/65 (56.92%), Query Frame = 1
Query:  613 ALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
               + V+ + E AQE D+ D F  FG I    L  DR+TG  +G+A V + +  +A  A+EG+NG
Sbjct:    9 GWILFVTGVHEEAQEDDMHDKFGEFGEIKNVHLNLDRRTGFLKGYALVEYETFKEAQAAMEGLNG 73          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Sea Lamprey
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 53.1434 bits (126), Expect = 1.896e-8
Identity = 33/104 (31.73%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  556 PHMRDNAPRPFSDKKRS-------DSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWS 846
            P  R ++  P S+++R        D +  + V  L     E DL ++F  +G +    +V D+Q+G SRGFA+V F +  DA +A E  NG   D   ++V +S
Sbjct:   85 PDYRRHSRSPMSNRRRHLGSRVNPDPSCCLGVFGLSLHTGEKDLKEVFSRYGPVQSVNVVYDQQSGRSRGFAFVYFDNSEDAKEAKERANGMELDGRYIRVDFS 188          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 53.1434 bits (126), Expect = 4.037e-8
Identity = 27/72 (37.50%), Postives = 42/72 (58.33%), Query Frame = 1
Query:  595 KKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGF 810
            +K +   + + V +L     E+ L  +F PFG I    L+ D +TG S+GF ++TF+S   A KA+E +NGF
Sbjct:  265 QKLASGPMRLYVGSLHFNITEAMLMGIFEPFGKIDNIQLMMDPETGRSKGFGFITFSSADCAKKALEQLNGF 336          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008846.1 (pep scaffold:Pmarinus_7.0:GL480623:147895:156346:1 gene:ENSPMAG00000008007.1 transcript:ENSPMAT00000008846.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 1.270e-7
Identity = 24/73 (32.88%), Postives = 42/73 (57.53%), Query Frame = 1
Query:  622 IRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQ 840
            + + +LP+   + DL   F PFG++  + +  D+QT LS+ F +V++ +   A  AI+ +NGF      L+VQ
Sbjct:    7 LFIYHLPQEFGDQDLMQTFMPFGSVVSSKVFVDKQTNLSKCFGFVSYDNPISAQAAIQAMNGFQIGTKRLKVQ 79          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 50.0618 bits (118), Expect = 4.214e-7
Identity = 27/72 (37.50%), Postives = 38/72 (52.78%), Query Frame = 1
Query:  595 KKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGF 810
            +K +   + + V +L     E  L  +F PFG I    L+ D  TG SRG+ +VTF     A KA+E +NGF
Sbjct:  252 QKSTAGPMRLYVGSLHFNITEDMLKGIFEPFGKIENCQLMMDSDTGRSRGYGFVTFADAECARKALEQLNGF 323          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Yeast
Match: TIF35 (eIF3g subunit of the eukaryotic translation initiation factor 3 (eIF3); subunit of the core complex of eIF3; is essential for translation; stimulates resumption of ribosomal scanning during translation reinitiation; eIF3 is also involved in programmed stop codon readthrough [Source:SGD;Acc:S000002837])

HSP 1 Score: 117.857 bits (294), Expect = 1.565e-31
Identity = 71/224 (31.70%), Postives = 118/224 (52.68%), Query Frame = 1
Query:  205 VSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVAD----EIAPIEEEKKASVQS-VKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDKKR----SDSALTIRVSNLPEAAQESDL-DDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWS 846
            V +SV  RK + K+G  K  P GP+     LG+E+ ++   +    E   I++EK +  ++ ++CR C  +H T  CP+K  +  +  L +   N     + +++K           G Y+PP  R  A  P SD  R     D   T+++  + E A E+ L ++L  PF  I R  +V++++TG SRG A+VTF+S   A +A+  ++G GY + IL+V+WS
Sbjct:   45 VHKSVAERKNWHKYGSEKGSPAGPSAVTARLGEEVELRLSRNWKQAEEERIQKEKASLTKTGLQCRLCGNDHMTMNCPFKTILSELSALEDPATNEGGVEAASEEKAGQVGGAGSIPGQYVPPSRRAGARDPSSDAYRDSRERDDMCTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLILRVEWS 268          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Yeast
Match: NOP15 (Constituent of 66S pre-ribosomal particles; involved in 60S ribosomal subunit biogenesis; localizes to both nucleolus and cytoplasm [Source:SGD;Acc:S000005054])

HSP 1 Score: 52.7582 bits (125), Expect = 1.087e-8
Identity = 34/131 (25.95%), Postives = 56/131 (42.75%), Query Frame = 1
Query:  448 QELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQ 840
            Q  T +I  +N +   N+KK+     L+  SG                          I VS LP    E +L   F  FG++    L ++++TG SR + ++ F ++ DA  A E +N +     +LQV+
Sbjct:   60 QSGTHKIKRLNPKKQANEKKSKDKKTLEEYSG-------------------------IIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNNYLLMGHLLQVR 165          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 49.6766 bits (117), Expect = 3.251e-7
Identity = 25/81 (30.86%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  607 DSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            +S+ ++ V +L  +  E+ L D+F P G++S   + +D  T  S G+AYV F       KAIE +N       + ++ WS+
Sbjct:   35 NSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQ 115          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Yeast
Match: GBP2 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; also binds single-stranded telomeric repeat sequence in vitro; relocalizes to the cytosol in response to hypoxia; GBP2 has a paralog, HRB1, that arose from the whole genome duplication [Source:SGD;Acc:S000000517])

HSP 1 Score: 48.9062 bits (115), Expect = 5.305e-7
Identity = 29/81 (35.80%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  604 SDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWS 846
             D    I  SNLP +   SDL DLF P G I+   L K ++ G   G A V + +  DA   I+ +N + Y  C LQ+ ++
Sbjct:  345 GDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAEL-KPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQISYA 424          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 48.1358 bits (113), Expect = 1.051e-6
Identity = 25/86 (29.07%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  589 SDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWS 846
            S +  SD    + V +L     +  L + F+ F +     ++ D QTG SRG+ +V+FTS+ DA  A++ + G   +   L++ W+
Sbjct:  153 SQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWA 238          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Nematostella
Match: EDO35846 (Eukaryotic translation initiation factor 3 subunit G [Source:UniProtKB/Swiss-Prot;Acc:A7SKE9])

HSP 1 Score: 190.274 bits (482), Expect = 1.260e-58
Identity = 106/266 (39.85%), Postives = 159/266 (59.77%), Query Frame = 1
Query:   76 DIRDTENLIFDENTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVADEIAPIEEE----KKASVQS-VKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPR---PFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            ++R+ EN I  E    Y +     +DE K  + I  Y+++T  V++ +  RKL+KKFG +KND PGPN   T + D++F+   +++  P   E    KK S Q  V+CR C+G+H+T KCPYK++++ I +  ++ D      +P  +   ++      SG Y+ P +RD A R       + + D   TIRV+NL E  +ESDL +LFRP G ISR FL KD+ T  S+GFA++ F  R DAA+AIE ++GFGYDH IL V+W++
Sbjct:   35 EVREGENKIVTE----YKR-----DDEGKLQKIITTYRVETRRVAKEIAKRKLWKKFGDSKNDKPGPNKTTTNVCDDVFLILTSNKENPDATEEDPLKKLSGQKIVQCRICKGDHWTTKCPYKDQLEVIHQQLKEDDGSGQPGTPPSE--PANPAAASTSGKYVAPGLRDGANRRGETMPSRSQRDETATIRVTNLSEETRESDLQELFRPLGPISRIFLAKDKFTNQSKGFAFINFVHREDAARAIEVLSGFGYDHLILNVEWAK 289          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Nematostella
Match: EDO28857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5A6])

HSP 1 Score: 82.8037 bits (203), Expect = 3.194e-19
Identity = 46/107 (42.99%), Postives = 72/107 (67.29%), Query Frame = 1
Query:  163 PCREILL-YKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVADEIAP--IEEE--KKASVQS-VKCRNCQGEHFTHKCPYKEEMKSI-QELTE 462
            P  EI+  Y+++T  V++ +  RKL+KKFG +KND PGPN   T + D++F+   +++  P   EE+  KK S Q  V+CR C+G+H+T KCPYK++++ I Q+L E
Sbjct:   23 PSSEIITTYRVETRRVAKEIAKRKLWKKFGDSKNDKPGPNKTTTNVCDDVFLILTSNKENPDATEEDPLKKLSGQKIVQCRICKGDHWTTKCPYKDQLEVIHQQLKE 129          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Nematostella
Match: EDO45702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS89])

HSP 1 Score: 52.7582 bits (125), Expect = 7.789e-9
Identity = 25/69 (36.23%), Postives = 40/69 (57.97%), Query Frame = 1
Query:  601 RSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            RS     + V+N+ E AQE D+ +LF  +G I    +  DR+TG  +G+A V + +  +A  A+E +NG
Sbjct:   33 RSVEGWILFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNG 101          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Nematostella
Match: EDO30149 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1M0])

HSP 1 Score: 50.8322 bits (120), Expect = 1.490e-8
Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 1
Query:  628 VSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            V+N+ E AQE D+ +LF  +G I    +  DR+TG  +G+A V + +  +A  A+E +NG
Sbjct:    9 VTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNG 68          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Nematostella
Match: EDO47928 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKL6])

HSP 1 Score: 50.447 bits (119), Expect = 2.086e-8
Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 1
Query:  628 VSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            V+N+ E AQE D+ +LF  +G I    +  DR+TG  +G+A V + +  +A  A+E +NG
Sbjct:    9 VTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNG 68          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Medaka
Match: EIF3G (eukaryotic translation initiation factor 3 subunit G [Source:NCBI gene;Acc:101161244])

HSP 1 Score: 186.037 bits (471), Expect = 1.501e-56
Identity = 100/242 (41.32%), Postives = 151/242 (62.40%), Query Frame = 1
Query:  175 ILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVA---DEIAPIEEE----KKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQ-ELTEQIDNINAESSPNDKKTTSDTVLKPA------SGAYLPPHMRDNA---PRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            +  +K++T + S++V  RK +KKFG ++ D PGPN A T + D++FM F++   D  A  ++E    K    + V CR C+G+H+T +CPYK+ +  +Q EL EQ+      S+ + +K       +PA      +G Y+PP +RD            +R+D   TIRV+NL E  +E+DL +LFRPFG+ISR +L KD+ TG S+GFA+++F  R DAA+AI GV+GFGYDH IL V+W++
Sbjct:   56 VRTFKIETRKASKAVARRKNWKKFGNSEFDAPGPNVATTTVSDDVFMTFISSKEDLNAQDQDEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQL----GLSTGDKEKPAGAAEPEPAQPAQSKTGKYVPPSLRDGGRGRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKNTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAK 293          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Medaka
Match: raver1 (ribonucleoprotein, PTB binding 1 [Source:NCBI gene;Acc:101160241])

HSP 1 Score: 60.077 bits (144), Expect = 1.244e-9
Identity = 27/74 (36.49%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  628 VSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            ++NLP+A  +   ++L RPFGN+ R FLV    TG S+G+ +V +  +  AA+A   + G      +L V W+E
Sbjct:  171 IANLPQAFTQQQFEELVRPFGNLERCFLVYSATTGHSKGYGFVEYMKKDSAARAKSELLGKQLGSRMLYVHWTE 244          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Medaka
Match: elavl1a (ELAV-like protein 1 [Source:NCBI gene;Acc:101170313])

HSP 1 Score: 56.9954 bits (136), Expect = 7.427e-9
Identity = 30/80 (37.50%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  604 SDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQW 843
            S S   I + NL + A ES L  +F PFG ++   +++D  T   +GF +VT T+  +AA AI  +NG+     ILQV +
Sbjct:  259 STSGWCIFIYNLGQDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSF 338          

HSP 2 Score: 49.6766 bits (117), Expect = 2.198e-6
Identity = 29/79 (36.71%), Postives = 49/79 (62.03%), Query Frame = 1
Query:  580 RPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTG---LSRGFAYVTFTSRSDAAKAIEGVNG 807
            RP SD  + D+ L I  S LP+   + D++D+F  +G I  + ++ D+ TG   +SRG A++ F  RS+A +A++ +NG
Sbjct:  113 RPSSDTIK-DANLYI--SGLPKNMTQKDVEDMFSCYGRIINSRVLVDQSTGTTGMSRGVAFIRFDKRSEAEEAVKSLNG 188          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Medaka
Match: tra2a (transformer-2 protein homolog alpha [Source:NCBI gene;Acc:101157868])

HSP 1 Score: 55.8398 bits (133), Expect = 1.351e-8
Identity = 37/111 (33.33%), Postives = 57/111 (51.35%), Query Frame = 1
Query:  544 AYLPPHMR---DNAPRPFSDKKRS-------DSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWS 846
            +Y P H R    NA  P S ++R        D +  + V  L  +  E DL ++F  +G ++   +V D++TG SRGFA++ F    DA +AIE  NG   D   ++V +S
Sbjct:   76 SYSPDHRRRRSQNAS-PMSSRRRHTGTRENPDPSTCLGVFGLNLSTTERDLREVFSRYGRLTGINMVHDQRTGRSRGFAFIYFERLCDAREAIEHTNGMNMDGRQIRVDYS 185          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Medaka
Match: ENSORLT00000000111.2 (ELAV-like protein 1 [Source:NCBI gene;Acc:101172398])

HSP 1 Score: 55.8398 bits (133), Expect = 1.806e-8
Identity = 31/76 (40.79%), Postives = 47/76 (61.84%), Query Frame = 1
Query:  580 RPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNG 807
            RP SD  + D+ L I  S LP    + DL+D+F  FG I  + ++ D+ +GLSRG A++ F  RS+A  A++ +NG
Sbjct:  129 RPSSDTIK-DANLYI--SGLPRTLGQQDLEDMFASFGRIINSRVLVDQASGLSRGVAFIRFDKRSEAEDAVKHLNG 201          

HSP 2 Score: 52.373 bits (124), Expect = 2.544e-7
Identity = 26/74 (35.14%), Postives = 41/74 (55.41%), Query Frame = 1
Query:  622 IRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQW 843
            I + NL + A E  L  +F PFG +    +++D  T   +GF +VT T+  +AA AI  +NG+     +LQV +
Sbjct:  276 IFIYNLTQDADEGMLWQMFGPFGAVVNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIHSLNGYRMGDKVLQVSF 349          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Planmine SMEST
Match: SMESG000016857.1 (SMESG000016857.1)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 271/271 (100.00%), Postives = 271/271 (100.00%), Query Frame = 1
Query:   37 MTETLTTWDIQEDDIRDTENLIFDENTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVADEIAPIEEEKKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            MTETLTTWDIQEDDIRDTENLIFDENTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVADEIAPIEEEKKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE
Sbjct:    1 MTETLTTWDIQEDDIRDTENLIFDENTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVADEIAPIEEEKKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAESSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 271          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Planmine SMEST
Match: SMESG000074687.1 (SMESG000074687.1)

HSP 1 Score: 372.859 bits (956), Expect = 2.688e-130
Identity = 180/272 (66.18%), Postives = 220/272 (80.88%), Query Frame = 1
Query:   40 TETLTTWDIQEDDIRDTENLIFDENTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVADEIAPIEEEKKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAES-SPNDKKTTSDTVLKPAS-GAYLPPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQWSE 849
            T+TL +WDI++DDI+  +NL+FDE TGFY K R  FN++D+ C+EIL YKL+TFEVSESVK RKL+KKFGKA+ND PGPNP+ T+LGDELFMK++ DE    E +KK+  QSV+CR C G+HF+ +CPYK+E++SIQELT QI+ +  +S    D K      LKP + G YLPPHMRD  P  FSDK+R+DSALTIRVSNLPE AQESDLDDLFRPFG+ISRTFL KD+ TG SRGFAY+TF +R DAAKAIEGVNGFGYDHCILQV+W++
Sbjct:    3 TQTLNSWDIEDDDIKIEDNLLFDEETGFYKKVRQTFNEKDQLCQEILQYKLETFEVSESVKCRKLWKKFGKARNDAPGPNPSHTFLGDELFMKYITDETTTTEGDKKSKDQSVRCRKCHGDHFSRQCPYKDEIESIQELTAQIEGVPVDSLIIQDDKFRKVVTLKPLTNGKYLPPHMRDIGPPVFSDKRRADSALTIRVSNLPETAQESDLDDLFRPFGSISRTFLAKDKITGSSRGFAYITFHNRVDAAKAIEGVNGFGYDHCILQVEWAK 274          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Planmine SMEST
Match: SMESG000074687.1 (SMESG000074687.1)

HSP 1 Score: 310.842 bits (795), Expect = 4.452e-105
Identity = 157/268 (58.58%), Postives = 198/268 (73.88%), Query Frame = 1
Query:   40 TETLTTWDIQEDDIRDTENLIFDENTGFYTKTRDIFNDEDKPCREILLYKLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVADEIAPIEEEKKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAES-SPNDKKTTSDTVLKPAS-GAYLPPHMRDNAPRPFSDKKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQV 837
            T+TL +WDI++DDI+  +NL+FDE TGFY K R  FN++D+ C+EIL YKL+TFEVSESVK RKL+KKFGKA+ND PGPNP+ T+LGDELFMK++ DE    E +KK+  QSV+CR C G+HF+ +CPYK+E++SIQELT QI+ +  +S    D K      LKP + G YLPPHMRD  P  FSDK+R+DSALTIRVSNLPE AQESDLDDLFRPFG+ISRTFL KD+ TG SR   + T  S     +++      G+ H  L+V
Sbjct:    3 TQTLNSWDIEDDDIKIEDNLLFDEETGFYKKVRQTFNEKDQLCQEILQYKLETFEVSESVKCRKLWKKFGKARNDAPGPNPSHTFLGDELFMKYITDETTTTEGDKKSKDQSVRCRKCHGDHFSRQCPYKDEIESIQELTAQIEGVPVDSLIIQDDKFRKVVTLKPLTNGKYLPPHMRDIGPPVFSDKRRADSALTIRVSNLPETAQESDLDDLFRPFGSISRTFLAKDKITGSSRRIIFYTQLSNRVVNRSV------GFSHLGLRV 264          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Planmine SMEST
Match: SMESG000081081.1 (SMESG000081081.1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.396e-10
Identity = 45/140 (32.14%), Postives = 68/140 (48.57%), Query Frame = 1
Query:  463 QIDNINAESSPND-------KKTTSDTVLK-PASGAYLPPHMRDNAPRPFSDKKRSDSALT-----IRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQW 843
            Q   ++A S+PN        ++  S + LK P+SG  L P M    P        S  ALT     I V NL    +E+ L  LF PFG +    +V+D  T   +GF +VT ++  +A  +I+ +NGF   + +LQV +
Sbjct:  274 QTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 413          

HSP 2 Score: 47.3654 bits (111), Expect = 8.468e-6
Identity = 29/102 (28.43%), Postives = 49/102 (48.04%), Query Frame = 1
Query:  541 GAYLPPHMRDNAPRPFSD---KKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQV 837
            G     +M    P P S+       ++   + V+ LP    + ++  LF   G +    LV+D+ TG S G+A+V F   +DA KAI+ +NG    +  ++V
Sbjct:   58 GTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKV 159          
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Planmine SMEST
Match: SMESG000081081.1 (SMESG000081081.1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.691e-10
Identity = 45/140 (32.14%), Postives = 68/140 (48.57%), Query Frame = 1
Query:  463 QIDNINAESSPND-------KKTTSDTVLK-PASGAYLPPHMRDNAPRPFSDKKRSDSALT-----IRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQVQW 843
            Q   ++A S+PN        ++  S + LK P+SG  L P M    P        S  ALT     I V NL    +E+ L  LF PFG +    +V+D  T   +GF +VT ++  +A  +I+ +NGF   + +LQV +
Sbjct:  275 QTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 414          

HSP 2 Score: 47.3654 bits (111), Expect = 9.102e-6
Identity = 29/102 (28.43%), Postives = 49/102 (48.04%), Query Frame = 1
Query:  541 GAYLPPHMRDNAPRPFSD---KKRSDSALTIRVSNLPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAKAIEGVNGFGYDHCILQV 837
            G     +M    P P S+       ++   + V+ LP    + ++  LF   G +    LV+D+ TG S G+A+V F   +DA KAI+ +NG    +  ++V
Sbjct:   59 GTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKV 160          
The following BLAST results are available for this feature:
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF3G2.333e-5839.84eukaryotic translation initiation factor 3 subunit... [more]
EIF3G6.957e-4738.40eukaryotic translation initiation factor 3 subunit... [more]
EIF3G1.024e-2850.00eukaryotic translation initiation factor 3 subunit... [more]
EIF3G1.950e-2835.91eukaryotic translation initiation factor 3 subunit... [more]
EIF3G3.807e-1738.89eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif-3.G9.950e-3534.27Eukaryotic translation initiation factor 3 subunit... [more]
eif-3.G9.950e-3534.27Eukaryotic translation initiation factor 3 subunit... [more]
eif-3.G1.081e-3434.27Eukaryotic translation initiation factor 3 subunit... [more]
rbm-3.21.057e-1036.25RNA Binding Motif protein homolog [Source:UniProt... [more]
R06C1.43.903e-1029.63pep chromosome:WBcel235:I:11930704:11931757:1 gene... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eIF3g14.963e-4837.50gene:FBgn0029629 transcript:FBtr0070446[more]
eIF3g25.837e-4334.02gene:FBgn0038796 transcript:FBtr0083885[more]
fne1.311e-835.00gene:FBgn0086675 transcript:FBtr0306739[more]
fne1.311e-835.00gene:FBgn0086675 transcript:FBtr0343650[more]
fne1.311e-835.00gene:FBgn0086675 transcript:FBtr0343651[more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif3g3.957e-5841.06eukaryotic translation initiation factor 3, subuni... [more]
raver13.809e-1037.84ribonucleoprotein, PTB-binding 1 [Source:ZFIN;Acc:... [more]
raver17.461e-1037.84ribonucleoprotein, PTB-binding 1 [Source:ZFIN;Acc:... [more]
elavl31.795e-837.10ELAV like neuron-specific RNA binding protein 3 [S... [more]
elavl1a2.879e-836.25ELAV like RNA binding protein 1a [Source:ZFIN;Acc:... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif3g1.937e-6141.60eukaryotic translation initiation factor 3 subunit... [more]
eif3g2.351e-6141.60eukaryotic translation initiation factor 3 subunit... [more]
eif3g2.394e-6141.60eukaryotic translation initiation factor 3 subunit... [more]
elavl13.401e-941.94ELAV like RNA binding protein 1 [Source:NCBI gene;... [more]
elavl13.520e-941.94ELAV like RNA binding protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif3g1.882e-5839.84eukaryotic translation initiation factor 3, subuni... [more]
Elavl23.692e-929.59ELAV like RNA binding protein 1 [Source:MGI Symbol... [more]
Srsf92.216e-837.65serine/arginine-rich splicing factor 9 [Source:MGI... [more]
Rbmx2.754e-836.99RNA binding motif protein, X chromosome [Source:MG... [more]
Elavl13.248e-835.00ELAV (embryonic lethal, abnormal vision)-like 1 (H... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DJI8|EI3GA_XENLA3.065e-6141.60Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q641B2|EI3GB_XENLA3.450e-6141.60Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q28CY2|EIF3G_XENTR1.245e-6041.60Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q3ZC12|EIF3G_BOVIN9.337e-5839.84Eukaryotic translation initiation factor 3 subunit... [more]
sp|O75821|EIF3G_HUMAN1.120e-5739.84Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1FMX81.191e-6643.80Eukaryotic translation initiation factor 3 subunit... [more]
A0A433TWG34.459e-6543.73Eukaryotic translation initiation factor 3 subunit... [more]
A0A1S3JUV01.381e-6443.41Eukaryotic translation initiation factor 3 subunit... [more]
A0A0B6Y8M15.282e-6443.19RRM domain-containing protein (Fragment) OS=Arion ... [more]
A0A0B6YAL86.911e-6443.19RRM domain-containing protein (Fragment) OS=Arion ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif3g8.761e-6041.37eukaryotic translation initiation factor 3 subunit... [more]
eif3g1.442e-5941.37eukaryotic translation initiation factor 3 subunit... [more]
ENSAMXT00000032401.18.805e-1043.33pep primary_assembly:Astyanax_mexicanus-2.0:18:890... [more]
raver11.426e-936.49ribonucleoprotein, PTB binding 1 [Source:NCBI gene... [more]
raver11.483e-936.49ribonucleoprotein, PTB binding 1 [Source:NCBI gene... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002832.14.953e-938.46pep scaffold:Pmarinus_7.0:GL476732:699988:701739:-... [more]
tra2a1.896e-831.73transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
RBM394.037e-837.50RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
ENSPMAT00000008846.11.270e-732.88pep scaffold:Pmarinus_7.0:GL480623:147895:156346:1... [more]
RBM394.214e-737.50RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TIF351.565e-3131.70eIF3g subunit of the eukaryotic translation initia... [more]
NOP151.087e-825.95Constituent of 66S pre-ribosomal particles; involv... [more]
PAB13.251e-730.86Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
GBP25.305e-735.80Poly(A+) RNA-binding protein; key surveillance fac... [more]
PUB11.051e-629.07Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO358461.260e-5839.85Eukaryotic translation initiation factor 3 subunit... [more]
EDO288573.194e-1942.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457027.789e-936.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301491.490e-838.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479282.086e-838.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF3G1.501e-5641.32eukaryotic translation initiation factor 3 subunit... [more]
raver11.244e-936.49ribonucleoprotein, PTB binding 1 [Source:NCBI gene... [more]
elavl1a7.427e-937.50ELAV-like protein 1 [Source:NCBI gene;Acc:10117031... [more]
tra2a1.351e-833.33transformer-2 protein homolog alpha [Source:NCBI g... [more]
ENSORLT00000000111.21.806e-840.79ELAV-like protein 1 [Source:NCBI gene;Acc:10117239... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit G vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016857.10.000e+0100.00SMESG000016857.1[more]
SMESG000074687.12.688e-13066.18SMESG000074687.1[more]
SMESG000074687.14.452e-10558.58SMESG000074687.1[more]
SMESG000081081.13.396e-1032.14SMESG000081081.1[more]
SMESG000081081.13.691e-1032.14SMESG000081081.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001326 ID=SMED30001326|Name=Eukaryotic translation initiation factor 3 subunit G|organism=Schmidtea mediterranea sexual|type=transcript|length=992bp
TTGTTTTAAAAAATAAATAATATTGAAGATTTAAAAATGACTGAAACGTT
AACCACATGGGACATTCAAGAAGATGATATTAGGGATACAGAAAATTTAA
TTTTCGATGAAAATACTGGGTTTTACACAAAAACTAGAGATATTTTTAAT
GATGAAGATAAGCCGTGTCGTGAAATTTTATTGTATAAATTACAGACTTT
TGAAGTTTCCGAATCTGTTAAAGCTCGTAAATTGTACAAAAAATTTGGAA
AAGCAAAAAACGATCCTCCAGGCCCGAATCCGGCCCAAACATATCTAGGA
GATGAATTATTTATGAAGTTCGTTGCTGATGAAATTGCACCCATCGAAGA
AGAAAAGAAAGCTTCGGTTCAAAGTGTTAAGTGCCGTAATTGTCAAGGTG
AACATTTCACACACAAATGTCCTTATAAGGAAGAAATGAAAAGCATTCAA
GAATTGACTGAACAAATTGACAATATCAATGCTGAATCATCGCCAAATGA
CAAAAAAACAACTTCAGATACCGTCTTGAAACCGGCTTCTGGTGCTTATT
TACCGCCGCATATGCGAGATAATGCTCCACGACCATTTTCTGATAAGAAA
CGATCAGATAGTGCTCTTACAATTCGAGTCAGCAATTTACCAGAAGCTGC
TCAAGAAAGTGATTTGGATGATTTATTTAGACCATTTGGTAATATTTCAA
GAACTTTCCTGGTTAAAGATAGACAAACCGGATTATCTAGAGGTTTTGCT
TATGTGACATTTACAAGCCGTTCTGACGCAGCTAAAGCAATCGAAGGTGT
CAATGGATTTGGATATGATCATTGCATTCTACAAGTCCAATGGTCGGAAT
GATTTTTCTGTCGAAATTTGAATTATTTGAAATATAATTAATATTTGATG
TTTTATACTTAATTTATTGCAAATTATATTTTTGGAAATGGAATATTTTA
ATCGATCTGACATTATTTGTAATAAATTTTGGTGTTTTTTGG
back to top

protein sequence of SMED30001326-orf-1

>SMED30001326-orf-1 ID=SMED30001326-orf-1|Name=SMED30001326-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=272bp
MTETLTTWDIQEDDIRDTENLIFDENTGFYTKTRDIFNDEDKPCREILLY
KLQTFEVSESVKARKLYKKFGKAKNDPPGPNPAQTYLGDELFMKFVADEI
APIEEEKKASVQSVKCRNCQGEHFTHKCPYKEEMKSIQELTEQIDNINAE
SSPNDKKTTSDTVLKPASGAYLPPHMRDNAPRPFSDKKRSDSALTIRVSN
LPEAAQESDLDDLFRPFGNISRTFLVKDRQTGLSRGFAYVTFTSRSDAAK
AIEGVNGFGYDHCILQVQWSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001732formation of cytoplasmic translation initiation complex
GO:0002183cytoplasmic translational initiation
GO:0001731formation of translation preinitiation complex
GO:0006412translation
GO:0006413translational initiation
GO:0006446regulation of translational initiation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR034240eIF3G_RRM
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR017334eIF3_g
IPR024675eIF3g_N
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003743translation initiation factor activity
GO:0000166nucleotide binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005852eukaryotic translation initiation factor 3 complex
GO:0016282eukaryotic 43S preinitiation complex
GO:0033290eukaryotic 48S preinitiation complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 130..150
NoneNo IPR availablePIRSFPIRSF037949Transl_init_eIF-3_RNA-bindcoord: 2..271
e-value: 1.1E-69
score: 232.6
NoneNo IPR availablePANTHERPTHR10352EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT Gcoord: 53..270
NoneNo IPR availablePANTHERPTHR10352:SF0EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT Gcoord: 53..270
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 195..268
e-value: 2.3E-22
score: 90.3
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 196..263
e-value: 2.8E-19
score: 68.7
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 194..271
score: 17.199
IPR024675Eukaryotic translation initiation factor 3 subunit G, N-terminalPFAMPF12353eIF3gcoord: 23..133
e-value: 3.5E-25
score: 88.8
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 120..271
e-value: 2.3E-24
score: 88.1
IPR034240eIF3G, RNA recognition motifCDDcd12408RRM_eIF3G_likecoord: 195..271
e-value: 5.65084E-40
score: 131.508
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 172..270