slc25a-12

Overview
Nameslc25a-12 (AKN21580.1)
Smed IDSMED30001325
Length (bp)1264
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-12 (SMED30001325) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-12 (SMED30001325) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-12 (SMED30001325) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-12 (SMED30001325) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001325

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30001325SMESG000064880.1 dd_Smed_v4_2449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30001325SMESG000064880.1 dd_Smed_v6_2449_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30001325SMESG000064880.1 dd_Smed_v4_2449_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001325SMESG000064880.1 dd_Smed_v4_2449_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30001325SMESG000064880.1 H.45.8gsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30001325SMESG000064880.1 H.45.8gsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-12 vs. Ensembl Human
Match: SLC25A48 (solute carrier family 25 member 48 [Source:HGNC Symbol;Acc:HGNC:30451])

HSP 1 Score: 128.642 bits (322), Expect = 2.597e-33
Identity = 95/292 (32.53%), Postives = 148/292 (50.68%), Query Frame = 3
Query:  363 NLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGV-GQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL------DPEG---KSNFANILSGALSGVVQLIPGTPVEVIKI--HMQNDAIKKGNL-------------IKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA-FVSGGIAGALSWVLLIPQDVMKTRIQA-GV----DKDIMDSF-RALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
             L +F +G +GG+A +  GHPLDTVKT  Q           I  V  +     F++G+S P  S A  N+ +F  +   QR L      +PE    ++    +L+  ++GVV +  G PV++IKI   MQ    +  NL                GP+  I  IVRN+G+ GLY+G      RDVP + +YF  Y  ++ +++      P+  A +++GG+AGA+SW    P DV+K+R+QA GV     K ++D   ++ +  G + FFRG T+  +R   ++A  F  YE
Sbjct:    5 QLEDFAAGWIGGAASVIVGHPLDTVKTRLQAGVGYGNTLSCIRVVYRRESMFGFFKGMSFPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGLGGPVDLIKIRLQMQTQPFRDANLGLKSRAVAPAEQPAYQGPVHCITTIVRNEGLAGLYRGASAMLLRDVPGYCLYFIPYVFLSEWITPEACTGPSPCAVWLAGGMAGAISWGTATPMDVVKSRLQADGVYLNKYKGVLDCISQSYQKEGLKVFFRGITVNAVRGFPMSAAMFLGYE 296          
BLAST of slc25a-12 vs. Ensembl Human
Match: SLC25A45 (solute carrier family 25 member 45 [Source:HGNC Symbol;Acc:HGNC:27442])

HSP 1 Score: 122.479 bits (306), Expect = 2.740e-31
Identity = 91/280 (32.50%), Postives = 131/280 (46.79%), Query Frame = 3
Query:  372 EFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQH-GYKTFYRGLSLPFWSYAGVNACLF----------TSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIK-----NGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNP-TLRAFVSGGIAGALSWVLLIPQDVMKTRIQAG-----VDKDIMDSF-RALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            EF +G + G+ GL  GHP DTVK   Q  T    I + +  + +H     F++G+S P  S A VN+ LF          T+    +R   P   S     L+G   G +Q     P ++IK+ +QN    +           GP+     I R +G  GL++G      RD P   IYF +YE +    +  E  NP +    V+GG AG  SWV   P D++K+R+Q       V + ++D    ++R  G   FFRG T+ + RA  VNAVTF  YE
Sbjct:    5 EFVAGWISGALGLVLGHPFDTVKVRLQTQTTYRGIVDCMVKIYRHESLLGFFKGMSFPIASIAVVNSVLFGVYSNTLLVLTATSHQERRAQP--PSYMHIFLAGCTGGFLQAYCLAPFDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTP-EGQNPSSATVLVAGGFAGIASWVAATPLDMIKSRMQMDGLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYE 281          
BLAST of slc25a-12 vs. Ensembl Human
Match: SLC25A45 (solute carrier family 25 member 45 [Source:HGNC Symbol;Acc:HGNC:27442])

HSP 1 Score: 122.479 bits (306), Expect = 2.740e-31
Identity = 91/280 (32.50%), Postives = 131/280 (46.79%), Query Frame = 3
Query:  372 EFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQH-GYKTFYRGLSLPFWSYAGVNACLF----------TSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIK-----NGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNP-TLRAFVSGGIAGALSWVLLIPQDVMKTRIQAG-----VDKDIMDSF-RALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            EF +G + G+ GL  GHP DTVK   Q  T    I + +  + +H     F++G+S P  S A VN+ LF          T+    +R   P   S     L+G   G +Q     P ++IK+ +QN    +           GP+     I R +G  GL++G      RD P   IYF +YE +    +  E  NP +    V+GG AG  SWV   P D++K+R+Q       V + ++D    ++R  G   FFRG T+ + RA  VNAVTF  YE
Sbjct:    5 EFVAGWISGALGLVLGHPFDTVKVRLQTQTTYRGIVDCMVKIYRHESLLGFFKGMSFPIASIAVVNSVLFGVYSNTLLVLTATSHQERRAQP--PSYMHIFLAGCTGGFLQAYCLAPFDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTP-EGQNPSSATVLVAGGFAGIASWVAATPLDMIKSRMQMDGLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYE 281          
BLAST of slc25a-12 vs. Ensembl Human
Match: SLC25A47 (solute carrier family 25 member 47 [Source:HGNC Symbol;Acc:HGNC:20115])

HSP 1 Score: 122.094 bits (305), Expect = 6.227e-31
Identity = 92/300 (30.67%), Postives = 136/300 (45.33%), Query Frame = 3
Query:  369 IEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKT--FYRGLSLPFWSYAGVNACLFTSYKFF------QRLLDPEGKSNFANI-LSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIK------------------------NGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLR-AFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRAL--------RNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            ++F +GA+GG  G+A G+PLDTVK   Q   K   I   +     H  +   FYRGLSLP  + + V++  F +Y+         R  +P+ K   A+I LSG  SG+V++   +P EV K+ +Q     +    +                         GP+  +  + R +G+ GLYKG      RD  +F  YF SY  +  ++S      P +    V+GG AG L+W +  P DV+K+R+QA  D      +R L        R  G    F+G  +   RA  VN V F  YE
Sbjct:    1 MDFVAGAIGGVCGVAVGYPLDTVKVRIQTEPKYTGIWHCVRDT-YHRERVWGFYRGLSLPVCTVSLVSSVSFGTYRHCLAHICRLRYGNPDAKPTKADITLSGCASGLVRVFLTSPTEVAKVRLQTQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYKGSSALVLRDGHSFATYFLSYAVLCEWLSPAGHSRPDVPGVLVAGGCAGVLAWAVATPMDVIKSRLQA--DGQGQRRYRGLLHCMVTSVREEGPRVLFKGLVLNCCRAFPVNMVVFVAYE 297          
BLAST of slc25a-12 vs. Ensembl Human
Match: SLC25A48 (solute carrier family 25 member 48 [Source:HGNC Symbol;Acc:HGNC:30451])

HSP 1 Score: 117.087 bits (292), Expect = 9.740e-29
Identity = 83/267 (31.09%), Postives = 135/267 (50.56%), Query Frame = 3
Query:  363 NLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGV-GQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL------DPEG---KSNFANILSGALSGVVQLIPGTPVEVIKI--HMQNDAIKKGNL-------------IKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA-FVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNIGFESFFRGG 1085
             L +F +G +GG+A +  GHPLDTVKT  Q           I  V  +     F++G+S P  S A  N+ +F  +   QR L      +PE    ++    +L+  ++GVV +  G PV++IKI   MQ    +  NL                GP+  I  IVRN+G+ GLY+G      RDVP + +YF  Y  ++ +++      P+  A +++GG+AGA+SW    P DV+K+R+QA  D   ++ ++ + +   +S+ + G
Sbjct:    5 QLEDFAAGWIGGAASVIVGHPLDTVKTRLQAGVGYGNTLSCIRVVYRRESMFGFFKGMSFPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGLGGPVDLIKIRLQMQTQPFRDANLGLKSRAVAPAEQPAYQGPVHCITTIVRNEGLAGLYRGASAMLLRDVPGYCLYFIPYVFLSEWITPEACTGPSPCAVWLAGGMAGAISWGTATPMDVVKSRLQA--DGVYLNKYKGVLDCISQSYQKEG 269          
BLAST of slc25a-12 vs. Ensembl Celegans
Match: R07B7.10 (pep chromosome:WBcel235:V:12084186:12086460:1 gene:WBGene00011094.1 transcript:R07B7.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R07B7.10)

HSP 1 Score: 120.553 bits (301), Expect = 4.467e-31
Identity = 87/272 (31.99%), Postives = 133/272 (48.90%), Query Frame = 3
Query:  408 LAFGHPLDTVKTVTQNSTKRMAISEGIAG-----VGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSN--------FANILSGALSG-VVQLIPGTPVEVIKIHMQNDAIKKGNLIKN------GPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMD----SFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECH 1151
            L  GHPLDTVK   Q     M I +GI       + Q      Y+G+ +PF S   +++ LF  Y    + L+P G SN         ++IL  ++ G +VQ+ P  PVE++K  +Q      G+  K+      GP+   R  VR +G+ GL+KG  +   RD   ++ Y   YE ++ Y     L N   + F +GG AG   W+ + P +V+K RIQA      +     + +  R  G  +F+RGG  ++LR  +VNAV F +YE  +
Sbjct:   16 LLVGHPLDTVKARLQT----MNIYKGIVDCMVKTMKQESVYGLYKGMFVPFISTGALHSLLFAGYGAGLKFLNP-GDSNVMARKDLPMSDILIASICGTLVQVGPVIPVELLKTKLQVQRENIGHFSKHSRNLYAGPLECARETVRAEGVRGLFKGGSVVFCRDNIGYLFYIPVYEGLSRYFRSHNLENTWTQLF-AGGCAGVSGWISVCPLEVVKNRIQADKSHKTLSPKEMTLKIYREDGLRAFYRGGWAISLRGFVVNAVIFVVYENTY 281          
BLAST of slc25a-12 vs. Ensembl Celegans
Match: slc-25A29 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q18844])

HSP 1 Score: 119.013 bits (297), Expect = 3.273e-30
Identity = 87/280 (31.07%), Postives = 139/280 (49.64%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAG-----VGQHGYKTFYRGLSLPFWSYAGVNACLFTSY-KFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIK--IHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA---FVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNI----GFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            L++ F+G++GG+AG+  GHPLDTVK   Q  +       G        V + G++  Y+G+S P  S + +NA +F  +    +++ DP+  S  ++ + G  +G+ Q +   P E IK  + +Q+D   K +   NGPI   ++++R  G+  L +G      RD PAF +YF SYE +   M K +    TL +     +GG AG LSW+     D++K+R QA  D         ++      G+  FF G     +RA   NA TF   E  ++ L
Sbjct:    4 LLDLFAGSLGGAAGVLAGHPLDTVKVRLQTQSGPTPQYRGTFHCFKLIVQKEGFRGLYKGMSSPLLSLSAINAIVFGVHGGTCRQMEDPD--SITSHFVGGCAAGMAQSVIAAPTERIKLLLQIQDD---KAHTKFNGPIDATKQLLRTHGLKSLTRGFLATVARDAPAFGVYFASYEWMARSMCK-DGETSTLSSGQLLFAGGTAGMLSWLFNYQTDIIKSRFQA--DNSYKSYMHCIKQTYLERGYRGFFVGLNSALIRAFPSNAATFFTVEWTYRIL 275          
BLAST of slc25a-12 vs. Ensembl Celegans
Match: slc-25A29 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q18844])

HSP 1 Score: 119.013 bits (297), Expect = 4.949e-30
Identity = 87/280 (31.07%), Postives = 139/280 (49.64%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAG-----VGQHGYKTFYRGLSLPFWSYAGVNACLFTSY-KFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIK--IHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA---FVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNI----GFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            L++ F+G++GG+AG+  GHPLDTVK   Q  +       G        V + G++  Y+G+S P  S + +NA +F  +    +++ DP+  S  ++ + G  +G+ Q +   P E IK  + +Q+D   K +   NGPI   ++++R  G+  L +G      RD PAF +YF SYE +   M K +    TL +     +GG AG LSW+     D++K+R QA  D         ++      G+  FF G     +RA   NA TF   E  ++ L
Sbjct:    4 LLDLFAGSLGGAAGVLAGHPLDTVKVRLQTQSGPTPQYRGTFHCFKLIVQKEGFRGLYKGMSSPLLSLSAINAIVFGVHGGTCRQMEDPD--SITSHFVGGCAAGMAQSVIAAPTERIKLLLQIQDD---KAHTKFNGPIDATKQLLRTHGLKSLTRGFLATVARDAPAFGVYFASYEWMARSMCK-DGETSTLSSGQLLFAGGTAGMLSWLFNYQTDIIKSRFQA--DNSYKSYMHCIKQTYLERGYRGFFVGLNSALIRAFPSNAATFFTVEWTYRIL 275          
BLAST of slc25a-12 vs. Ensembl Celegans
Match: slc-25A29 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q18844])

HSP 1 Score: 119.013 bits (297), Expect = 6.965e-30
Identity = 87/280 (31.07%), Postives = 139/280 (49.64%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAG-----VGQHGYKTFYRGLSLPFWSYAGVNACLFTSY-KFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIK--IHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA---FVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNI----GFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            L++ F+G++GG+AG+  GHPLDTVK   Q  +       G        V + G++  Y+G+S P  S + +NA +F  +    +++ DP+  S  ++ + G  +G+ Q +   P E IK  + +Q+D   K +   NGPI   ++++R  G+  L +G      RD PAF +YF SYE +   M K +    TL +     +GG AG LSW+     D++K+R QA  D         ++      G+  FF G     +RA   NA TF   E  ++ L
Sbjct:    4 LLDLFAGSLGGAAGVLAGHPLDTVKVRLQTQSGPTPQYRGTFHCFKLIVQKEGFRGLYKGMSSPLLSLSAINAIVFGVHGGTCRQMEDPD--SITSHFVGGCAAGMAQSVIAAPTERIKLLLQIQDD---KAHTKFNGPIDATKQLLRTHGLKSLTRGFLATVARDAPAFGVYFASYEWMARSMCK-DGETSTLSSGQLLFAGGTAGMLSWLFNYQTDIIKSRFQA--DNSYKSYMHCIKQTYLERGYRGFFVGLNSALIRAFPSNAATFFTVEWTYRIL 275          
BLAST of slc25a-12 vs. Ensembl Celegans
Match: slc-25A29 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q18844])

HSP 1 Score: 119.013 bits (297), Expect = 6.965e-30
Identity = 87/280 (31.07%), Postives = 139/280 (49.64%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAG-----VGQHGYKTFYRGLSLPFWSYAGVNACLFTSY-KFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIK--IHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA---FVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNI----GFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            L++ F+G++GG+AG+  GHPLDTVK   Q  +       G        V + G++  Y+G+S P  S + +NA +F  +    +++ DP+  S  ++ + G  +G+ Q +   P E IK  + +Q+D   K +   NGPI   ++++R  G+  L +G      RD PAF +YF SYE +   M K +    TL +     +GG AG LSW+     D++K+R QA  D         ++      G+  FF G     +RA   NA TF   E  ++ L
Sbjct:    4 LLDLFAGSLGGAAGVLAGHPLDTVKVRLQTQSGPTPQYRGTFHCFKLIVQKEGFRGLYKGMSSPLLSLSAINAIVFGVHGGTCRQMEDPD--SITSHFVGGCAAGMAQSVIAAPTERIKLLLQIQDD---KAHTKFNGPIDATKQLLRTHGLKSLTRGFLATVARDAPAFGVYFASYEWMARSMCK-DGETSTLSSGQLLFAGGTAGMLSWLFNYQTDIIKSRFQA--DNSYKSYMHCIKQTYLERGYRGFFVGLNSALIRAFPSNAATFFTVEWTYRIL 275          
BLAST of slc25a-12 vs. Ensembl Fly
Match: CG5646 (gene:FBgn0039525 transcript:FBtr0085210)

HSP 1 Score: 126.331 bits (316), Expect = 6.267e-33
Identity = 92/290 (31.72%), Postives = 133/290 (45.86%), Query Frame = 3
Query:  360 KNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFAN--------ILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLI--KNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYM---------------SKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRAL----RNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            +N  +F +G  GG+ G+   HPLDT+K   Q S   +  +        +G   FYRG+  PF S   +N+ LF  Y    R L     S++           L+G+++G VQ     P+E+IK+ +Q        L   +       +RI++ DGI GLY+G+     RDV  + IY  +Y     YM               S + L+  TL    +G  AG +SWV +IP DV+KT +QA  +      F  +    R  G+ S FRG  ML  RA+  NA TF  YE
Sbjct:    4 ENYCDFVAGCFGGACGVLVAHPLDTIKVWQQASNSSVVTAIQQIYSRNNGVNGFYRGMFFPFISTGAINSLLFGIYGNHLRQLRKVCHSDYQREQLEYHNMFLAGSVAGFVQSFIACPMELIKVRLQTATYYSDYLYGQRRTAFGTFKRILKTDGISGLYRGLLPMMCRDVLPYGIYMLAYRQGVDYMDRRDFVRRRRSQSDGSSVNLLVTTL----AGAWAGVISWVCVIPFDVVKTLMQADENHKYRGIFHCVRVQYRAYGWRSIFRGSWMLVARAVPFNAATFLGYE 289          
BLAST of slc25a-12 vs. Ensembl Fly
Match: CG4995 (gene:FBgn0032219 transcript:FBtr0079989)

HSP 1 Score: 127.487 bits (319), Expect = 1.364e-32
Identity = 91/286 (31.82%), Postives = 139/286 (48.60%), Query Frame = 3
Query:  324 DKRLEAARQEFR-KNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKT---------FYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQA---GVDKD----IMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTF 1130
            D +L+A  + F  K +++F +G +GG+AG+  GHP DTVK   Q    R    +G      H ++T          YRG+S P      VNA +F  Y   QRL + +  S  ++  +G+++GV Q     P+E+ K  +Q        +   GPI  ++ IV+ +GI G +KG+     RD+P F  YF S+E    Y+ +           ++GG AG  SW+   P DV+KT +QA   G +      I  + +  RN G + FFRG     +RA  +NA  F
Sbjct:   26 DIQLKATSETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTF----HCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRLSN-DPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFE----YLMRQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACF 302          
BLAST of slc25a-12 vs. Ensembl Fly
Match: CG4995 (gene:FBgn0032219 transcript:FBtr0079990)

HSP 1 Score: 127.487 bits (319), Expect = 1.364e-32
Identity = 91/286 (31.82%), Postives = 139/286 (48.60%), Query Frame = 3
Query:  324 DKRLEAARQEFR-KNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKT---------FYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQA---GVDKD----IMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTF 1130
            D +L+A  + F  K +++F +G +GG+AG+  GHP DTVK   Q    R    +G      H ++T          YRG+S P      VNA +F  Y   QRL + +  S  ++  +G+++GV Q     P+E+ K  +Q        +   GPI  ++ IV+ +GI G +KG+     RD+P F  YF S+E    Y+ +           ++GG AG  SW+   P DV+KT +QA   G +      I  + +  RN G + FFRG     +RA  +NA  F
Sbjct:   26 DIQLKATSETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTF----HCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRLSN-DPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFE----YLMRQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACF 302          
BLAST of slc25a-12 vs. Ensembl Fly
Match: CG4995 (gene:FBgn0032219 transcript:FBtr0079991)

HSP 1 Score: 122.865 bits (307), Expect = 3.755e-31
Identity = 87/272 (31.99%), Postives = 131/272 (48.16%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKT---------FYRGLSLPFWSYAGVNACLFTSYKFFQRLL-DPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQA---GVDKD----IMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTF 1130
            +++F +G +GG+AG+  GHP DTVK   Q    R    +G      H ++T          YRG+S P      VNA +F  Y   QRL  DP   +  ++  +G+++GV Q     P+E+ K  +Q        +   GPI  ++ IV+ +GI G +KG+     RD+P F  YF S+E    Y+ +           ++GG AG  SW+   P DV+KT +QA   G +      I  + +  RN G + FFRG     +RA  +NA  F
Sbjct:    2 VVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTF----HCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRLSNDPNSLT--SHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFE----YLMRQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACF 263          
BLAST of slc25a-12 vs. Ensembl Fly
Match: CG4995 (gene:FBgn0032219 transcript:FBtr0331665)

HSP 1 Score: 122.865 bits (307), Expect = 3.755e-31
Identity = 87/272 (31.99%), Postives = 131/272 (48.16%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKT---------FYRGLSLPFWSYAGVNACLFTSYKFFQRLL-DPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQA---GVDKD----IMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTF 1130
            +++F +G +GG+AG+  GHP DTVK   Q    R    +G      H ++T          YRG+S P      VNA +F  Y   QRL  DP   +  ++  +G+++GV Q     P+E+ K  +Q        +   GPI  ++ IV+ +GI G +KG+     RD+P F  YF S+E    Y+ +           ++GG AG  SW+   P DV+KT +QA   G +      I  + +  RN G + FFRG     +RA  +NA  F
Sbjct:    2 VVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTF----HCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRLSNDPNSLT--SHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFE----YLMRQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACF 263          
BLAST of slc25a-12 vs. Ensembl Zebrafish
Match: FO704822.1 (solute carrier family 25 member 45 [Source:NCBI gene;Acc:100329446])

HSP 1 Score: 129.798 bits (325), Expect = 4.041e-34
Identity = 87/265 (32.83%), Postives = 132/265 (49.81%), Query Frame = 3
Query:  396 GSAGLAFGHPLDTVKTVTQNSTKRMAISEG-IAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL------DPEGKSNFANI-LSGALSGVVQLIPGTPVEVIKIHMQNDAIKK--GNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAG-----VDKDIMDSFR-ALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            G+ GL  GHPLDTVK   Q  +    I +  I    + G   F++G+S P  S A  NA  F SY      L      D   +S  + + ++G  SG+ QL    P++++K+ +QN    +  GN  + GP+  +  IVR DG+ GL++G    A RDVP + +YF  YE     M++            +GG+AG ++W    P DV+K R+Q       V   +++    ++R  G   FF+G  + ++RA  VNAVTF  YE
Sbjct:   23 GAVGLVVGHPLDTVKVRLQTQSVYGGILDCVIKTYTREGLHGFFKGMSFPVLSVAVSNAVAFGSYSNALDYLTQSHHNDHSQRSPLSYVFMAGCFSGLAQLFVTAPIDLVKVRLQNQTRSRSAGNKYR-GPLHCVAVIVREDGLKGLFRGFWALALRDVPCYGLYFLPYEFTLRMMTEKGKQPGHCAVLAAGGVAGVITWACATPMDVVKARLQMSGGGGRVYSGVLNCITVSVREEGIRVFFKGLLLNSVRAFPVNAVTFLSYE 286          

HSP 2 Score: 62.7734 bits (151), Expect = 1.502e-10
Identity = 53/183 (28.96%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  375 FFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAG--------VGQHGYKTFYRGLSLPFWSYAGVNA-CL---FTSYKFFQRLLDPEGKS--NFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECI 881
            F +G   G A L    P+D VK   QN T+  +      G        V + G K  +RG    FW+ A  +  C    F  Y+F  R++  +GK   + A + +G ++GV+     TP++V+K  +Q      G  + +G +  I   VR +GI   +KG+ +++ R  P   + F SYE I
Sbjct:  112 FMAGCFSGLAQLFVTAPIDLVKVRLQNQTRSRSAGNKYRGPLHCVAVIVREDGLKGLFRG----FWALALRDVPCYGLYFLPYEFTLRMMTEKGKQPGHCAVLAAGGVAGVITWACATPMDVVKARLQMSG--GGGRVYSGVLNCITVSVREEGIRVFFKGLLLNSVRAFPVNAVTFLSYEMI 288          
BLAST of slc25a-12 vs. Ensembl Zebrafish
Match: slc25a48 (solute carrier family 25 member 48 [Source:NCBI gene;Acc:436640])

HSP 1 Score: 121.324 bits (303), Expect = 6.513e-31
Identity = 87/299 (29.10%), Postives = 144/299 (48.16%), Query Frame = 3
Query:  363 NLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGV-GQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDP----EGKSNFANI---LSGALSGVVQLIPGTPVEVIKIHMQNDA----IKKGNLIKNG-----------------PIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMN-PTLRAFVSGGIAGALSWVLLIPQDVMKTRIQA---------GVDKDIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
             L +F +G +GG++ +  GHPLDTVKT  Q           +  +  +     F++GLS P  S    N+ +F  +   QRL+      +G+   + +   ++  L+G+V +  G PV+++KI +Q        +  NL  NG                 P+  I  +++N+GI GLY+G G    RD+P + +YF  Y     +++  +  + P    +++GG+AG++SWV   P DV+K+R+QA         G+   IM S+R     G   FFRG T+  +R   + A  F  YE
Sbjct:    5 QLDDFLAGWIGGASSVIVGHPLDTVKTRLQAGKGYKNTFHCVVTIYKKENVIGFFKGLSFPLASITLYNSMVFGFFSNTQRLISKYRYGDGRHPCSMLDLTVASMLTGLVSVGVGAPVDLVKIRLQMQTQPVLAENFNLAGNGSVPLRSMGIQSQSFYRGPLHCISTVLQNEGIQGLYRGAGAMILRDIPGYALYFIPYTLFCNWLNPDDNSSPPPCCIWLAGGLAGSISWVTATPSDVVKSRLQADAMHQRKYKGILHCIMQSYRTE---GIHVFFRGATVNAIRGFPMCATMFLGYE 300          
BLAST of slc25a-12 vs. Ensembl Zebrafish
Match: slc25a20 (solute carrier family 25 member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1869])

HSP 1 Score: 114.39 bits (285), Expect = 1.871e-28
Identity = 87/295 (29.49%), Postives = 136/295 (46.10%), Query Frame = 3
Query:  342 ARQEFRKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTK-RMAISEGIAG--------VGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLD--PEGKSNFANILS-GALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYM-----SKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRA-----LRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            ++Q+    +  FF+G  GG   +  GHPLDT+K   Q   K R       AG        + + G +  Y+G++ P      + A  F  +   ++L    P+    +  + + G LSGV       P E IK  +Q  A   G +   GP+  ++++ R  GI G+YKG  +   RDVPA  +YF +YE +   +     S  EL  P++    +GG+AG  +W + IP DV+K+R Q   +    + FR      +R  G  S ++G   + LRA   NA  F  +E   K L
Sbjct:    2 SKQQPISPMKNFFAGGFGGVCLVFAGHPLDTIKVRLQTQPKPRPGEVAQYAGTFDCFKKTLAKEGVRGLYKGMAAPIIGVTPMFAVCFFGFGLGKKLQQKTPDDILTYPQLFAAGMLSGVFTTAIMAPGERIKCLLQIQA-ASGQVKYAGPMDCVKQLYRESGIRGIYKGTALTLMRDVPASGMYFMTYEWLKHALTPEGKSPSELSVPSI--LFAGGMAGIFNWAVAIPPDVLKSRFQTAPEGKYPNGFRDVLRELVREEGVRSLYKGFNAVMLRAFPANAACFLGFEVAMKFL 293          
BLAST of slc25a-12 vs. Ensembl Zebrafish
Match: slc25a47a (solute carrier family 25 member 47a [Source:NCBI gene;Acc:724009])

HSP 1 Score: 114.39 bits (285), Expect = 2.010e-28
Identity = 84/292 (28.77%), Postives = 137/292 (46.92%), Query Frame = 3
Query:  372 EFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIA-GVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANI---LSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNL-----IK---NGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLR-AFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFR--------------ALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQS 1166
            +F +G+ GG+ G+A G+PLDTVK   Q   +   I + I   + + G   F++G+ LP  + +  ++ +F +Y+   + L    K+    +   +SG   GV Q+   +P +++K+ +Q     + ++     +K   +GPI  +  I R  G+ GLY+G    A RD P+F  YF +Y  +   ++      P      +SGG+AG   W +  P DV+K R+Q       MD  R                R  G   FFR   +  LRA  VN V F +YE   + L+S
Sbjct:    5 DFLAGSFGGACGVAVGYPLDTVKVRIQTQKQFTGIWQCIVLTIRKEGVHGFFKGMFLPITTISMTSSVVFGTYRNCLQALSYIRKAENTKLDVFMSGLAGGVAQVSVMSPGDIVKVRLQCQTESRHSVNPKYSVKPKYSGPIHCLLSICREQGLSGLYRGALPLALRDGPSFATYFLTYHTLCARLTPDGQKEPEWTVVLLSGGVAGMSGWAVGTPMDVIKARLQ-------MDGVRGQRRYRGLLHCLTVTTRTEGLGVFFRSLGINCLRAFPVNMVVFAVYEVSVRVLRS 289          
BLAST of slc25a-12 vs. Ensembl Zebrafish
Match: si:dkey-150i13.2 (si:dkey-150i13.2 [Source:ZFIN;Acc:ZDB-GENE-090312-157])

HSP 1 Score: 110.538 bits (275), Expect = 4.180e-27
Identity = 87/298 (29.19%), Postives = 140/298 (46.98%), Query Frame = 3
Query:  315 VSTDKRLEAARQEFRKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGI-----AGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL--DPEGKSNFANI-LSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKM-ELMN--PTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNI----GFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQ 1163
            V +D+R+          L  F +G  GG   L  GHPLDT+K   Q  T+  A+ +G        V + G    Y+G+  P      + A  F  +   + LL  DP   + +  I L+G L+GV   +   P E IK  +Q   +  G +   GP+    R+ +  GI  +YKG  +   RDVP+  +YF +Y+ +  Y++   E ++   T R  ++GGIAG ++W++ +P DV+K+  Q+  D         LR +    G +  ++G + + LRA   NA  F  +E   K L 
Sbjct:    4 VESDRRVSP--------LKNFVAGGFGGICLLLAGHPLDTIKVRLQ--TQDCAVYKGTFDCFRKTVSKEGIFGLYKGMGAPLAGVTPMMALNFFGFGLGKELLQRDPTVPATYTQIYLAGMLAGVCTTVIVAPGERIKCLLQILPLA-GRMKYTGPLDCAVRLYKQQGICSVYKGTILTLIRDVPSNGVYFLTYDYLKHYLTPDGECVHHLSTSRVLLAGGIAGMINWLIALPADVLKSNYQSATDGRYQGVRHVLRTLLKEEGAQGLYKGFSAVMLRAFPANAACFLGFEVALKYLN 290          
BLAST of slc25a-12 vs. Ensembl Xenopus
Match: slc25a45 (solute carrier family 25 member 45 [Source:NCBI gene;Acc:100127755])

HSP 1 Score: 138.272 bits (347), Expect = 4.050e-37
Identity = 95/282 (33.69%), Postives = 145/282 (51.42%), Query Frame = 3
Query:  372 EFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKT---FYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFAN-------ILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIK--------NGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFV-SGGIAGALSWVLLIPQDVMKTRIQA----GVDK-DIMDSFR-ALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            EF +G + G+ GL  GHP+DTVK   Q  ++   I + +  +  +  +T   F++G+S P  S A  N+  F SY      L  +   N+ N        ++G  SG+VQL    PV+++K+ +QN     GN  +         GP+     I R +GI GLY+G    A RD+P+  +YF +YE +  +M+K  L  P+    + +GG AG + W    P DV+K R+Q     GV    ++D  R ++R  G + F +G T+ +LRA  VNAVTF  YE
Sbjct:    5 EFIAGWISGALGLVVGHPVDTVKVRLQTQSRYRGILDCV--IQTYRNETIFGFFKGMSFPVGSVAISNSLAFGSYSNALLYLSDQEIKNWKNPPHNCHVFMAGCFSGIVQLSFSAPVDLVKVRLQNQTESFGNQARPGHLQARYQGPVHCAVCIFREEGIFGLYRGCLALALRDIPSMGLYFLTYEVLCKWMTK-SLDEPSAWTMLFAGGCAGTVGWAFANPMDVIKARLQMDGMHGVQYLGMLDCIRKSIRQEGVKVFLKGLTINSLRAFPVNAVTFLSYE 283          

HSP 2 Score: 50.0618 bits (118), Expect = 2.889e-6
Identity = 45/189 (23.81%), Postives = 77/189 (40.74%), Query Frame = 3
Query:  363 NLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMA---------------ISEGIAGVGQHGYKTFYRG-LSLPFWSYAGVNACLFTSYKFFQRLLDP--EGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYE 875
            N   F +G   G   L+F  P+D VK   QN T+                  +   +    + G    YRG L+L       +    F +Y+   + +    +  S +  + +G  +G V      P++VIK  +Q D +     +  G +  IR+ +R +G+    KG+ I++ R  P   + F SYE
Sbjct:   98 NCHVFMAGCFSGIVQLSFSAPVDLVKVRLQNQTESFGNQARPGHLQARYQGPVHCAVCIFREEGIFGLYRGCLALALRDIPSMGL-YFLTYEVLCKWMTKSLDEPSAWTMLFAGGCAGTVGWAFANPMDVIKARLQMDGMHGVQYL--GMLDCIRKSIRQEGVKVFLKGLTINSLRAFPVNAVTFLSYE 283          
BLAST of slc25a-12 vs. Ensembl Xenopus
Match: slc25a20 (solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 [Source:NCBI gene;Acc:394703])

HSP 1 Score: 107.457 bits (267), Expect = 8.187e-26
Identity = 87/284 (30.63%), Postives = 129/284 (45.42%), Query Frame = 3
Query:  375 FFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMA-ISEGIAG--------VGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLD--PEGKSNFANILS-GALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYM-----SKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFR-----ALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            FF+G  GG   +  GHPLDT+K   Q   K +  I    +G        +   G +  Y+G++ P      + A  F  +   ++L    PE    +  + + G LSGV       P E IK  +Q  A   G +   GP+   +++ R  GI G+YKG  +   RDVPA  +YF +YE +   +     S  EL  P +    +GG+AG  +W + IP DV+K+R Q        + FR      +R  G  S ++G T + LRA   NA  F  +E   K L
Sbjct:   14 FFAGGFGGICLVFAGHPLDTIKVRIQTQPKPVPGIPPLYSGTFDCFKKTLVNEGLRGLYKGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDILTYPQLFAAGMLSGVFTTAIMAPGERIKCLLQIQA-ASGEVKYAGPMDCAKQLYREAGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNILTPEGHSVSELSVPKI--LFAGGMAGIFNWAVAIPPDVLKSRFQTAPAGKYPNGFRDVLRELIREEGIGSLYKGFTAVMLRAFPANAACFLGFEVAMKFL 294          

HSP 2 Score: 50.0618 bits (118), Expect = 3.190e-6
Identity = 37/139 (26.62%), Postives = 61/139 (43.88%), Query Frame = 3
Query:  501 QHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKS----NFANIL-SGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKM 902
            + G +  Y+G  L        +   F +Y++ + +L PEG S    +   IL +G ++G+       P +V+K   Q     K     NG    +R ++R +GIG LYKG      R  PA    F  +E    +++ M
Sbjct:  162 EAGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNILTPEGHSVSELSVPKILFAGGMAGIFNWAVAIPPDVLKSRFQTAPAGK---YPNGFRDVLRELIREEGIGSLYKGFTAVMLRAFPANAACFLGFEVAMKFLNWM 297          
BLAST of slc25a-12 vs. Ensembl Xenopus
Match: pdgfd (platelet derived growth factor D [Source:Xenbase;Acc:XB-GENE-985911])

HSP 1 Score: 105.145 bits (261), Expect = 1.544e-24
Identity = 90/308 (29.22%), Postives = 144/308 (46.75%), Query Frame = 3
Query:  294 DLWPGIRVSTDKRLEAARQEFRKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNST--KRMAISEG---IAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGK--SNFANILSGALSGVVQLIPGTPVEVIKIHMQ------------------NDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKM-ELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQA---GVDKD----IMDSFRAL-RNIGFESFFRGGTMLTLRALLV 1115
            +LW  + VS    L++    F     +  +G + G  G+    P+D  KT  QN    +RM  S     I  +   GY   YRG ++         A    +  FF+  L  +GK  +    +L+G  +G  Q+I  TP+E++KI +Q                  N A+ +    +   +   R ++R+DGI GLYKG+G    RDVP  IIYF  +  +N    K  +  +P   +F+SG  AG  + V + P DV+KTR+Q+   G+++D    I+D  R + R+ G  +F +G      RAL++
Sbjct:   25 ELW-FLCVSEKCSLDSFSYSFCSLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRMYTSMSDCLIKTIRSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHALSKDGKKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRLAAQRKLLASQAGPNSAVAESITARPTAMQISRELLRSDGIAGLYKGLGATLLRDVPFSIIYFPLFANLNKLGQKTPDGKSPFYVSFLSGCAAGCTAAVAVNPCDVIKTRLQSLQRGINEDTYSGIIDCTRKIWRSEGPAAFLKGAYC---RALVI 328          
BLAST of slc25a-12 vs. Ensembl Xenopus
Match: SLC25A47 (solute carrier family 25 member 47 [Source:NCBI gene;Acc:100496270])

HSP 1 Score: 103.605 bits (257), Expect = 1.752e-24
Identity = 85/293 (29.01%), Postives = 137/293 (46.76%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKT-----FYRGLSLPFWSYAGVNACLFTSYKFFQRLL-------DPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKN--------GPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFV-SGGIAGALSWVLLIPQDVMKTRIQA-GVDKD-----IMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQ 1163
            + +F +GA+GG+ G+  G+PLDTVK   Q          GI    +  YK      F++G+S+P    +  ++ +F  Y+   R L            S F   LSG  +G  Q++  +P ++ K+ +Q       +   +        GPI  +  IV+ +G  GLYKG     FRD  +F  YF SY  +  ++   E  +  L   + +GG AG ++W +  P DV+K+R+Q  GV K      I     ++R  G    F+G ++  LRA  VN V F  YE   ++++
Sbjct:    1 MADFIAGALGGACGVMVGYPLDTVKVRIQTQKNY----NGIWHCVRSTYKMERVSGFFKGVSMPMSMVSVSSSIVFGVYRNVLRNLCKLKYGTTAVKPSKFDIFLSGYAAGGAQILVSSPADMAKVRLQTQMCPPNSTTCSLLTGPKYSGPINCLLTIVKEEGFLGLYKGSSALMFRDCHSFATYFLSYAILREWLLPFEQSHSELIGVLFAGGFAGVVAWGIATPMDVIKSRLQVDGVTKQRYRGVIHCITESVRQEGITVLFKGLSLNCLRAFPVNMVVFLTYEAILRQIK 289          
BLAST of slc25a-12 vs. Ensembl Xenopus
Match: pdgfd (platelet derived growth factor D [Source:Xenbase;Acc:XB-GENE-985911])

HSP 1 Score: 103.99 bits (258), Expect = 1.997e-24
Identity = 84/282 (29.79%), Postives = 134/282 (47.52%), Query Frame = 3
Query:  372 EFFSGAVGGSAGLAFGHPLDTVKTVTQNST--KRMAISEG---IAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGK--SNFANILSGALSGVVQLIPGTPVEVIKIHMQ------------------NDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKM-ELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQA---GVDKD----IMDSFRAL-RNIGFESFFRGGTMLTLRALLV 1115
            +  +G + G  G+    P+D  KT  QN    +RM  S     I  +   GY   YRG ++         A    +  FF+  L  +GK  +    +L+G  +G  Q+I  TP+E++KI +Q                  N A+ +    +   +   R ++R+DGI GLYKG+G    RDVP  IIYF  +  +N    K  +  +P   +F+SG  AG  + V + P DV+KTR+Q+   G+++D    I+D  R + R+ G  +F +G      RAL++
Sbjct:   11 KLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRMYTSMSDCLIKTIRSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHALSKDGKKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRLAAQRKLLASQAGPNSAVAESITARPTAMQISRELLRSDGIAGLYKGLGATLLRDVPFSIIYFPLFANLNKLGQKTPDGKSPFYVSFLSGCAAGCTAAVAVNPCDVIKTRLQSLQRGINEDTYSGIIDCTRKIWRSEGPAAFLKGA---YCRALVI 289          
BLAST of slc25a-12 vs. Ensembl Mouse
Match: Slc25a48 (solute carrier family 25, member 48 [Source:MGI Symbol;Acc:MGI:2145373])

HSP 1 Score: 127.102 bits (318), Expect = 6.174e-33
Identity = 95/304 (31.25%), Postives = 148/304 (48.68%), Query Frame = 3
Query:  363 NLIEFFSGAVGGSAGLAFGHPLDTVKTVTQ---------NSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDP---------EGKSNFANILSGALSGVVQLIPGTPVEVIKI--HMQNDAIKKGN--------LIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPT-LRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNI--------GFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQ 1163
             L +F +G +GG A +  G+PLDTVKT  Q         N  + +   E + G        F++G+S P  S A  N+ +F  +   QR L            G+S    +L+  L+GVV +  G PVE+IKI   MQ    ++ +            GP+  I  IV+ +G+ GLY+G      RD+P +  YF  Y  ++ +++      P+   A+++GGIAGA+SW    P DV+K+RIQA  D   ++ +R + +         GF+ FFRG T+  +R   ++A  F  YE   K L+
Sbjct:    5 QLEDFVAGWIGGVASVIVGYPLDTVKTRLQAGVGYANTFNCIRMVYKRERVFG--------FFKGMSFPLASIAIYNSVVFGVFSNTQRFLSKYRCGELEAGPGRSLSDLLLASMLTGVVSVGLGGPVELIKIRLQMQTQPFREASHGLKSRAVAAYQGPVHCIATIVQMEGLTGLYRGASAMLLRDIPGYCFYFIPYVFLSEWITPEACTGPSPYAAWLAGGIAGAISWGTATPMDVVKSRIQA--DGVYLNKYRGVVDCISQSYQQEGFKVFFRGITVNAVRGFPMSAAMFLGYELSLKALR 298          
BLAST of slc25a-12 vs. Ensembl Mouse
Match: Slc25a45 (solute carrier family 25, member 45 [Source:MGI Symbol;Acc:MGI:2147731])

HSP 1 Score: 122.094 bits (305), Expect = 2.284e-31
Identity = 88/282 (31.21%), Postives = 132/282 (46.81%), Query Frame = 3
Query:  372 EFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQH-GYKTFYRGLSLPFWSYAGVNACLF----------TSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKN-----GPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNP-TLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDK--------DIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            EF +G + G+ GL  GHP DTVK   Q  +    I + +    +H     F++G+S P  S A VN+ LF          T+    +R   P   +N    ++G   G++Q     P ++IK+ +QN    +  +  +     GP+     I+R +G  GL++G      RD P   +YF +YE +    +  E  NP +    V+GG AG  SW+   P DV+K+R+Q    K        D M S  + R  G   FF+G T+ + RA  VNA TF  YE
Sbjct:    5 EFVAGWISGAVGLVLGHPFDTVKVRLQTQSTYQGIVDCVVKTYRHESVLGFFKGMSFPIASVALVNSVLFGVYSNTLLALTATSHQERRAQPPSYTNI--FIAGCTGGLLQAYCLAPFDLIKVRLQNQTEPRMQISSSMPRYRGPVHCAASILREEGPQGLFRGSWALVLRDTPTLGMYFVTYEGLCRQYTP-EGQNPSSATVLVAGGFAGIASWITATPFDVIKSRMQMDGLKGRKYGGMLDCMAS--SFRQEGIGVFFKGMTLNSARAFPVNAATFLSYE 281          
BLAST of slc25a-12 vs. Ensembl Mouse
Match: Slc25a45 (solute carrier family 25, member 45 [Source:MGI Symbol;Acc:MGI:2147731])

HSP 1 Score: 122.094 bits (305), Expect = 2.284e-31
Identity = 88/282 (31.21%), Postives = 132/282 (46.81%), Query Frame = 3
Query:  372 EFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQH-GYKTFYRGLSLPFWSYAGVNACLF----------TSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKN-----GPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNP-TLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDK--------DIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            EF +G + G+ GL  GHP DTVK   Q  +    I + +    +H     F++G+S P  S A VN+ LF          T+    +R   P   +N    ++G   G++Q     P ++IK+ +QN    +  +  +     GP+     I+R +G  GL++G      RD P   +YF +YE +    +  E  NP +    V+GG AG  SW+   P DV+K+R+Q    K        D M S  + R  G   FF+G T+ + RA  VNA TF  YE
Sbjct:    5 EFVAGWISGAVGLVLGHPFDTVKVRLQTQSTYQGIVDCVVKTYRHESVLGFFKGMSFPIASVALVNSVLFGVYSNTLLALTATSHQERRAQPPSYTNI--FIAGCTGGLLQAYCLAPFDLIKVRLQNQTEPRMQISSSMPRYRGPVHCAASILREEGPQGLFRGSWALVLRDTPTLGMYFVTYEGLCRQYTP-EGQNPSSATVLVAGGFAGIASWITATPFDVIKSRMQMDGLKGRKYGGMLDCMAS--SFRQEGIGVFFKGMTLNSARAFPVNAATFLSYE 281          
BLAST of slc25a-12 vs. Ensembl Mouse
Match: Slc25a47 (solute carrier family 25, member 47 [Source:MGI Symbol;Acc:MGI:2144766])

HSP 1 Score: 117.087 bits (292), Expect = 2.521e-29
Identity = 93/309 (30.10%), Postives = 135/309 (43.69%), Query Frame = 3
Query:  369 IEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGV-GQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQ------RLLDPEGKSNFANI-LSGALSGVVQLIPGTPVEVIKIHM--------------------------QNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNP-TLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRAL--------RNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQS 1166
            ++F +GA+GG  G+A G+PLDTVK   Q   K   I   I     Q     FYRGLSLP  + + V++  F +Y          R    + K   A+I LSG  SG+V++   +P EV K+ +                             A  +     +GP+  +  + R +G+ GLYKG      R+  +F  YF SY  +  +++      P  L   V+GG AG L+W +  P DV+K+R+QA  D      +R L        R  G    F+G  +   RA  VN V F  YE   +  QS
Sbjct:    1 MDFVAGAIGGVCGVAVGYPLDTVKVRIQTEAKYAGIWHCIRDTYRQERVWGFYRGLSLPVCTVSLVSSVSFGTYHHCLAHICRFRYGSTDAKPTKADITLSGCASGLVRVFLTSPTEVAKVRLQTQTQAQTQQRRSSASWTSGAPALCPTPTACLEPRPKYSGPLHCLVTVAREEGLRGLYKGSSALLLREGHSFATYFLSYAMLCEWLTPAGHSQPDVLGVLVAGGCAGVLAWAVATPMDVIKSRLQA--DGQGQHRYRGLLHCVVTSVREEGPRVLFKGLALNCCRAFPVNMVVFVAYEAVLRLTQS 307          
BLAST of slc25a-12 vs. Ensembl Mouse
Match: Slc25a29 (solute carrier family 25 (mitochondrial carrier, palmitoylcarnitine transporter), member 29 [Source:MGI Symbol;Acc:MGI:2444911])

HSP 1 Score: 106.686 bits (265), Expect = 1.246e-25
Identity = 80/269 (29.74%), Postives = 129/269 (47.96%), Query Frame = 3
Query:  369 IEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGI-----AGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKM---ELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQA-GVD-----KDIMDSFR-ALRNIGFESFFRGGTMLTLRALLVNAVTF 1130
            ++F +G  GG AG+  GHP D VK   Q  +       G      + + Q      Y+GL  P      +NA +F       R L  +   N    L+GA +G +Q +   P+E+ K  +Q  A+      K G +  + +I R++G+ G+ +G+     R+ P+F +YF +Y+ +   M       L+ P L   ++GG +G  SW+   P DV+K+R+QA G+      + I+D  R + +  G++ F RG     LRA  VNA TF
Sbjct:    3 LDFLAGCAGGVAGVIVGHPFDIVKVRLQVQSTEKPQYRGTLHCFQSIIKQESVLGLYKGLGSPLMGLTFINALVFGVQGNTLRALGQDSPLN--QFLAGAAAGAIQCVICCPMELAKTRLQLQAVGPARTYK-GSLDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVMTRAMGCEPGDRLLVPKL--LLAGGTSGITSWLSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSYQAEGWQVFTRGLASTLLRAFPVNAATF 266          
BLAST of slc25a-12 vs. UniProt/SwissProt
Match: sp|Q9CA93|BAC2_ARATH (Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana OX=3702 GN=BAC2 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 4.209e-33
Identity = 91/260 (35.00%), Postives = 127/260 (48.85%), Query Frame = 3
Query:  417 GHPLDTVKTVTQNSTKR-MAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDP-----EGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA---------FVSGGIAGALSWVLLIPQDVMKTRIQA--GVDKDIMDSFR-ALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            G+PLDT++   Q S+K   A S     +   G  + YRG++ P  S    NA +F  Y  F R  D      E  S     L G  +G VQ +  TPVE+IKI +Q    K      +GPI   + I+R  G+ GLY+G+ I   RD PA  +YF++YE +       E ++P  R           V+GG+AG  SWV   P DV+KTR+Q   G  + I D FR +++  G+   +RG      RA +VN   F  YE
Sbjct:   30 GYPLDTLRIRQQQSSKSGSAFSILRRMLAIEGPSSLYRGMAAPLASVTFQNAMVFQIYAIFSRSFDSSVPLVEPPSYRGVALGGVATGAVQSLLLTPVELIKIRLQLQQTK------SGPITLAKSILRRQGLQGLYRGLTITVLRDAPAHGLYFWTYEYVR------ERLHPGCRKTGQENLRTMLVAGGLAGVASWVACYPLDVVKTRLQQGHGAYEGIADCFRKSVKQEGYTVLWRGLGTAVARAFVVNGAIFAAYE 277          
BLAST of slc25a-12 vs. UniProt/SwissProt
Match: sp|Q6ZT89|S2548_HUMAN (Solute carrier family 25 member 48 OS=Homo sapiens OX=9606 GN=SLC25A48 PE=1 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 1.247e-32
Identity = 95/292 (32.53%), Postives = 148/292 (50.68%), Query Frame = 3
Query:  363 NLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGV-GQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL------DPEG---KSNFANILSGALSGVVQLIPGTPVEVIKI--HMQNDAIKKGNL-------------IKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA-FVSGGIAGALSWVLLIPQDVMKTRIQA-GV----DKDIMDSF-RALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
             L +F +G +GG+A +  GHPLDTVKT  Q           I  V  +     F++G+S P  S A  N+ +F  +   QR L      +PE    ++    +L+  ++GVV +  G PV++IKI   MQ    +  NL                GP+  I  IVRN+G+ GLY+G      RDVP + +YF  Y  ++ +++      P+  A +++GG+AGA+SW    P DV+K+R+QA GV     K ++D   ++ +  G + FFRG T+  +R   ++A  F  YE
Sbjct:    5 QLEDFAAGWIGGAASVIVGHPLDTVKTRLQAGVGYGNTLSCIRVVYRRESMFGFFKGMSFPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGLGGPVDLIKIRLQMQTQPFRDANLGLKSRAVAPAEQPAYQGPVHCITTIVRNEGLAGLYRGASAMLLRDVPGYCLYFIPYVFLSEWITPEACTGPSPCAVWLAGGMAGAISWGTATPMDVVKSRLQADGVYLNKYKGVLDCISQSYQKEGLKVFFRGITVNAVRGFPMSAAMFLGYE 296          
BLAST of slc25a-12 vs. UniProt/SwissProt
Match: sp|A4QNX2|S247B_DANRE (Solute carrier family 25 member 47-B OS=Danio rerio OX=7955 GN=slc25a47b PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.651e-32
Identity = 85/282 (30.14%), Postives = 142/282 (50.35%), Query Frame = 3
Query:  363 NLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQH-GYKTFYRGLSLPFWSYAGVNACLFTSYK----FFQRLL-----DPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKN------GPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQA-GVDKDIMDSF-----RALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            +L +F +G+VGG+ G+A G+PLDTVK   Q  T      + +    ++ G + FYRG+S+P  + +  ++ +F +Y+    F  +L      +P  K++    L+G   GV Q++   P +++K+ +Q       ++ +       GP+  + RI R++G+ GLYKG    A RD P+F  YF +Y  I   ++            ++GG++G   W +  P DV+K+R+Q  GV       F      ++R  G    FRG T+  +RA  VN   F MYE
Sbjct:    2 HLADFLAGSVGGAFGVAVGYPLDTVKVRLQTQTGYSGFWQCVRKTCRNEGLQGFYRGMSMPISTVSISSSLVFGTYRNILQFLHQLQHRSAGEPHHKAHI--FLAGFTGGVTQVLVMAPADIVKVRLQCQTEPVQHISQESSSKYRGPVQCLLRIARDEGLLGLYKGSAALALRDGPSFATYFLTYNTICEILTTENQRPGWPVVLLAGGVSGMCGWAVGTPMDVIKSRLQVDGVSGRRYRGFLHCITHSVRTEGSGVLFRGLTVNCIRAFPVNMSVFAMYE 281          
BLAST of slc25a-12 vs. UniProt/SwissProt
Match: sp|Q8BW66|S2548_MOUSE (Solute carrier family 25 member 48 OS=Mus musculus OX=10090 GN=Slc25a48 PE=1 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 4.318e-32
Identity = 95/304 (31.25%), Postives = 148/304 (48.68%), Query Frame = 3
Query:  363 NLIEFFSGAVGGSAGLAFGHPLDTVKTVTQ---------NSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDP---------EGKSNFANILSGALSGVVQLIPGTPVEVIKI--HMQNDAIKKGN--------LIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPT-LRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNI--------GFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQ 1163
             L +F +G +GG A +  G+PLDTVKT  Q         N  + +   E + G        F++G+S P  S A  N+ +F  +   QR L            G+S    +L+  L+GVV +  G PVE+IKI   MQ    ++ +            GP+  I  IV+ +G+ GLY+G      RD+P +  YF  Y  ++ +++      P+   A+++GGIAGA+SW    P DV+K+RIQA  D   ++ +R + +         GF+ FFRG T+  +R   ++A  F  YE   K L+
Sbjct:    5 QLEDFVAGWIGGVASVIVGYPLDTVKTRLQAGVGYANTFNCIRMVYKRERVFG--------FFKGMSFPLASIAIYNSVVFGVFSNTQRFLSKYRCGELEAGPGRSLSDLLLASMLTGVVSVGLGGPVELIKIRLQMQTQPFREASHGLKSRAVAAYQGPVHCIATIVQMEGLTGLYRGASAMLLRDIPGYCFYFIPYVFLSEWITPEACTGPSPYAAWLAGGIAGAISWGTATPMDVVKSRIQA--DGVYLNKYRGVVDCISQSYQQEGFKVFFRGITVNAVRGFPMSAAMFLGYELSLKALR 298          
BLAST of slc25a-12 vs. UniProt/SwissProt
Match: sp|Q3MHI3|S2548_BOVIN (Solute carrier family 25 member 48 OS=Bos taurus OX=9913 GN=SLC25A48 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 4.520e-31
Identity = 91/292 (31.16%), Postives = 149/292 (51.03%), Query Frame = 3
Query:  363 NLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGV-GQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL------DPE-GKSNFAN--ILSGALSGVVQLIPGTPVEVIKI--HMQNDAIKKGNL-------------IKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA-FVSGGIAGALSWVLLIPQDVMKTRIQAG---VDK--DIMDSF-RALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
             L +F +G +GG+A +  GHPLDTVK   Q  +   +    I  V  +     F++G+S P  S A  N+ +F  +   QR L      +PE G  +  +  +L+  ++GVV +  G PV++I+I   MQ    ++ NL                GP+     IVR +G+ GLY+G      RDVP + +YF  Y  ++ +++      P+  A +++GG+AGA+SW    P DV+K+R+QA    V+K   ++D   ++ +  G + FFRG T+  +R   ++A  F  YE
Sbjct:    5 QLEDFVAGWIGGAASVIVGHPLDTVKARLQAGSGYGSTLSCIRTVYRRESVFGFFKGMSFPLASIAVYNSVVFGVFSNTQRFLSHHRCQEPEAGPPHVLSDLLLASMVAGVVSVGLGAPVDLIEIRLQMQTQPFQEANLGLKPRVAALGEQPAYQGPVHCFATIVRTEGLAGLYRGASAMLLRDVPGYCLYFIPYVFLSDWITPEACAGPSPCAVWLAGGMAGAISWGTATPMDVVKSRLQADGVYVNKYRGVLDCMSQSYQKEGLKVFFRGITVNAVRGFPMSAAMFLGYE 296          
BLAST of slc25a-12 vs. TrEMBL
Match: A0A0H3YF49 (Slc25a-12 OS=Schmidtea mediterranea OX=79327 GN=slc25a-12 PE=2 SV=1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 298/298 (100.00%), Postives = 298/298 (100.00%), Query Frame = 3
Query:  273 MSTEFATDLWPGIRVSTDKRLEAARQEFRKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQS 1166
            MSTEFATDLWPGIRVSTDKRLEAARQEFRKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQS
Sbjct:    1 MSTEFATDLWPGIRVSTDKRLEAARQEFRKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQS 298          
BLAST of slc25a-12 vs. TrEMBL
Match: G7YK69 (Mitochondrial arginine transporter BAC2 OS=Clonorchis sinensis OX=79923 GN=BAC2 PE=3 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 4.808e-64
Identity = 123/282 (43.62%), Postives = 167/282 (59.22%), Query Frame = 3
Query:  348 QEFRKNLI--------EFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWY-IRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRAL-RNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQ 1163
            QEFR+ +         EF +GAVGG AGL  GHPLDT+K + QNST++    E    + Q G    +RGL+LPF+SYA  NA  F  YK   + LDP G S FA + +GA SG+ QLIP TP+E+IKI  QN AI  G    N  I + +R I++  G+ GLY G+ +HA RD+P   +YF++Y     Y   + L +P   + VSG + GALSW + +P D++KTR+Q+G      D  R L +   +  FFRG  +  LRAL+VNA TFT+YE  +  L 
Sbjct:    5 QEFREKITWAASDTVNEFTAGAVGGIAGLVIGHPLDTLKILMQNSTQKPTAIEIFNRIKQFGPTNLFRGLTLPFYSYAITNAVTFGVYKTTLKELDPTGNSVFACLAAGAASGMAQLIPATPIELIKIQQQNTAISSG---PNPKIKHCVRLIIQQHGLRGLYVGLSMHALRDIPGLTVYFFAYTTFLRYGCLIGL-SPFWCSCVSGALGGALSWCVSLPFDIVKTRMQSGGLNSTRDVVRELVKESDYSVFFRGFNVAILRALMVNACTFTVYEMSYASLS 282          
BLAST of slc25a-12 vs. TrEMBL
Match: A0A4Z2DN15 (Mitochondrial basic amino acids transporter isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_010655 PE=3 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 8.630e-63
Identity = 120/270 (44.44%), Postives = 161/270 (59.63%), Query Frame = 3
Query:  357 RKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSY-ECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRN-IGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            R++L EF SGA+GG AGL  GHP+DTVK + QNS K ++  E    + Q G K F+ GLS+PF+SY  +NA +FT YK    +LD  G+S  AN ++GA++GVVQLIP  P+EVIKI  Q+ A   G          I  I+R +G  GLY G  I  FRDVP F  YFY+Y ECI   + K   ++    AF+ G I G LSW + +P D++KTR Q      I +    L N   ++ FFRG  ++  RA LVNA TF++YE  ++ L
Sbjct:    4 RESLNEFLSGAIGGLAGLTVGHPMDTVKVIMQNSPKNLSCKEVTFLISQIGIKRFFTGLSVPFYSYGFINAVIFTVYKKSLSILDATGQSPLANAMAGAIAGVVQLIPAVPIEVIKIQQQSKATYPGEKQLTARKC-IHTILRMNGFTGLYSGTIIQGFRDVPGFTTYFYTYSECIK--IGKYIDLSTFWSAFIGGAIGGTLSWCVSMPFDIIKTRQQVDNGIKISNVINNLLNEKNYKIFFRGFNVVITRAFLVNACTFSVYETVYEYL 270          
BLAST of slc25a-12 vs. TrEMBL
Match: A0A4Z2DN47 (Mitochondrial basic amino acids transporter isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010655 PE=3 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.287e-62
Identity = 120/270 (44.44%), Postives = 161/270 (59.63%), Query Frame = 3
Query:  357 RKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSY-ECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRN-IGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            R++L EF SGA+GG AGL  GHP+DTVK + QNS K ++  E    + Q G K F+ GLS+PF+SY  +NA +FT YK    +LD  G+S  AN ++GA++GVVQLIP  P+EVIKI  Q+ A   G          I  I+R +G  GLY G  I  FRDVP F  YFY+Y ECI   + K   ++    AF+ G I G LSW + +P D++KTR Q      I +    L N   ++ FFRG  ++  RA LVNA TF++YE  ++ L
Sbjct:   20 RESLNEFLSGAIGGLAGLTVGHPMDTVKVIMQNSPKNLSCKEVTFLISQIGIKRFFTGLSVPFYSYGFINAVIFTVYKKSLSILDATGQSPLANAMAGAIAGVVQLIPAVPIEVIKIQQQSKATYPGEKQLTARKC-IHTILRMNGFTGLYSGTIIQGFRDVPGFTTYFYTYSECIK--IGKYIDLSTFWSAFIGGAIGGTLSWCVSMPFDIIKTRQQVDNGIKISNVINNLLNEKNYKIFFRGFNVVITRAFLVNACTFSVYETVYEYL 286          
BLAST of slc25a-12 vs. TrEMBL
Match: A0A075A072 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_01211 PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.363e-62
Identity = 123/293 (41.98%), Postives = 168/293 (57.34%), Query Frame = 3
Query:  312 RVSTDKRLEAARQEFRKNLI--------EFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRAL-RNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQ 1163
            R  T   +    QEFR  +         EF +GAVGG AGL  GHPLDT+K + QNST++ +  E    + Q G    +RGL+LPF+SYA  NA  F  YK   + LDP G S FA + +GA SG+ QLIP TP+E+IKI  QN AI  G  +K      ++ I++  G+ GLY G+ +HA RD+P   +YF+ Y     Y   + L +P   + VSG + GALSW + +P D++KTR+Q+G      D  R L +   +  FFRG  +  LRAL+VNA TFT+YE  +  L 
Sbjct:   77 RNPTITNMVTGTQEFRAKITWAASDTVNEFTAGAVGGIAGLVIGHPLDTLKILMQNSTQKPSAIEIFKNIRQFGATNLFRGLTLPFYSYAITNAVTFGVYKTTLKELDPTGNSVFACLAAGAASGMAQLIPATPIELIKIQQQNTAISCGPNLKIKHC--VQLIIQQRGLRGLYVGLSMHALRDIPGLTVYFFGYTTFLRYGCLIGL-SPFWCSCVSGALGGALSWCVSLPFDIVKTRMQSGGLNTTRDVVRELVKESDYSVFFRGFNVAILRALMVNACTFTVYEMSYASLS 366          
BLAST of slc25a-12 vs. Ensembl Cavefish
Match: SLC25A45 (solute carrier family 25 member 45 [Source:NCBI gene;Acc:103042612])

HSP 1 Score: 140.584 bits (353), Expect = 3.040e-38
Identity = 92/277 (33.21%), Postives = 140/277 (50.54%), Query Frame = 3
Query:  369 IEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQH-GYKTFYRGLSLPFWSYAGVNACLFTSYK-----FFQRLLDPEGKSN----FANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIK---NGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQ---AG--VDKDIMDS-FRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            +EF +G + G+ GL  GHP+DTVK   Q  +    I + +     H G+  F +G++ P  S A  N+  F SY        Q       + N    +A   +G +SG++Q++  +P++++K+ +QN    +  L +     P   +  IVR DG  GL++GV   A RDVP F +YF  YE     +++      T    ++GGIAG ++W    P DV+K R+Q   AG  V K  +     +LR  G   FF+G  + +LRA  VNAVTF  YE
Sbjct:    4 VEFIAGWISGAVGLVLGHPMDTVKVRLQTQSIYKGIFDCVVRTYTHEGFHGFLKGMAFPVLSVAVSNSVAFGSYSNALDYITQSQHKERAQGNKAPLWAVFTAGCVSGMMQVLVTSPIDLVKVRLQNQTEGRSELDRARYRSPWHCMVMIVREDGARGLFRGVTALALRDVPCFGLYFLPYELTCRMLTEKGKEPSTYAILIAGGIAGVVTWSCATPMDVIKARLQMSGAGGRVYKGTLHCIITSLREEGIRVFFKGLLLNSLRAFPVNAVTFLSYE 280          

HSP 2 Score: 64.6994 bits (156), Expect = 3.149e-11
Identity = 50/186 (26.88%), Postives = 84/186 (45.16%), Query Frame = 3
Query:  375 FFSGAVGGSAGLAFGHPLDTVKTVTQNSTK----------RMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGK--SNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMS 896
            F +G V G   +    P+D VK   QN T+          R      +  V + G +  +RG++             F  Y+   R+L  +GK  S +A +++G ++GVV     TP++VIK  +Q      G  +  G +  I   +R +GI   +KG+ +++ R  P   + F SYE +  YM+
Sbjct:  104 FTAGCVSGMMQVLVTSPIDLVKVRLQNQTEGRSELDRARYRSPWHCMVMIVREDGARGLFRGVTALALRDVPCFGLYFLPYELTCRMLTEKGKEPSTYAILIAGGIAGVVTWSCATPMDVIKARLQMSG--AGGRVYKGTLHCIITSLREEGIRVFFKGLLLNSLRAFPVNAVTFLSYEMLLRYMT 287          
BLAST of slc25a-12 vs. Ensembl Cavefish
Match: si:dkey-150i13.2 (mitochondrial carnitine/acylcarnitine carrier protein-like [Source:NCBI gene;Acc:103035997])

HSP 1 Score: 118.242 bits (295), Expect = 6.802e-30
Identity = 92/286 (32.17%), Postives = 136/286 (47.55%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTK----RMAISEGI-----AGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL--DPEGKSNFANI-LSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYM-----SKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVD---KDIMDSFRAL-RNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            L  F +G VGG+  L  GHPLDT+K   Q   K    +  I  G        V + G    Y+G+  P    A + A  F  +   ++LL  DP     +  I L+G L+GV   +   P E IK  +Q  +   G L   GP+    R+ +  GI  +YKG  +   RDVP+  +YF +YE +   +     S  +L  P  R  ++GG AG L+WV+ +P DV+K+  Q   D   K ++D  R L R  G ++ ++G + + LRA   NA  F  +E   K L
Sbjct:   14 LKNFVAGGVGGACLLFAGHPLDTIKVRLQTQPKASGPQYVIYTGTYDCLRKTVSREGVLGLYKGMGAPLAGVAPMMAISFFGFGLGKQLLQSDPSVPHTYTQIYLAGMLAGVFTTVIVAPGERIKCLLQVQS-SAGQLKYAGPMDCAVRLYKEQGIRSVYKGTVLTLIRDVPSSGLYFLTYEYLKHVLTPEGQSVQQLSTP--RILLAGGTAGILNWVIALPPDVLKSNFQTAADGRYKGLVDVLRTLIREEGAKALYKGLSAVMLRAFPANAACFLGFEVALKCL 296          
BLAST of slc25a-12 vs. Ensembl Cavefish
Match: slc25a48 (solute carrier family 25 member 48 [Source:NCBI gene;Acc:103025062])

HSP 1 Score: 117.472 bits (293), Expect = 7.321e-29
Identity = 93/303 (30.69%), Postives = 143/303 (47.19%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQ--NSTKR-------MAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL------DPEGKSNFANI-LSGALSGVVQLIPGTPVEVIKI--HMQNDAIKKGNL-------------------IKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNP-TLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKD------IMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            L+ F SGA    + +  GHPLDTVKT  Q  NS K        +   E +AG        F++GLS P  S    N+ +F  +   QRL+      D    S   ++ ++  ++G V +  G PV+++KI   MQ   I   N+                   I  GPI  I  I++N+GI GLY+G G    RDVP + +YF  Y  +  +++     +P      ++GG+AG++SWV   P DV+K+R+QA    D      +    ++ +  G   FFRG T+  +R   ++A  F +YE
Sbjct:  112 LLYFLSGA----SSVIVGHPLDTVKTRLQAGNSYKNTFHCIVTIYKKETVAG--------FFKGLSFPLASITLYNSLVFGFFSNSQRLISKLRYGDGRHPSGLLDLTVASMMTGFVSVGIGAPVDLVKIRLQMQTQTILAENVTLAGNGSVPLRSVGLQSQPIYRGPIHCISSILQNEGIQGLYRGAGAMLLRDVPGYALYFIPYTLLCGWLNPNGNTSPHPCTICLAGGLAGSISWVTATPADVVKSRLQADAMHDRKYKGIVHCILQSYKTEGLHVFFRGATVNAVRGFPMSATMFLVYE 402          
BLAST of slc25a-12 vs. Ensembl Cavefish
Match: slc25a20 (solute carrier family 25 member 20 [Source:NCBI gene;Acc:103039532])

HSP 1 Score: 112.849 bits (281), Expect = 6.345e-28
Identity = 85/284 (29.93%), Postives = 132/284 (46.48%), Query Frame = 3
Query:  375 FFSGAVGGSAGLAFGHPLDTVKTVTQNSTK----RMAISEGI-----AGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLD--PEGKSNFANILS-GALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYM-----SKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRA-----LRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            FF+G  GG   +  GHPLDT+K   Q   K    +  +  G        + + G +  Y+G++ P      + A  F  +   ++L    P+   ++  + + G LSGV       P E IK  +Q  A   G +   GP+  +++I R  GI G+YKG  +   RDVPA  +YF +YE +   +     S  EL  P++    +GG+AG  +W + IP DV+K+R Q   +    + FR      +R  G  S ++G   + LRA   NA  F  +E   K L
Sbjct:   14 FFAGGFGGVCLVFAGHPLDTIKVRLQTQPKPGPGQTPLYAGTFDCCKKTLAKEGVRGLYKGMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPDDILSYPQLFAAGMLSGVFTTAIMAPGERIKCLLQIQA-ASGEVKYAGPMDCVKQIYRESGIRGIYKGTALTLMRDVPASGMYFMTYEWLKNLLTPEGKSPNELSVPSV--LFAGGMAGIFNWAVAIPPDVLKSRFQTAPEGKYPNGFRDVLRELIREEGVASLYKGFNAVMLRAFPANAACFLGFELAMKFL 294          
BLAST of slc25a-12 vs. Ensembl Cavefish
Match: slc25a29 (solute carrier family 25 member 29 [Source:NCBI gene;Acc:103030089])

HSP 1 Score: 112.464 bits (280), Expect = 1.107e-27
Identity = 83/272 (30.51%), Postives = 134/272 (49.26%), Query Frame = 3
Query:  369 IEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGI-----AGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIK--IHMQNDAIKKGNLIK--NGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTL--RAFVSGGIAGALSWVLLIPQDVMKTRIQA-GVD-----KDIMDSFR-ALRNIGFESFFRGGTMLTLRALLVNAVTF 1130
            ++F +G +GG+AG+  GHP DTVK   Q  +    + +G      + + Q      Y+G+  P      +NA +F       RLL  +   N    L+GA +G +Q +   P+E+ K  + MQ   +KK +  K     +  + RI + +G+ G+ +G+     R+ P F +YF +Y+ +   +   E  +P +  +   +GG++G  SW+   P DV+K+R+QA GV        IMD  R ++   G   F RG T   LRA  VNA TF
Sbjct:    1 MDFLAGCIGGAAGVLVGHPFDTVKVRLQVQSADKPLYKGTIHCFQSIIRQESLLGLYKGIGSPMMGLTFINAIVFGVQGNTMRLLGKDTPLN--QFLAGAAAGSIQSVICCPMELAKTRMQMQGTGVKKSSTRKVYKNSLDCLARIYQREGLRGINRGMVTTLIRETPGFGVYFLAYDVLTRSLG-CEPEDPYMIPKLLFAGGMSGIASWLSTYPVDVIKSRLQADGVGGKYQYSSIMDCTRKSIEREGLRVFTRGLTSTLLRAFPVNAATF 269          
BLAST of slc25a-12 vs. Ensembl Sea Lamprey
Match: slc25a20 (solute carrier family 25 member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1869])

HSP 1 Score: 98.2117 bits (243), Expect = 1.392e-23
Identity = 73/236 (30.93%), Postives = 112/236 (47.46%), Query Frame = 3
Query:  495 VGQHGYKTFYRGLSLPFWSYAGVNACLFTSY---KFFQRLLDPEGKSNFANIL-SGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYM-----SKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFR-----ALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            + + G +  Y+G++ P    A + A  F  +   K FQ+   PE    +  +  +G LSGV   +   P E IK  +Q  A   G +   GP+  +++I R  GI G+YKG  +   RDVPA  +YF +YE +   +     S  +L  P +    +GG+AG  +W + IP D +K+R Q   +      FR      +R  G  S ++G T + LRA   NA  F  +E   K L
Sbjct:   31 LAKEGLRGLYKGMAAPLVGVAPMFAVCFFGFGLGKKFQQT-HPEDSLTYIQLFKAGMLSGVFTTVIMAPGERIKCLLQVQA-NTGGIKYAGPMDCVKQIYRESGIRGVYKGTALTLMRDVPASGMYFMTYEWLKNVLTPEGGSVSDLSIPKI--LFAGGMAGIFNWAVAIPPDTLKSRFQTAPEGKYPHGFRDVLRELVREEGVLSLYKGFTAVMLRAFPANAACFLGFEVAMKFL 262          
BLAST of slc25a-12 vs. Ensembl Sea Lamprey
Match: slc25a48 (solute carrier family 25 member 48 [Source:NCBI gene;Acc:436640])

HSP 1 Score: 89.7373 bits (221), Expect = 1.565e-20
Identity = 74/271 (27.31%), Postives = 114/271 (42.07%), Query Frame = 3
Query:  519 FYRGLSLPFWSYAGVNACLFTSYKFFQRLLD----------PEGKSNFAN-----------ILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKG--------------------------------NLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA-FVSGGIAGALSWVLLIPQDVMKTRIQA---------GVDKDIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            F++G+S P  S A  N+ +F  +   +R+L+          P    + A+           +L+ AL+G V +  G PV+++KI +Q      G                                  +  GPI  +   V   G+ GLY+G G    RDVP +  YF  Y  +    +      P++ A +V+GG+AG+LSW L  P DV+K+R+QA         G       S+RA    G   FFRG T+  +R   ++A  F  YE
Sbjct:    7 FFKGMSFPLASIAAYNSLVFGVFSTSRRVLESLRPPVGSGVPGSHQHAADAAPTRTPVSELMLASALTGAVSVTVGAPVDLVKIRLQMQTQNLGIAPMMSSLRSMPLPPAPPAPRALHVAPLGLQPCSLYRGPIHCVWLTVSRGGLRGLYRGAGAMLLRDVPGYCTYFVPYVLLCQLFTPSGQPEPSMGAIWVAGGLAGSLSWGLATPFDVVKSRLQADGVVETKYTGAWHCAQHSYRA---EGLGVFFRGLTVNLVRGFPMSAAAFLAYE 274          
BLAST of slc25a-12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002073.1 (pep scaffold:Pmarinus_7.0:GL478102:892:24949:1 gene:ENSPMAG00000001875.1 transcript:ENSPMAT00000002073.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 3.303e-20
Identity = 75/252 (29.76%), Postives = 121/252 (48.02%), Query Frame = 3
Query:  486 IAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGK--SNFANILSGALSGVVQLIPGTPVEVIKIHMQN-------------------DAIKKGNLIKNG------------PIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTY-MSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQA---GVDKD----IMDSFRA-LRNIGFESFFRGGTMLTLRALLV 1115
            I  V   GY   YRG ++         A    +  FF+ +L  +GK  + F  +L+G  +G  Q+I  TP+E++KI +Q+                    + ++  +I+ G             +   R ++R  GI GLYKG+G    RDVP  IIYF  +  +N+  ++      P   +F SG IAG+++ V + P DV+KTR+Q+   GV++D    I+D  +  L   G  +FF+GG     RAL++
Sbjct:    5 IKTVRSDGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRNMLSKDGKKLTLFREMLAGCGAGTCQVIITTPMEMLKIQLQDAGRLGIEKREVKGTPWKKFPSAERYTIIECGFSSGTPLGASRSALQITRDLLRAQGIAGLYKGLGATLLRDVPFSIIYFPLFANLNSLGVTTPGERAPFYHSFASGCIAGSMAAVAVNPCDVIKTRLQSLQRGVNEDTYTGIVDCTKKILAKEGGRAFFKGG---GCRALVI 253          
BLAST of slc25a-12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008980.1 (pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 gene:ENSPMAG00000008118.1 transcript:ENSPMAT00000008980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 1.088e-13
Identity = 71/268 (26.49%), Postives = 104/268 (38.81%), Query Frame = 3
Query:  420 HPLDTVKTVTQNST------------------KRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSN--FANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVD------KDIMDSFRA-LRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            +P+D VKT  QN                    K++   EG+ G+        YRGL       A   A   T     +       KS      I++G  +G  Q+I   P+E++KI +Q         I  GP      ++R+ G  GLYKG      RD+P   IYF  Y    +  +  +     L    +G IAG  +  L+ P DV+KTR+Q            ++D FR  L   G  + ++G      R+     VT   YE
Sbjct:    8 YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVVRYEGVFGL--------YRGLIPQLLGVAPEKAIKLTMNDLIRDKFTKRDKSIPLIGEIIAGGCAGGSQVIFTNPLEIVKIRLQ-----VAGEITTGPRVSALNVLRDLGFLGLYKGAKACFLRDIPFSAIYFPVYAHTKSSFADEKGHVGPLHLLTAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILSEEGPRALWKGAGARVCRSSPQFGVTLLTYE 262          

HSP 2 Score: 47.7506 bits (112), Expect = 2.709e-6
Identity = 46/180 (25.56%), Postives = 78/180 (43.33%), Query Frame = 3
Query:  372 EFFSGAVGGSAGLAFGHPLDTVKTVTQ-----NSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQR-LLDPEGKSNFANILS-GALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTY 890
            E  +G   G + + F +PL+ VK   Q      +  R++    +  +G  G    Y+G    F      +A  F  Y   +    D +G     ++L+ GA++G+      TP +VIK  +Q  A + G    +G I   R+I+  +G   L+KG G    R  P F +   +YE +  +
Sbjct:   92 EIIAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGFLG---LYKGAKACFLRDIPFSAIYFPVYAHTKSSFADEKGHVGPLHLLTAGAIAGMPAASLVTPADVIKTRLQV-AARAGQTTYSGVIDCFRKILSEEGPRALWKGAGARVCRSSPQFGVTLLTYELLQQW 267          
BLAST of slc25a-12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006621.1 (pep scaffold:Pmarinus_7.0:GL477233:35245:42511:-1 gene:ENSPMAG00000005981.1 transcript:ENSPMAT00000006621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 9.741e-12
Identity = 76/296 (25.68%), Postives = 124/296 (41.89%), Query Frame = 3
Query:  360 KNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEG-IAGVGQ----HGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLD-----PEGK--SNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGN--------LIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMS----KMELMNPTLRAFVSGGIAGALSWVLL----------IPQDVMKTRIQAGVDKDIMDSFRA-LRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            + LI+  +G  GG A +  G P DT K   Q   K   +  G ++ +GQ     G    YRG      +  G NA LF  Y F QRL+       EG   SN     +G+L+     I   P+E++K  MQ  A+++ +        +     +   R ++R DG+ GLY G+     RD+P +  +F+  E   T  +      + + P++  F+SG I G L+  L           +    M  ++   + +  + S  + +      + + G T   +RA   NA  F  YE
Sbjct:    8 QALIDTSAGTAGGIACVYSGQPFDTAKVKMQTFPK---LYNGFVSCLGQTYRAEGMWGLYRGSFPALIANIGENAMLFLCYGFCQRLVARLSHLQEGSRLSNMQMATAGSLAAGFTAIVICPLELVKCRMQ--AMREMHAAGKTVFTMADCTAVAVTRNVLRVDGLLGLYNGLSSTWMRDMPGYFCFFWGNEVCKTLFTPPGKTKDDLVPSVH-FLSGYI-GLLNHCLFAHTFIDPLTRLSTHSMTHQLACSLFQSFVQSLTSKVATSCIMALYSGFTPTIIRAFPANAALFLAYE 296          
BLAST of slc25a-12 vs. Ensembl Yeast
Match: CRC1 (Mitochondrial inner membrane carnitine transporter; required for carnitine-dependent transport of acetyl-CoA from peroxisomes to mitochondria during fatty acid beta-oxidation; human homolog SLC25A20 complements yeast null mutant [Source:SGD;Acc:S000005626])

HSP 1 Score: 102.449 bits (254), Expect = 5.824e-25
Identity = 90/307 (29.32%), Postives = 131/307 (42.67%), Query Frame = 3
Query:  321 TDKRLEAARQEFRKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMA-------ISEGIAGVG----QHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL---DPEGKSNFANILSGALSGVVQLIPGT----PVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMS---------KMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRA---LRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECH 1151
            T  R        R+N+  F +G VGG   +  GHP D +K   QN             I E    V      +  K FY+G+  P      + A  F  Y   ++L+   + +G SN   +   A +G +  IP T    P E +K+ +Q  +  KG+ I+       + IV+  GI  L+KG      RD P   +YF SYE    Y++         K E +N  L   ++GGIAG   W+ + P D +KT++QA   +  M S      L+  G + FF G     LR+   NA TF   E  H
Sbjct:   21 TKSRPPIKSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPTTLVTAPTERVKVVLQTSS--KGSFIQAA-----KTIVKEGGIASLFKGSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVN-ILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTRQNMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLGVEMTH 319          
BLAST of slc25a-12 vs. Ensembl Yeast
Match: AGC1 (Mitochondrial amino acid transporter; acts both as a glutamate uniporter and as an aspartate-glutamate exchanger; involved in nitrogen metabolism and nitrogen compound biosynthesis; human homolog SLC25A13 complements yeast null mutant [Source:SGD;Acc:S000006225])

HSP 1 Score: 93.9745 bits (232), Expect = 5.223e-21
Identity = 87/279 (31.18%), Postives = 122/279 (43.73%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTK----RMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQ-RLLDPEGK-SNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA-------FVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDS---FRALRNI----GFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            L  F  G++ G  G    +P+D +KT  Q        + +I   +  + + G K  Y GL       A   A   T   F + RL D  GK S F  I+SGA +G  Q+I   P+E++KI +Q  +   G  I+        +IV+  G+ GLY GV     RDVP   IYF +Y  +   +   +  + T R          +G IAG  +  L  P DV+KTR+Q    K        F A+R I     F SFF+GG    LR+      T   YE
Sbjct:  531 LYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQAN-ETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYE 808          
BLAST of slc25a-12 vs. Ensembl Yeast
Match: ODC2 (Mitochondrial inner membrane transporter; 2-oxodicarboxylate transporter, exports 2-oxoadipate and 2-oxoglutarate from the mitochondrial matrix to the cytosol for use in lysine and glutamate biosynthesis and in lysine catabolism; ODC2 has a paralog, ODC1, that arose from the whole genome duplication [Source:SGD;Acc:S000005748])

HSP 1 Score: 81.6481 bits (200), Expect = 9.698e-18
Identity = 70/232 (30.17%), Postives = 110/232 (47.41%), Query Frame = 3
Query:  372 EFFSGAVGGSAGLAFGHPLDTVKT-----VTQNST----KRMAISEGIAG-----VGQHGYKTFYRGLSLPFWSYAGVNACLFTS----YKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYF-YSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQA 1010
            +F SGAV G + L   +PLD VKT     VT  +     K++    G+       V + G+   YRG+S P    A   A  F       K F+ L +    +   +I +GA +G+ +     P E+IKI MQ+  +K   L   GP+  +++ ++N+GI GLYKG+    +R+      YF   Y+  N+          T    ++G I G +  +L  P DV+K+RIQ+
Sbjct:   15 QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAAGASAGMTEAAVIVPFELIKIRMQD--VKSSYL---GPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQS 241          
BLAST of slc25a-12 vs. Ensembl Yeast
Match: SFC1 (Mitochondrial succinate-fumarate transporter; transports succinate into and fumarate out of the mitochondrion; required for ethanol and acetate utilization [Source:SGD;Acc:S000003856])

HSP 1 Score: 80.8777 bits (198), Expect = 2.005e-17
Identity = 79/297 (26.60%), Postives = 128/297 (43.10%), Query Frame = 3
Query:  393 GGSAGL---AFGHPLDTVKTVTQNSTKRMAISEGIAGV----------------GQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL--DPEGKSNFANI-LSGALSGVVQ-LIPGTPVEVIKIHMQNDAIKKGNLIK----NGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMN--PTLRAFVSGGIAGALSWVLLIPQDVMKTRIQ----------AGVDKDIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQS 1166
            GG+AGL      HPLDT+K        RM I   +AG+                 + G+   Y+GL           A  F+SY+F++ LL     G  +  N  ++G  +G+ + ++   P+EV+KI +Q   +           N  I     IV+ +G+  LY+GV + A R        F  Y  +  ++     M+  P+      G I+GA+      P D +KTR+Q          +G+ K I    + L+  GF + ++G T   +R     AVTFT+YE   + L++
Sbjct:   17 GGTAGLFEALCCHPLDTIKV-------RMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHLEN 306          
BLAST of slc25a-12 vs. Ensembl Yeast
Match: ORT1 (Ornithine transporter of the mitochondrial inner membrane; exports ornithine from mitochondria as part of arginine biosynthesis; functionally complemented by human ortholog, SLC25A15, which is associated with hyperammonaemia-hyperornithinaemia-homocitrullinuria (HHH) syndrome, but HHH-associated variants fail to complement [Source:SGD;Acc:S000005656])

HSP 1 Score: 72.4034 bits (176), Expect = 1.045e-14
Identity = 69/285 (24.21%), Postives = 121/285 (42.46%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKT-----------VTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGK-SNFANIL-SGALSGVVQLIPGTPVEVIKIHMQ--NDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA-------FVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNI----GFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            +++  +G++ G+ G     P DTVK             T +  K    +EGIA       + F++G++ P       NA LF SY    + L+     S    IL SG ++G    +  TPVE++K  +Q  N  +          +  I+ I+   G+ GL++G      R+    + +F +YE +   +     ++   R         +SGG AG      + P D +K+ +Q     + +    A++ I    G + F+RG  +   RA+  NA  F ++E
Sbjct:   14 ILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIA-------RGFFQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVSPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQT----EHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287          

HSP 2 Score: 45.0542 bits (105), Expect = 9.702e-6
Identity = 52/196 (26.53%), Postives = 83/196 (42.35%), Query Frame = 3
Query:  375 FFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMA----------------ISE-GIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL-------DPEGKSN--FANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECIN 884
              SG V GS       P++ VK   Q +  ++A                I+E G+AG+ Q    TF R       S+ GV    F +Y+  ++ L       DP+   +  +  ++SG  +G+       P + +K  MQ + I   N +K        +I    G+ G Y+G+GI  FR VPA    FY +E ++
Sbjct:  111 LISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRE------SFGGV--AWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTEHISLTNAVK--------KIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETLS 290          
BLAST of slc25a-12 vs. Ensembl Nematostella
Match: EDO41788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3K4])

HSP 1 Score: 120.939 bits (302), Expect = 3.548e-31
Identity = 90/293 (30.72%), Postives = 132/293 (45.05%), Query Frame = 3
Query:  324 DKRLEAARQEFRKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISE---------GIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL--DPEGKSNFANIL-SGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA---FVSGGIAGALSWVLLIPQDVMKTRIQAGVD----KDIMDSFRA-LRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            +K+ + A     KN   FF+G  GG   +A GHPLDT+K   Q   +     +          +  +   G+   Y+G++ P      + A  F  +   ++L   DP     +  I+ +GA +GV       P E IK  +Q            GPI   R+I   +GI G+YKGV     RDVP   +YF SYE +  + +  +     + A     +GG AG L+W   I QDV+K+R+Q   +    K + D FR  +R  G  + FRG T + LRA   NA  F  YE
Sbjct:   16 EKKEKKASSSGIKN---FFAGGFGGVCCIATGHPLDTIKVRLQTMPRPKPGEKPMFTGTFDCAMKTIRNEGFFGLYKGMAAPITGVTPIFAICFWGFNMGKKLQMKDPNADPTYLQIMNAGAFAGVCTTAIMAPGERIKCLLQIQQASGAEKKYKGPIDCARQIYAQNGIRGVYKGVCATLLRDVPGTAMYFLSYEYLMKHFTPEDGSRKDVGAHKILFAGGTAGMLNWAAAIAQDVLKSRLQTAPEGTYPKGVRDVFRQMMREEGPSALFRGLTPVMLRAFPANAACFLGYE 305          
BLAST of slc25a-12 vs. Ensembl Nematostella
Match: EDO35704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKV2])

HSP 1 Score: 107.457 bits (267), Expect = 1.606e-26
Identity = 83/285 (29.12%), Postives = 137/285 (48.07%), Query Frame = 3
Query:  372 EFFSGAVG----GSAGLAFGHPLDTVKTVTQNST-----------KRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMS----KMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKD----------IMDSFRALRNIGFESFFRGGTMLT-LRALLVNAVTFTM 1136
            +FF+G +G    G AG+  GHP DTVK   Q  T           K++   E + G+        Y+G++ P      +NA +F       R L+  G    A  +SGA++G VQ I   P+E+ K  +Q     +  +   G +  ++++  ++G+ G ++G+ I   RD+PAF +YF S++ +   ++     ++ ++P +R F SGGIAG LSW+L  P D++K+  QA    +            D  + +   G  S F  G + T LR    NA T T+
Sbjct:    4 DFFAGCLGVFLTGFAGVVVGHPFDTVKVRLQTQTNNVYNGVFDCFKQIIKRESVLGL--------YKGMASPLAGLGLINAIIFGVQGETLRRLN--GSGTMAQAISGAIAGGVQSIVCCPMELAKTRVQVQGQGQKLMAYTGSLDCLKKVFHSEGLRGCFRGMAITTTRDIPAFALYFGSFQYVCELLTPKGEHVDNLSP-IRLFFSGGIAGTLSWILTYPVDMVKSCYQADGRTNSGKPQYKYNGYADCVKKIYISGGVSAFGQGLLATILRGFPTNAATLTV 277          
BLAST of slc25a-12 vs. Ensembl Nematostella
Match: EDO40203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7Y7])

HSP 1 Score: 101.293 bits (251), Expect = 3.044e-24
Identity = 81/291 (27.84%), Postives = 137/291 (47.08%), Query Frame = 3
Query:  360 KNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNS-----TKRMAISEGIAGV-GQHGYKTFYRGLSLPFWSYAGVNACLFTSYK-FFQRLL--DPEGKSNFANI-LSGALSGVVQLIPGTPVEVIKI--HMQNDAIKKGNL---------------IKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVD------KDIMD-SFRALRNIGFESFFRGGTMLTLRALLVNAVTF 1130
            ++L  F +G  GG AG+  G PLDTVK   Q +      K+++  +   G+         ++G++ P    A  NA +F  +    +R     P+G +    I  +G+++G+ Q+    PV+++KI   MQ +AI  GN                +  GP+  + ++ R+ G+ G ++G  + A RD+P F +YF  YE +  + S +          ++GG AG +SW    P DV+K+RIQA  +      K +MD + ++ +  G   F RG     LR    +A  F
Sbjct:    2 ESLYNFVAGWFGGCAGVIVGQPLDTVKVRMQATGKLPGNKQLSSWKCFTGIIKNESVFGLFKGMASPLSMLAFQNAVIFCVHSTILERFQYRRPDGSNTIGQIAFAGSVAGLAQVPLIAPVDLVKIKLQMQTEAILFGNYANVNFCLSAKRSTRSVYRGPVDCLVKLYRSRGLAGCFQGNTVTAVRDIPGFAVYFGVYELLCDWFSNLFGSRGVATYLMAGGFAGVVSWASTFPFDVIKSRIQADGNLGKFRYKGMMDCALQSYKEEGMIVFTRGIWPTLLRGFPSSAAIF 292          
BLAST of slc25a-12 vs. Ensembl Nematostella
Match: EDO47806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL60])

HSP 1 Score: 87.0409 bits (214), Expect = 3.146e-19
Identity = 81/301 (26.91%), Postives = 133/301 (44.19%), Query Frame = 3
Query:  309 IRVSTDKRLEAARQEFR--KNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNST---------KRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSN--FANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLR------AFVSGGIAGALSWVLLIPQDVMKTRIQA---GVDKDIMDSFRAL-RNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            + VS +K ++  R +F   KN I   +     +     G PLDT+K   Q             + +       +   G    +RG+++P  +       LF+   F +    P  K      ++ +G ++GV      TP++ +K  +Q +    G+    GP+  +RRI R  G+ G+YKG+ + A RD+P +   F++ E  +  ++  +  N   R        VSG IAG   W   +P DV+KTR Q    G    ++D  R L R  GF + + G   + +RAL VNA  F  Y+
Sbjct:    1 MEVSQEKEIDFTRPKFSVLKNSIAGSAAGAAANL---VGFPLDTIKVRLQAMPLPKPGEPWMYKNSFDCFFKIIRNEGVYYLFRGVTVPILNSIPNTTVLFSCVSFVKSYKLPVSKDPELLRSLAAGMIAGVATSFVLTPLDRVKCILQIEKAFGGSSY-GGPVDCLRRIYREAGVRGVYKGISVTAMRDIPGWGAMFFTNELCHRAITGEK--NHLTRHIGPGGVLVSGAIAGMAYWTAGLPADVLKTRYQTAPPGRYGRVLDVLRTLVRYEGFTALYTGFGAILIRALPVNAAFFLAYD 295          
BLAST of slc25a-12 vs. Ensembl Nematostella
Match: EDO47003 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN42])

HSP 1 Score: 86.2705 bits (212), Expect = 6.704e-19
Identity = 83/297 (27.95%), Postives = 131/297 (44.11%), Query Frame = 3
Query:  357 RKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQN--STKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSY----KFFQRLLDPEGKSN---FANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLI------KNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYM------SKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQ-----AGVDKDIMDSFRAL-RNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQS 1166
            ++   +F +GA+GG+A +  G P DT+K   Q   S  + A+  GI    Q G+K  Y G      +    N+ LF  Y       + L   + +S    F N  +G+ +         P E+IK  +Q  A  + NLI      K+G I    +I+RNDG  GL++G+     R+VP +  +F  YE  + YM         +++   L+  + GG AG   W  + P DV+K+RIQ      G     +++   + R  GF   +RG     +R    N   F  YE     L++
Sbjct:    7 KRMATDFTAGAMGGTACVFAGQPFDTIKVKMQTFPSMSKNALDCGIKTFKQEGFKGLYAGTIPSLAANIAENSFLFLFYGQCLSLIKTLTGKKHESELTIFHNACAGSGAAFFMSFVLCPAELIKCRLQ--AQHQTNLISGMAGPKSGVIDVTMQIIRNDGFQGLFRGMTATWAREVPGYFFFFGGYE-FSRYMLTPSGGDVRDVVKSPLKMILCGGFAGTCLWTAIFPADVVKSRIQILSSGKGKAPGFLETLILIFRTEGFRVLYRGLGPSIIRCFPANGALFMAYEGTQSLLKN 300          
BLAST of slc25a-12 vs. Ensembl Medaka
Match: slc25a47a (solute carrier family 25 member 47 [Source:NCBI gene;Acc:101170813])

HSP 1 Score: 118.242 bits (295), Expect = 7.039e-30
Identity = 86/287 (29.97%), Postives = 136/287 (47.39%), Query Frame = 3
Query:  363 NLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTK----RMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYK-FFQRLLDPEGKSNFANI-----LSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKN------GPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRA-FVSGGIAGALSWVLLIPQDVMKTRIQ----------AGVDKDIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            ++ +F SG+V G+ G+A G+PLDTVK   Q   +       I E ++  G HG   F++G+ LP  + +  ++ +F +Y+   Q L    G +   N      LSG   GV Q+   +P +++K+ +Q     +   ++       GP+  +  I+R DG+ GLY+G      RD P++  YF +Y  +  ++S      P      ++GGIAG   W +  P DV+K R+Q           G    I ++   LR  G   FFR   +  LRA  VN V F  YE
Sbjct:    2 HIADFLSGSVAGACGVAVGYPLDTVKVRIQTQKQFTGFYHCIVETLSKEGVHG---FFKGMLLPMTTVSMTSSVVFGTYRNCLQCLRQARGGNRGTNTKREVFLSGLAGGVAQVSVMSPGDIVKVRLQCQTESRQRGLQKPGPKYLGPVHCLLHIIREDGLRGLYRGALPLTLRDGPSYATYFLTYTTLYDWLSGSSKKKPHWTGVMLAGGIAGMAGWTVATPMDVVKARLQIDGMHGTQRYKGFVHCITET---LRTEGAGVFFRSLGINCLRAFPVNMVVFFTYE 282          
BLAST of slc25a-12 vs. Ensembl Medaka
Match: slc25a20 (solute carrier family 25 member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1869])

HSP 1 Score: 115.161 bits (287), Expect = 1.001e-28
Identity = 88/287 (30.66%), Postives = 135/287 (47.04%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTK-RMAISEGIAG--------VGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLD--PEGKSNFANILS-GALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYM-----SKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRA-----LRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            L  FF+G  GG   +  GHPLDT+K   Q   K +   S   AG        + + G K  Y+G++ P      + A  F  +   ++L    P+   ++  + + G LSGV       P E IK  +Q  A   G +  +GP+  ++++ R  GI G+Y+G  +   RDVPA  +YF SYE +   +     S  EL  P++    +GG+AG  +W + IP DV+K+R Q   +    + FR      +R  G  S ++G   + LRA   NA  F  +E   K L
Sbjct:   12 LKNFFAGGFGGVCLVFAGHPLDTIKVRLQTQPKAKPGESLMYAGTLDCFKKTLAKEGVKGLYKGMAAPIIGVTPMFAVCFFGFGLGRKLQQRSPDDVLSYPQLFAAGMLSGVFTTAIMAPGERIKCLLQIQA-STGEVKYSGPMDCVKQLYRESGIRGIYRGTALTLMRDVPASGMYFMSYEWLKNLLTPAGKSHNELSIPSV--LFAGGMAGICNWAVAIPPDVLKSRFQTAPEGKYPNGFRDVLRELIREEGVASLYKGFNAVMLRAFPANAACFLGFEMAMKFL 295          
BLAST of slc25a-12 vs. Ensembl Medaka
Match: slc25a48 (solute carrier family 25 member 48 [Source:NCBI gene;Acc:101173796])

HSP 1 Score: 113.235 bits (282), Expect = 9.261e-28
Identity = 85/299 (28.43%), Postives = 137/299 (45.82%), Query Frame = 3
Query:  396 GSAGLAFGHPLDTVKTVTQ-----NSTKRMAIS----EGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLL------DPEGKSNFANILSGA-LSGVVQLIPGTPVEVIKI--HMQNDAIKKGNL-----------------------IKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNP-TLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRAL--------RNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            G++ +  GHPLDTVKT  Q      ST    +S    E +AG        F++G+S P  S    N+ +F  +   QR +      D     +  ++ + + L+G+V +  G PV+++KI   MQ   +   NL                       +  GPI  +  I++  G+ GLY+G G    RDVP + +YF  Y      ++      P     +++GG+AG++SWV   P DV+K+R+QA  D  +   +R L        R+ G + FFRG T+  +R   +++  F  YE
Sbjct:   53 GASSVVVGHPLDTVKTRLQAGKGYGSTLHCILSIYRKETVAG--------FFKGMSFPLASITVYNSVVFGFFSNAQRFISTYRYGDGRHPCSLLDLTAASMLTGMVSVGLGAPVDLVKIRLQMQTQTVLAENLSFAGNVASGSDIPLRSVSVSNQQLYRGPIHCVSSILQTQGVQGLYRGAGAMVLRDVPGYALYFIPYSVFCRLLTPESSAGPHPCSIWLAGGLAGSISWVTATPADVVKSRMQA--DAQLHRKYRGLLHCILHCYRSEGAQVFFRGATVNAIRGFPMSSTMFLTYE 341          
BLAST of slc25a-12 vs. Ensembl Medaka
Match: SLC25A29 (solute carrier family 25 member 29 [Source:NCBI gene;Acc:101165114])

HSP 1 Score: 105.145 bits (261), Expect = 8.539e-25
Identity = 88/280 (31.43%), Postives = 131/280 (46.79%), Query Frame = 3
Query:  396 GSAGLAFGHPLDTVKTVTQNSTKRMAISEGI-----AGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQ----NDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTL--RAFVSGGIAGALSWVLLIPQDVMKTRIQA----GVDK--DIMDSFR-ALRNIGFESFFRGGTMLTLRALLVNAVTFT------MY----EECH 1151
            G+AG+  GHP DTVK   Q       +  G      + V Q      Y+G+  P      +NA +F       R L  +   N    L+GA +G +Q +   P+E+ K  MQ     +   K  L KN  +  + RI + +G  G+ +G+     R+ P F +YF +Y+ +   +   E  +P +  +   +GG++G  SW+   P DV+K+R+QA    GV+K   IMD  R +L+  G+  F RG T   LRA  VNA TF       MY    EEC 
Sbjct:   56 GAAGVLVGHPFDTVKVRLQVQNVDKPLYRGTFHCFQSIVRQESMLGLYKGIGSPMMGLTFINAIVFGVQGNAMRRLGSDTPLN--QFLAGASAGAIQCVICCPMELAKTRMQMQGTGEKKSKRKLYKNS-LDCLVRIYKKEGFRGINRGMVTTFVRETPGFGVYFLAYDVLTRSLG-CEPEDPYMIPKLLFAGGMSGIASWISTYPVDVIKSRLQADGVGGVNKYSSIMDCVRQSLKKEGWRVFTRGLTSTLLRAFPVNATTFATVTLFLMYMREGEECR 331          
BLAST of slc25a-12 vs. Ensembl Medaka
Match: slc25a29 (mitochondrial basic amino acids transporter [Source:NCBI gene;Acc:101155318])

HSP 1 Score: 103.605 bits (257), Expect = 1.048e-24
Identity = 82/272 (30.15%), Postives = 127/272 (46.69%), Query Frame = 3
Query:  369 IEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGI-----AGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAI---KKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYM---SKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQ----AGVDK--DIMDSFR-ALRNIGFESFFRGGTMLTLRALLVNAVTF 1130
            ++F +G  GG+AG+  GHP DTVK   Q       +  G      + + Q      Y+G+  P      +NA +F  +    R L+ +  +N     +GA +G +Q +   PVE+ K  MQ   I   K         +  +  I R +G+ G+ +G+     R+ P F  YF+SY+ +   +        + P L    +GG+AG  SW++  P DV+K+R+Q     GV +   IMD  R ++   G+  F RG T   LRA  VNA TF
Sbjct:    1 MDFLAGCFGGAAGVLVGHPFDTVKVRLQVQPVDKPLYRGTYHCFQSIIRQESVLGLYKGIGSPMMGLTVINAIVFGVHGNTMRFLEEDTPTN--QFFAGAAAGAIQCVVCCPVELAKTRMQMQGIGEKKASRKTYRSSLDCLVHIYRQEGVRGVNRGMVTTLIRETPGFGAYFWSYDVLTRSLGCEPDSRFIIPKL--LFAGGMAGIASWIVTYPADVIKSRLQMDGAGGVQRYSSIMDCVRQSIGKEGYMVFTRGLTSTLLRAFPVNATTF 268          
BLAST of slc25a-12 vs. Planmine SMEST
Match: SMESG000064880.1 (SMESG000064880.1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 298/298 (100.00%), Postives = 298/298 (100.00%), Query Frame = 3
Query:  273 MSTEFATDLWPGIRVSTDKRLEAARQEFRKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQS 1166
            MSTEFATDLWPGIRVSTDKRLEAARQEFRKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQS
Sbjct:    1 MSTEFATDLWPGIRVSTDKRLEAARQEFRKNLIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQS 298          
BLAST of slc25a-12 vs. Planmine SMEST
Match: SMESG000011486.1 (SMESG000011486.1)

HSP 1 Score: 169.474 bits (428), Expect = 2.494e-49
Identity = 89/260 (34.23%), Postives = 146/260 (56.15%), Query Frame = 3
Query:  372 EFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQ---NDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            E  +G V G       HP+DT+KT+ Q S  +M        + + G + F++G ++P  ++A VN+  F +Y   ++  DP  +S+  ++   + SGV QL    P EVIKI MQ   N  + K   +       I+ I +  GI G Y G      RD+P  + YF +YE ++ Y+ +   MN   ++ +SGG  G +SWV++IP D++KTRIQ+  DKD++ S++A+ ++G+ + FRG ++L LR+   NA+ F +YE
Sbjct:   22 ELIAGGVAGLVAQVSNHPIDTIKTIYQ-SHPKMKYYFVCKDIYKIGIRNFWKGCTVPSTTFAIVNSVSFATYFVPKKHFDPRSESDLVSVGCASFSGVCQLAFWVPSEVIKIKMQMYANSPMSKSVTVMTS----IKHIYKTYGIKGFYHGTIAQLLRDIPNNVAYFITYEKLSKYLDQTYQMNLVEKSIISGGATGMISWVIVIPMDLVKTRIQSRTDKDLISSYKAILSLGYLAMFRGTSILLLRSFSANAMIFLVYE 276          
BLAST of slc25a-12 vs. Planmine SMEST
Match: SMESG000009142.1 (SMESG000009142.1)

HSP 1 Score: 103.605 bits (257), Expect = 1.023e-24
Identity = 77/285 (27.02%), Postives = 122/285 (42.81%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQ----NSTKRMAISEGIAG-----VGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGKSNFAN---ILSGALSGVVQLIPGTPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTL---RAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKDIMDSFRA-----LRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRL 1160
            L  F +G VGG   +  G PLDT+K   Q         + + + +A      +   G   FY+G++ P      + A  F  Y   ++L   +  +         +G LSGV      TP E +K  +Q      G     GP   ++++ +  GI  +YKG      RD+PA   YF SYE +   ++        L   R  ++GG AG  +W++ IP D +K+R+Q   +    +  R+     + N G    +RG + + +RA   NA  F  YE   K L
Sbjct:    9 LKSFIAGGVGGICTVVVGQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 293          
BLAST of slc25a-12 vs. Planmine SMEST
Match: SMESG000069729.1 (SMESG000069729.1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.684e-18
Identity = 72/262 (27.48%), Postives = 123/262 (46.95%), Query Frame = 3
Query:  366 LIEFFSGAVGGSAGLAFGHPLDTVKTVTQNSTKRMAISEGIAGVGQHGYKT-----FYRGLSLPFWSYAGVNACLFTSYKFFQRLLDPEGK--SNFANILSGALSGVVQLIPGTPVEVIKIHMQNDA---IK-KGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMNPTL--RAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDKD-------IMDSF-RALRNIGFESFFRGGT 1088
            L +  +G + G  G+   +P+D VKT  QN    + +  G+    +  +K+      YRG ++  +      A       FF+  L P GK  +    +++G  +G  Q+I  TP+E++KI +Q++    IK +    K         +++  GI GLYKG+G    RDV    IYF  +   N    + E    T+   +F SG +AG ++ + + P DV+KTR+Q     +       I D F +     G+++FF+G +
Sbjct:   12 LPKILNGGIAGIVGVTCVYPIDLVKTRLQNQQSGVKLYNGMFDCAKKTFKSEGFFKMYRGSAVNLFLITPEKAIKLVGNDFFRYHLKPTGKPLNPLREMIAGGGAGACQIIVTTPMELLKIQLQDEGRTRIKGQTGATKASASRIALNLLKEKGIFGLYKGMGATFLRDVTFSAIYFPLFANFNKLGPQRENGKGTVFYWSFGSGCLAGCIASLSVNPFDVVKTRLQTLKKIEGEQEFTGIFDCFKKTFTTEGWKAFFKGAS 273          
BLAST of slc25a-12 vs. Planmine SMEST
Match: SMESG000061041.1 (SMESG000061041.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.655e-17
Identity = 76/230 (33.04%), Postives = 112/230 (48.70%), Query Frame = 3
Query:  495 VGQHGYKTFYRGLSLPFWSYAGVNACLFTSYKFFQ-RLLDPEGK-SNFANILSGALSGVVQLIPG-TPVEVIKIHMQNDAIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSYECINTYMSKMELMN------PTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVD----KDIMDSF-RALRNIGFESFFRGGTMLTLRALLVNAVTFTMYE 1142
            V +HG    YRGLS+  +     +A  F +++ F+ R L  +G  +N   +L G  +GV + I   TP+E IK+   ND I  GN   NG I  ++ IV+++GI GLY+GV     +      I F+  E +     K           PTL   V G  AGA S     P DV+KTR+Q G+D    K+  D F +  +N G  +F++G      R  L   +TF +Y+
Sbjct:   58 VKEHGVLGLYRGLSVLVYGSIPKSAVRFGAFEEFKKRNLSADGTLTNSRKLLCGLGAGVSEAILAVTPMETIKVKFINDQIS-GNPKYNGFIHGVKTIVKSEGIKGLYQGVTATIMKQGTNQAIRFFVMESLKDGYRKYRGDTSPNAPIPTLLTGVFGATAGAASVFGNTPIDVVKTRMQ-GLDSKQYKNTFDCFLKIFKNEGPRAFYKGTVPRLSRVCLDVGITFMIYD 285          
The following BLAST results are available for this feature:
BLAST of slc25a-12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A482.597e-3332.53solute carrier family 25 member 48 [Source:HGNC Sy... [more]
SLC25A452.740e-3132.50solute carrier family 25 member 45 [Source:HGNC Sy... [more]
SLC25A452.740e-3132.50solute carrier family 25 member 45 [Source:HGNC Sy... [more]
SLC25A476.227e-3130.67solute carrier family 25 member 47 [Source:HGNC Sy... [more]
SLC25A489.740e-2931.09solute carrier family 25 member 48 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R07B7.104.467e-3131.99pep chromosome:WBcel235:V:12084186:12086460:1 gene... [more]
slc-25A293.273e-3031.07SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-25A294.949e-3031.07SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-25A296.965e-3031.07SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-25A296.965e-3031.07SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
back to top
BLAST of slc25a-12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG56466.267e-3331.72gene:FBgn0039525 transcript:FBtr0085210[more]
CG49951.364e-3231.82gene:FBgn0032219 transcript:FBtr0079989[more]
CG49951.364e-3231.82gene:FBgn0032219 transcript:FBtr0079990[more]
CG49953.755e-3131.99gene:FBgn0032219 transcript:FBtr0079991[more]
CG49953.755e-3131.99gene:FBgn0032219 transcript:FBtr0331665[more]
back to top
BLAST of slc25a-12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FO704822.14.041e-3432.83solute carrier family 25 member 45 [Source:NCBI ge... [more]
slc25a486.513e-3129.10solute carrier family 25 member 48 [Source:NCBI ge... [more]
slc25a201.871e-2829.49solute carrier family 25 member 20 [Source:ZFIN;Ac... [more]
slc25a47a2.010e-2828.77solute carrier family 25 member 47a [Source:NCBI g... [more]
si:dkey-150i13.24.180e-2729.19si:dkey-150i13.2 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
back to top
BLAST of slc25a-12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a454.050e-3733.69solute carrier family 25 member 45 [Source:NCBI ge... [more]
slc25a208.187e-2630.63solute carrier family 25 (carnitine/acylcarnitine ... [more]
pdgfd1.544e-2429.22platelet derived growth factor D [Source:Xenbase;A... [more]
SLC25A471.752e-2429.01solute carrier family 25 member 47 [Source:NCBI ge... [more]
pdgfd1.997e-2429.79platelet derived growth factor D [Source:Xenbase;A... [more]
back to top
BLAST of slc25a-12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a486.174e-3331.25solute carrier family 25, member 48 [Source:MGI Sy... [more]
Slc25a452.284e-3131.21solute carrier family 25, member 45 [Source:MGI Sy... [more]
Slc25a452.284e-3131.21solute carrier family 25, member 45 [Source:MGI Sy... [more]
Slc25a472.521e-2930.10solute carrier family 25, member 47 [Source:MGI Sy... [more]
Slc25a291.246e-2529.74solute carrier family 25 (mitochondrial carrier, p... [more]
back to top
BLAST of slc25a-12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CA93|BAC2_ARATH4.209e-3335.00Mitochondrial arginine transporter BAC2 OS=Arabido... [more]
sp|Q6ZT89|S2548_HUMAN1.247e-3232.53Solute carrier family 25 member 48 OS=Homo sapiens... [more]
sp|A4QNX2|S247B_DANRE2.651e-3230.14Solute carrier family 25 member 47-B OS=Danio reri... [more]
sp|Q8BW66|S2548_MOUSE4.318e-3231.25Solute carrier family 25 member 48 OS=Mus musculus... [more]
sp|Q3MHI3|S2548_BOVIN4.520e-3131.16Solute carrier family 25 member 48 OS=Bos taurus O... [more]
back to top
BLAST of slc25a-12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF490.000e+0100.00Slc25a-12 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
G7YK694.808e-6443.62Mitochondrial arginine transporter BAC2 OS=Clonorc... [more]
A0A4Z2DN158.630e-6344.44Mitochondrial basic amino acids transporter isofor... [more]
A0A4Z2DN471.287e-6244.44Mitochondrial basic amino acids transporter isofor... [more]
A0A075A0722.363e-6241.98Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of slc25a-12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A453.040e-3833.21solute carrier family 25 member 45 [Source:NCBI ge... [more]
si:dkey-150i13.26.802e-3032.17mitochondrial carnitine/acylcarnitine carrier prot... [more]
slc25a487.321e-2930.69solute carrier family 25 member 48 [Source:NCBI ge... [more]
slc25a206.345e-2829.93solute carrier family 25 member 20 [Source:NCBI ge... [more]
slc25a291.107e-2730.51solute carrier family 25 member 29 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a201.392e-2330.93solute carrier family 25 member 20 [Source:ZFIN;Ac... [more]
slc25a481.565e-2027.31solute carrier family 25 member 48 [Source:NCBI ge... [more]
ENSPMAT00000002073.13.303e-2029.76pep scaffold:Pmarinus_7.0:GL478102:892:24949:1 gen... [more]
ENSPMAT00000008980.11.088e-1326.49pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 ... [more]
ENSPMAT00000006621.19.741e-1225.68pep scaffold:Pmarinus_7.0:GL477233:35245:42511:-1 ... [more]
back to top
BLAST of slc25a-12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CRC15.824e-2529.32Mitochondrial inner membrane carnitine transporter... [more]
AGC15.223e-2131.18Mitochondrial amino acid transporter; acts both as... [more]
ODC29.698e-1830.17Mitochondrial inner membrane transporter; 2-oxodic... [more]
SFC12.005e-1726.60Mitochondrial succinate-fumarate transporter; tran... [more]
ORT11.045e-1424.21Ornithine transporter of the mitochondrial inner m... [more]
back to top
BLAST of slc25a-12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO417883.548e-3130.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357041.606e-2629.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402033.044e-2427.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478063.146e-1926.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470036.704e-1927.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a47a7.039e-3029.97solute carrier family 25 member 47 [Source:NCBI ge... [more]
slc25a201.001e-2830.66solute carrier family 25 member 20 [Source:ZFIN;Ac... [more]
slc25a489.261e-2828.43solute carrier family 25 member 48 [Source:NCBI ge... [more]
SLC25A298.539e-2531.43solute carrier family 25 member 29 [Source:NCBI ge... [more]
slc25a291.048e-2430.15mitochondrial basic amino acids transporter [Sourc... [more]
back to top
BLAST of slc25a-12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064880.10.000e+0100.00SMESG000064880.1[more]
SMESG000011486.12.494e-4934.23SMESG000011486.1[more]
SMESG000009142.11.023e-2427.02SMESG000009142.1[more]
SMESG000069729.16.684e-1827.48SMESG000069729.1[more]
SMESG000061041.11.655e-1733.04SMESG000061041.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30001325
GenBankAKN21580.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001325 ID=SMED30001325|Name=slc25a-12|organism=Schmidtea mediterranea sexual|type=transcript|length=1264bp
TAGTTAAAAAACCCGTAGGCCGTAACTTGCAAGCTTTTTGAAAAGAATTG
TGTTGGCGTATAGAAAATCAAATATTGTATTTATAATGAACATATTCGGT
AGTTAAATACTATTTATCAGCGACTTCCATTAACTAGGTTCTCTCCTCTC
CTGAAGGTTTTCAAGATTTTCTAAAGATTTTTTTTAGAAGTTTCCATTGT
TCAAATTTTTGCAATCGTTTAACTTTTCGCGAATTGTGCCGAATCAACAC
GCCACTTTTACGGTCTTTTTAGATGTCAACTGAATTTGCGACAGATTTAT
GGCCGGGAATTCGAGTCTCAACAGATAAACGTCTGGAAGCAGCTAGGCAA
GAATTCAGAAAAAATTTGATAGAATTTTTTTCGGGTGCTGTTGGAGGATC
TGCTGGATTGGCATTTGGCCACCCGTTGGATACAGTAAAAACTGTCACTC
AAAACTCTACTAAAAGAATGGCGATTTCCGAAGGAATTGCTGGTGTTGGA
CAGCATGGTTATAAAACATTTTATCGTGGTCTCAGTTTGCCATTTTGGTC
ATATGCCGGTGTCAATGCGTGTTTGTTTACCAGTTATAAATTTTTTCAAA
GACTTTTAGACCCTGAAGGTAAGTCAAACTTTGCAAATATTCTTTCAGGG
GCTTTATCTGGAGTGGTTCAACTGATTCCAGGAACTCCAGTGGAAGTAAT
TAAAATTCACATGCAAAATGATGCAATTAAGAAAGGAAATTTGATCAAAA
ATGGACCAATTTGGTATATTAGGAGAATCGTAAGAAATGATGGCATAGGA
GGTCTTTATAAAGGAGTTGGAATTCATGCATTCCGAGATGTTCCTGCTTT
TATAATTTATTTCTATTCTTATGAATGTATTAATACTTATATGAGTAAAA
TGGAATTGATGAATCCTACTTTGCGAGCATTCGTATCCGGAGGCATTGCT
GGAGCTCTTTCTTGGGTTTTGCTTATTCCGCAGGATGTGATGAAAACAAG
AATTCAAGCCGGTGTCGACAAAGATATTATGGATAGTTTCAGAGCACTTA
GGAATATCGGTTTCGAATCATTCTTTCGAGGCGGAACAATGCTCACATTG
AGAGCATTACTTGTTAATGCAGTAACTTTTACAATGTATGAAGAATGTCA
TAAAAGACTGCAATCATAAATAATAAAAAGCCTTGTTGGTATTAAGAAGA
TTCAAGATAATCTCAAAATTTCTATTTTGTTAATTTTAGAGATATTTTTT
AAATTGAAATATAA
back to top

protein sequence of SMED30001325-orf-1

>SMED30001325-orf-1 ID=SMED30001325-orf-1|Name=SMED30001325-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=299bp
MSTEFATDLWPGIRVSTDKRLEAARQEFRKNLIEFFSGAVGGSAGLAFGH
PLDTVKTVTQNSTKRMAISEGIAGVGQHGYKTFYRGLSLPFWSYAGVNAC
LFTSYKFFQRLLDPEGKSNFANILSGALSGVVQLIPGTPVEVIKIHMQND
AIKKGNLIKNGPIWYIRRIVRNDGIGGLYKGVGIHAFRDVPAFIIYFYSY
ECINTYMSKMELMNPTLRAFVSGGIAGALSWVLLIPQDVMKTRIQAGVDK
DIMDSFRALRNIGFESFFRGGTMLTLRALLVNAVTFTMYEECHKRLQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR018108Mitochondrial_sb/sol_carrier
IPR023395Mt_carrier_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 32..112
e-value: 2.2E-9
score: 37.1
coord: 215..297
e-value: 1.4E-12
score: 47.4
coord: 118..210
e-value: 6.9E-19
score: 67.6
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 214..295
score: 17.343
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 117..206
score: 16.377
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 29..111
score: 12.28
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 32..298
e-value: 7.5E-54
score: 184.4
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 29..291
NoneNo IPR availablePANTHERPTHR45624FAMILY NOT NAMEDcoord: 27..297
NoneNo IPR availableTMHMMTMhelixcoord: 216..235