slc24a-8

Overview
Nameslc24a-8 (AKN21568.1)
Smed IDSMED30001319
Length (bp)1611
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc24a-8 (SMED30001319) t-SNE clustered cells

Violin plots show distribution of expression levels for slc24a-8 (SMED30001319) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc24a-8 (SMED30001319) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc24a-8 (SMED30001319) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001319

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001319SMESG000030115.1 PL06017B2C01ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001319SMESG000030115.1 PL08007A1F03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30001319SMESG000030115.1 SmedASXL_015989SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30001319SMESG000030115.1 SmedASXL_015989SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30001319SMESG000030115.1 dd_Smed_v4_7121_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30001319SMESG000030115.1 dd_Smed_v6_7121_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
collecting ductSMED30001319SMESG000030115.1 Smed-slc24a-8smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
proximal tubuleSMED30001319SMESG000030115.1 Smed-slc24a-8smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc24a-8 vs. Ensembl Human
Match: SLC24A5 (solute carrier family 24 member 5 [Source:HGNC Symbol;Acc:HGNC:20611])

HSP 1 Score: 353.599 bits (906), Expect = 6.926e-116
Identity = 201/460 (43.70%), Postives = 292/460 (63.48%), Query Frame = 1
Query:  232 NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQR-----------LPR-----LKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
             C      EFP  F TR+ER++GGII +  + +Y+F+A++I+CDEYF+ SLE + E   +  DVAG TFMAAGSSAPEL T+ +GVFITK D+GISTI+GSA++N+L I A CG+   +V  L+ WP+FRDC  Y +S  A++ I+ D  + WYE  ++L +Y  Y+++L ++  +  ++I++           + R     L G+ +E  P I +   T  G+         +      S+H   ++ ED       P++F +P +   R++WV  LP+  + + T PDCRK   W+  F++TFF+S IWIS  TYILVWM+ + G+TL+IPDT+MGLT LAAGTSIPD IA  LVA+ G GDMA+SN +GSNVFD+L CLG+PWFI+T+F+N  +   V S  L + TI+L  +++ L   +  N WKL+R LG + L  Y+ +  LS L+EL I+GN
Sbjct:   45 QCVISPSSEFPEGFFTRQERRDGGIIIYFLIIVYMFMAISIVCDEYFLPSLEIISESLGLSQDVAGTTFMAAGSSAPELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNTVSTLSCWPLFRDCAAYTISAAAVLGIIYDNQVYWYEGALLLLIYGLYVLVLCFDIKINQYIIKKCSPCCACLAKAMERSEQQPLMGWEDEGQPFIRRQSRTDSGIFYEDSGYSQLSI----SLHGLSQVSED------PPSVFNMPEADLKRIFWVLSLPIITLLFLTTPDCRKK-FWKNYFVITFFMSAIWISAFTYILVWMVTITGETLEIPDTVMGLTLLAAGTSIPDTIASVLVARKGKGDMAMSNIVGSNVFDML-CLGIPWFIKTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLATLSVLYELGIIGN 492          
BLAST of slc24a-8 vs. Ensembl Human
Match: SLC24A5 (solute carrier family 24 member 5 [Source:HGNC Symbol;Acc:HGNC:20611])

HSP 1 Score: 293.123 bits (749), Expect = 2.657e-93
Identity = 175/404 (43.32%), Postives = 253/404 (62.62%), Query Frame = 1
Query:  400 VFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQR-----------LPR-----LKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
               +  DVAG TFMAAGSSAPEL T+ +GVFITK D+GISTI+GSA++N+L I A CG+   +V  L+ WP+FRDC  Y +S  A++ I+ D  + WYE  ++L +Y  Y+++L ++  +  ++I++           + R     L G+ +E  P I +   T  G+         +      S+H   ++ ED       P++F +P +   R++WV  LP+  + + T PDCRK   W+  F++TFF+S IWIS  TYILVWM+ + G+TL+IPDT+MGLT LAAGTSIPD IA  LVA+ G GDMA+SN +GSNVFD+L CLG+PWFI+T+F+N  +   V S  L + TI+L  +++ L   +  N WKL+R LG + L  Y+ +  LS L+EL I+GN
Sbjct:   41 ALGLSQDVAGTTFMAAGSSAPELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNTVSTLSCWPLFRDCAAYTISAAAVLGIIYDNQVYWYEGALLLLIYGLYVLVLCFDIKINQYIIKKCSPCCACLAKAMERSEQQPLMGWEDEGQPFIRRQSRTDSGIFYEDSGYSQLSI----SLHGLSQVSED------PPSVFNMPEADLKRIFWVLSLPIITLLFLTTPDCRKK-FWKNYFVITFFMSAIWISAFTYILVWMVTITGETLEIPDTVMGLTLLAAGTSIPDTIASVLVARKGKGDMAMSNIVGSNVFDML-CLGIPWFIKTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLATLSVLYELGIIGN 432          
BLAST of slc24a-8 vs. Ensembl Human
Match: SLC24A3 (solute carrier family 24 member 3 [Source:HGNC Symbol;Acc:HGNC:10977])

HSP 1 Score: 191.045 bits (484), Expect = 1.048e-52
Identity = 95/165 (57.58%), Postives = 129/165 (78.18%), Query Frame = 1
Query:  229 KNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYV 723
            KNCT  ++ EFPND  T ++R+ G ++ H+  +IY+F ALAI+CD++FV SLE++CE  ++  DVAGATFMAAGSSAPEL TSVIGVFITK DVG+ TIVGSAVFN+LCII +CG+F G V+ L+ W + RD I Y LS+IALI+ + D  + W+E+L+++ MY+
Sbjct:   85 KNCTEPALHEFPNDIFTNEDRRQGAVVLHVLCAIYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVIALIVFIYDEKVSWWESLVLVLMYL 249          

HSP 2 Score: 173.711 bits (439), Expect = 2.079e-46
Identity = 98/207 (47.34%), Postives = 138/207 (66.67%), Query Frame = 1
Query:  961 TIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            T F+ P+     + W    P++ + YFT+P+C KP  W K F+VTF  S +WI+  +Y++VWM+ +IG TL IPD IMG+TFLAAGTS+PD +A  +VA+ G GDMA+SNSIGSNVFDILI LGLPW ++T  ++ GS I + S  LI++   LL++V V V  + +NKW+L++ LG   L LY + +  S + E N+    N P C
Sbjct:  436 TPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPR-WEKWFMVTFASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVHLNKWQLDKKLGCGCLLLYGVFLCFSIMTEFNVFTFVNLPMC 641          
BLAST of slc24a-8 vs. Ensembl Human
Match: SLC24A3 (solute carrier family 24 member 3 [Source:HGNC Symbol;Acc:HGNC:10977])

HSP 1 Score: 191.045 bits (484), Expect = 1.048e-52
Identity = 95/165 (57.58%), Postives = 129/165 (78.18%), Query Frame = 1
Query:  229 KNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYV 723
            KNCT  ++ EFPND  T ++R+ G ++ H+  +IY+F ALAI+CD++FV SLE++CE  ++  DVAGATFMAAGSSAPEL TSVIGVFITK DVG+ TIVGSAVFN+LCII +CG+F G V+ L+ W + RD I Y LS+IALI+ + D  + W+E+L+++ MY+
Sbjct:   85 KNCTEPALHEFPNDIFTNEDRRQGAVVLHVLCAIYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVIALIVFIYDEKVSWWESLVLVLMYL 249          

HSP 2 Score: 173.711 bits (439), Expect = 2.079e-46
Identity = 98/207 (47.34%), Postives = 138/207 (66.67%), Query Frame = 1
Query:  961 TIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            T F+ P+     + W    P++ + YFT+P+C KP  W K F+VTF  S +WI+  +Y++VWM+ +IG TL IPD IMG+TFLAAGTS+PD +A  +VA+ G GDMA+SNSIGSNVFDILI LGLPW ++T  ++ GS I + S  LI++   LL++V V V  + +NKW+L++ LG   L LY + +  S + E N+    N P C
Sbjct:  436 TPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPR-WEKWFMVTFASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVHLNKWQLDKKLGCGCLLLYGVFLCFSIMTEFNVFTFVNLPMC 641          
BLAST of slc24a-8 vs. Ensembl Human
Match: SLC24A4 (solute carrier family 24 member 4 [Source:HGNC Symbol;Acc:HGNC:10978])

HSP 1 Score: 189.504 bits (480), Expect = 2.172e-52
Identity = 96/183 (52.46%), Postives = 131/183 (71.58%), Query Frame = 1
Query:  175 NSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYV 723
            N   M+ ++GT       KNCT  +I EFP D  + KER++G ++ HI  ++Y+F ALAI+CD++FV SLE++CE  ++  DVAGATFMAAGSS PEL  SVIGVFIT  DVG+ TIVGSAVFN+LCII +CG+F G V+ L WW + RD + Y +S+I LI+ + D  I W+E L+++ +YV
Sbjct:   61 NRKLMAPVNGTQTA----KNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTISVIVLIVFIYDEQIVWWEGLVLIILYV 239          

HSP 2 Score: 177.948 bits (450), Expect = 3.334e-48
Identity = 95/205 (46.34%), Postives = 137/205 (66.83%), Query Frame = 1
Query:  967 FEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            F VP +   ++ WV   P+  +   TIP+C KP  W K F+VTF  + +WI+V +YI+VW++ +IG TL IPD IMG+TFLAAGTS+PD +A  +VA+ G GDMA+SN+IGSNVFDIL+ LG+PW ++T  +N GS + + S  L+++ + LL +V + V  I +NKW+L+R LG   L LY + +  S + E N+    N P C
Sbjct:  396 FSVPEARGDKVKWVFTWPLIFLLCVTIPNCSKPR-WEKFFMVTFITATLWIAVFSYIMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGLQTMVVNYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGVYVLVLYAIFLCFSIMIEFNVFTFVNLPMC 599          
BLAST of slc24a-8 vs. Ensembl Celegans
Match: ncx-5 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:G5EC02])

HSP 1 Score: 169.088 bits (427), Expect = 3.279e-45
Identity = 96/198 (48.48%), Postives = 130/198 (65.66%), Query Frame = 1
Query:  226 LKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLPRLKGYGEEHNP 819
            ++  +  +  +FP D  + + R+ GG+I HI + IY+FVALA++CDE+FV SL  + EV  I  DVAGATFMAAG SAPE  TS+ GVF+ + +VG+ TIVGSA FN+LC++A C +F   V+HL WWP+FRD   Y LS+  L+I   D +I+W EAL+M  MY+AY   + +NG L     Q L R  G G E  P
Sbjct:   73 IQTTSNANSSQFPADIFSLQTRRRGGVIVHIGLLIYMFVALAVVCDEFFVPSLSVITEVLAISDDVAGATFMAAGGSAPEFFTSLFGVFVAQDNVGVGTIVGSATFNILCVLAFCTLFSRQVLHLTWWPLFRDMSFYTLSLFLLLIFFGDEVIEWQEALVMFSMYIAYGFFMKFNGFLELKTKQFLFRKVGIGSEIAP 270          

HSP 2 Score: 130.568 bits (327), Expect = 5.755e-32
Identity = 73/195 (37.44%), Postives = 118/195 (60.51%), Query Frame = 1
Query:  940 TNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSF----LNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALY 1512
            ++  E P     P +   +L ++ + P+     +T+PD RKP + RK F +TF  +++WI+  +Y++VW    IG+T  IP  IMGLT LAAGTSIPD I   +VA+ G GDMA+S+SIGSN+FD+ + L +PW I  +       P   I V S+ L+ +   L + ++VL+  + +++WK+++F G + +  Y
Sbjct:  440 SSTAEKPLDLSWPEANHKKLIYLFLAPITFPLAYTLPDVRKPSL-RKFFAITFIGAILWIAAYSYLMVWWANTIGETFGIPTEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSIGSNLFDVCVGLPIPWLIHFAIGVFKSEPTQNISVTSNGLVCSLGLLFAMLIVLLTCVAISRWKMDKFFGLLMIFSY 633          
BLAST of slc24a-8 vs. Ensembl Celegans
Match: ncx-4 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q1ZXT5])

HSP 1 Score: 155.606 bits (392), Expect = 9.530e-41
Identity = 81/156 (51.92%), Postives = 113/156 (72.44%), Query Frame = 1
Query:  256 EFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYV 723
            +FP D  + ++R+NG ++ H+   IY+FV+LAI+CDE+FV SL+ L E  ++  DVAGATFMAAG SAPE  TSVIGVFI +++VGI TIVGSA FN+LC++A C +F  S++ L WWP+FRD  IY L++  L+    D +I + EAL M  +Y+
Sbjct:   86 QFPPDPFSLEQRQNGFVVLHMCGLIYMFVSLAIVCDEFFVPSLDVLTEKLSLSDDVAGATFMAAGGSAPEFFTSVIGVFIAQNNVGIGTIVGSATFNILCVLAFCTLFSKSILDLTWWPLFRDVSIYMLALAMLVFFFMDEMITFPEALAMFSIYI 241          

HSP 2 Score: 125.176 bits (313), Expect = 3.317e-30
Identity = 85/232 (36.64%), Postives = 125/232 (53.88%), Query Frame = 1
Query:  886 ETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFL--------NPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNIL 1557
             +  ++ I S +   E      E P     P ++  RL +V + PV    + TIPD RK    R L+  TF IS++WI+  +Y++VW    IG+T  IP  I+GLT LAAGTSIPD I   +VA+ G GDMA+S+S+GSN+FD+ + L +PW +   FL         P S I V S  L+ +   L   ++VLV  I ++ WK+N+  G + +  Y+     S   E + L
Sbjct:  366 RSSQIEEIKSLLEEQE------EKPLDMTWPETWVKRLTYVLLAPVVIPMWVTIPDVRKSHN-RGLYPATFIISILWIAFFSYLMVWWANTIGETFVIPTEIIGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDVCVGLPIPWLLY--FLIEYIKHPNEPLSPISVSSKGLLCSVGMLFIMLIVLVFAIFLSGWKMNKIFGILMIVSYVFFCVFSVSLETDKL 588          
BLAST of slc24a-8 vs. Ensembl Celegans
Match: ncx-4 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q1ZXT5])

HSP 1 Score: 85.8853 bits (211), Expect = 1.470e-19
Identity = 59/148 (39.86%), Postives = 84/148 (56.76%), Query Frame = 1
Query: 1138 LVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFL--------NPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNIL 1557
            +VW    IG+T  IP  I+GLT LAAGTSIPD I   +VA+ G GDMA+S+S+GSN+FD+ + L +PW +   FL         P S I V S  L+ +   L   ++VLV  I ++ WK+N+  G + +  Y+     S   E + L
Sbjct:    1 MVWWANTIGETFVIPTEIIGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDVCVGLPIPWLLY--FLIEYIKHPNEPLSPISVSSKGLLCSVGMLFIMLIVLVFAIFLSGWKMNKIFGILMIVSYVFFCVFSVSLETDKL 146          
BLAST of slc24a-8 vs. Ensembl Celegans
Match: ncx-6 (Putative sodium/calcium exchanger 6 [Source:UniProtKB/Swiss-Prot;Acc:P34315])

HSP 1 Score: 61.6178 bits (148), Expect = 9.755e-10
Identity = 39/115 (33.91%), Postives = 67/115 (58.26%), Query Frame = 1
Query: 1006 VAMLPVAAICYFTIPDCRKPGIWRKLF-LVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFI 1347
            +++L  AA+ +FT    ++P  ++ L     F +S+ WI + +  +V ++ ++G    +   ++GLT LA   SI D IA   VAK GY  MA++ +IG  +F++LI  GLP+ I
Sbjct:  406 LSVLLTAAVLFFT-ELHKEPPFYKSLISYAGFLMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLFNLLIGFGLPFTI 519          
BLAST of slc24a-8 vs. Ensembl Celegans
Match: ncx-7 (Putative sodium/calcium exchanger 7 [Source:UniProtKB/Swiss-Prot;Acc:P34322])

HSP 1 Score: 56.6102 bits (135), Expect = 3.365e-8
Identity = 32/97 (32.99%), Postives = 58/97 (59.79%), Query Frame = 1
Query: 1060 KPGIWRKLFLVTFFI-SVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFI 1347
            +P  +++++  + FI S+ WI + +  +V ++ ++G    +   ++GLT LA   SI D IA   V K GY  MA++ +IG  +F++L+  GLP+ I
Sbjct:  505 QPKYYKEIYSYSGFIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTI 601          
BLAST of slc24a-8 vs. Ensembl Fly
Match: zyd (gene:FBgn0265767 transcript:FBtr0340198)

HSP 1 Score: 306.22 bits (783), Expect = 6.980e-98
Identity = 185/496 (37.30%), Postives = 282/496 (56.85%), Query Frame = 1
Query:  232 NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEA--LIMLF------MYVAXXXXXXXXXXXXXFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDS---------------------------SEEEEIMETGDVDSIHSRIRL-----DEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSF--LNPGSE-IPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRT 1590
            NCT  +I++FP D  +  +R++G ++ H+  S+YLFVALA++CDEYFV ++E++C   N+ +DVAGATFMAA +SAPEL  +VIG FIT+ D+G+ TIVGSAVFN+L + A CGI  G  I L+WWP+ RD I Y +++  LI +++D  ++WYEA  L+ L+      MY            +   + Q +  ++  G  +         +  G                               S    I++   +D   +   +     DE     G S   +    S   +  W+ + P+  +    IPDC+K     K+F +TF + ++WI   +Y++ WMI +IGDTL IPD++MG+TFLAAGTS+P+A++  +VAK G+G M I NSIGSN FDIL+CLG+PW I+  F  + PG   + + S+ L ++ ITLLST+ +L  T   NK+KL++ +G   L +Y++ +  +SL ELN+    N P C R+
Sbjct:    5 NCTQPAIDDFPRDLFSEAQRQSGAVVLHVIASLYLFVALAVVCDEYFVPAVEKICAALNMSNDVAGATFMAAATSAPELFVNVIGTFITEGDIGVGTIVGSAVFNILAVAACCGIGAGMTIPLDWWPLTRDSIAYGVTVAILICVMHDERVEWYEALILVSLYAVYLAVMYFDKTFQKCAKELVENRICQNMANIQLNGGLNKEQAKATSTSGAGTTAISITTSTMTTTLSTTHSAGGGGGAVGLCSGPGAIVQMAPLDDAEAESHVAVAAADEGRKEEGYSLLSYPKDKSCFAQFTWLIIWPIHLLFRIAIPDCKKAKN-NKIFPLTFIMCIVWIGSLSYVVAWMITIIGDTLKIPDSVMGITFLAAGTSVPEAVSSVIVAKRGHGSMGICNSIGSNTFDILLCLGVPWLIKAVFFPIQPGQNYVAINSAGLEYSAITLLSTLFLLYLTFSTNKFKLDKKVGTACLVMYLVFMVFASLIELNVFFRVNLPTCGRS 499          
BLAST of slc24a-8 vs. Ensembl Fly
Match: CG12061 (gene:FBgn0040031 transcript:FBtr0332625)

HSP 1 Score: 247.284 bits (630), Expect = 6.240e-76
Identity = 158/451 (35.03%), Postives = 253/451 (56.10%), Query Frame = 1
Query:  211 RKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQ-----RLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFEL 1548
            R  +  +NCT  +I EFPN     +++    I+    VS+YLFV LAI+CD+Y V ++ERLC    + +DVAGATF+AA +SAPEL  + +G F+T  D+G+ TIVGS+VFN+L I  +CGIF      L+WWP+ RD   Y ++I +L  +L D L+ WYEA  +L +Y++             +VIQ     R+  L  +    + L+ ++  T         EEE ++ G  D + ++ + + +                F    +W    P   +   T+P        R +F ++   +++WIS+ +Y+L W + ++G  L+IPD IMGLT LAAGTS+P+  + Y+V+K GYG MAI N+IGSN FDIL+CLGLPW ++   L    +I ++S++L  TT  L+ T  VL   ++  ++ + + +G++ +  Y L + ++   E+
Sbjct:   29 RYDIDARNCTLPAIVEFPN---LMRQKSWIAIVVSTLVSMYLFVILAIVCDDYLVPAMERLCYTLRMTYDVAGATFLAASTSAPELFVNFVGTFVTNGDIGLGTIVGSSVFNILVIAGVCGIFTQPT-KLDWWPVTRDTAWYLIAIASLTYVLWDSLVMWYEAFALLLLYIS-------------YVIQLSFDRRIQNLVRHEHAESELLDEDPMT--------REEEPLK-GFRDHVCAKPKTEYN----------------FYQWTWWAIKYPAELMLACTVPSA------RSIFFLSMISAILWISLISYLLTWFLTILGYNLNIPDAIMGLTVLAAGTSVPEVASSYIVSKKGYGSMAICNAIGSNTFDILVCLGLPWLLK--ILIYQQKIDIDSTALTITTAMLVVTAAVLYLGLLARRFVMGKTVGYLSIIFYALFLIIACTLEI 429          
BLAST of slc24a-8 vs. Ensembl Fly
Match: CG12061 (gene:FBgn0040031 transcript:FBtr0333740)

HSP 1 Score: 196.823 bits (499), Expect = 1.282e-57
Identity = 131/389 (33.68%), Postives = 214/389 (55.01%), Query Frame = 1
Query:  397 EVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQ-----RLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFEL 1548
                + +DVAGATF+AA +SAPEL  + +G F+T  D+G+ TIVGS+VFN+L I  +CGIF      L+WWP+ RD   Y ++I +L  +L D L+ WYEA  +L +Y++             +VIQ     R+  L  +    + L+ ++  T         EEE ++ G  D + ++ + + +                F    +W    P   +   T+P  R       +F ++   +++WIS+ +Y+L W + ++G  L+IPD IMGLT LAAGTS+P+  + Y+V+K GYG MAI N+IGSN FDIL+CLGLPW ++   L    +I ++S++L  TT  L+ T  VL   ++  ++ + + +G++ +  Y L + ++   E+
Sbjct:   15 NALRMTYDVAGATFLAASTSAPELFVNFVGTFVTNGDIGLGTIVGSSVFNILVIAGVCGIFTQPT-KLDWWPVTRDTAWYLIAIASLTYVLWDSLVMWYEAFALLLLYIS-------------YVIQLSFDRRIQNLVRHEHAESELLDEDPMT--------REEEPLK-GFRDHVCAKPKTEYN----------------FYQWTWWAIKYPAELMLACTVPSARS------IFFLSMISAILWISLISYLLTWFLTILGYNLNIPDAIMGLTVLAAGTSVPEVASSYIVSKKGYGSMAICNAIGSNTFDILVCLGLPWLLK--ILIYQQKIDIDSTALTITTAMLVVTAAVLYLGLLARRFVMGKTVGYLSIIFYALFLIIACTLEI 356          
BLAST of slc24a-8 vs. Ensembl Fly
Match: CG1090 (gene:FBgn0037238 transcript:FBtr0335201)

HSP 1 Score: 194.897 bits (494), Expect = 1.583e-54
Identity = 101/196 (51.53%), Postives = 142/196 (72.45%), Query Frame = 1
Query: 1003 WVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRT 1590
            W  + P+  +C  T+PDCR+   +R  +  TF +S++WIS  +Y +VWMI +IG TL IPDT+MGLTF+AAG S+PDA++   V K+G+GDMA+SN+IGSNVFDIL+CLGLPWFI+T+ + PGS + V S  L ++T++L STVV L+ +  +N WKL++ LG I +  Y+  I L+SL+ELN+ G  N P CP T
Sbjct:  438 WYVVYPIHFLCKKTMPDCRQEQ-YRNWYPFTFLMSMVWISFYSYFMVWMITVIGSTLAIPDTVMGLTFVAAGVSVPDALSSIAVIKEGFGDMAVSNAIGSNVFDILVCLGLPWFIQTAIIKPGSHVNVISKGLAYSTLSLFSTVVFLILSTHLNGWKLDKRLGIILMVWYLFFITLASLYELNVFGYMNPPECPST 632          

HSP 2 Score: 177.948 bits (450), Expect = 2.205e-48
Identity = 89/165 (53.94%), Postives = 124/165 (75.15%), Query Frame = 1
Query:  232 NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVA 726
            NCT  +IE+FP   M +  R++GG+I HI V+++ F  LAI+CDEYFV+SL+RLCE   +  DVAGATFMAAGSSAPEL T VIGVF  K D+GIS ++GSAVFN++ +I++C +  G+V  LNWWP+ RDC  YC+SI+ ++II+ + +I  +E+++ML  YV 
Sbjct:   90 NCTPPAIEQFPQPLMNKWARQHGGLILHILVAVFTFFGLAIVCDEYFVASLDRLCEELKLSPDVAGATFMAAGSSAPELATVVIGVFFAKDDIGISGVIGSAVFNIMFVISVCALCSGTVCQLNWWPLVRDCFFYCVSILVMLIIIFNDVISCFESVVMLLCYVG 254          
BLAST of slc24a-8 vs. Ensembl Fly
Match: CG1090 (gene:FBgn0037238 transcript:FBtr0335203)

HSP 1 Score: 194.897 bits (494), Expect = 1.583e-54
Identity = 101/196 (51.53%), Postives = 142/196 (72.45%), Query Frame = 1
Query: 1003 WVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRT 1590
            W  + P+  +C  T+PDCR+   +R  +  TF +S++WIS  +Y +VWMI +IG TL IPDT+MGLTF+AAG S+PDA++   V K+G+GDMA+SN+IGSNVFDIL+CLGLPWFI+T+ + PGS + V S  L ++T++L STVV L+ +  +N WKL++ LG I +  Y+  I L+SL+ELN+ G  N P CP T
Sbjct:  438 WYVVYPIHFLCKKTMPDCRQEQ-YRNWYPFTFLMSMVWISFYSYFMVWMITVIGSTLAIPDTVMGLTFVAAGVSVPDALSSIAVIKEGFGDMAVSNAIGSNVFDILVCLGLPWFIQTAIIKPGSHVNVISKGLAYSTLSLFSTVVFLILSTHLNGWKLDKRLGIILMVWYLFFITLASLYELNVFGYMNPPECPST 632          

HSP 2 Score: 177.948 bits (450), Expect = 2.205e-48
Identity = 89/165 (53.94%), Postives = 124/165 (75.15%), Query Frame = 1
Query:  232 NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVA 726
            NCT  +IE+FP   M +  R++GG+I HI V+++ F  LAI+CDEYFV+SL+RLCE   +  DVAGATFMAAGSSAPEL T VIGVF  K D+GIS ++GSAVFN++ +I++C +  G+V  LNWWP+ RDC  YC+SI+ ++II+ + +I  +E+++ML  YV 
Sbjct:   90 NCTPPAIEQFPQPLMNKWARQHGGLILHILVAVFTFFGLAIVCDEYFVASLDRLCEELKLSPDVAGATFMAAGSSAPELATVVIGVFFAKDDIGISGVIGSAVFNIMFVISVCALCSGTVCQLNWWPLVRDCFFYCVSILVMLIIIFNDVISCFESVVMLLCYVG 254          
BLAST of slc24a-8 vs. Ensembl Zebrafish
Match: slc24a5 (solute carrier family 24 member 5 [Source:ZFIN;Acc:ZDB-GENE-031210-1])

HSP 1 Score: 355.91 bits (912), Expect = 7.256e-117
Identity = 199/459 (43.36%), Postives = 298/459 (64.92%), Query Frame = 1
Query:  211 RKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRL--------PRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
            R L     C      EFP  F T +ERK+GGI+ +  +  Y+ ++++I+CDEYF+ SLE + E   +  DVAGATFMAAGSSAPEL T+ +GVF+TK D+G+STI+GSAV+N+LCI A CG+   +V  L+ WP+FRDC+ Y +S+ A+I I++D  + WY+   +L +Y  Y+ +L ++  +  +V+QR         PR +  GE+  PL+  +  +S  +   S  +  +   D    H  + L        E  ++F +P+    R+ WV  LPV+ + + ++PDCR+P  W+  +++TF +S +WIS  TY+LVWM+ ++G+TL IPDT+MG+T LAAGTSIPD +A  +VA++G  DMA+SN +GSNVFD+L CLGLPWFI+T F++ GS + V SS L+F + TLL +++ L   + +N WKL+  LG + LA Y+L   LS L+EL I+GN
Sbjct:   50 RDLENASECVQPQSSEFPEGFFTVQERKDGGILIYFMIIFYMLLSVSIVCDEYFLPSLEVISERLGLSQDVAGATFMAAGSSAPELVTAFLGVFVTKGDIGVSTIMGSAVYNLLCICAACGLLSSAVGRLSCWPLFRDCVAYSISVAAVIAIISDNRVYWYDGACLLLVYGVYVAVLCFDLKISEYVMQRFSPCCWCLKPRDRDSGEQQ-PLVGWSDDSSLRVQRRSRNDSGIFQDDSGYSHLSLSLHGLNEISDEHKSVFSMPDHDLKRILWVLSLPVSTLLFVSVPDCRRP-FWKNFYMLTFLMSAVWISAFTYVLVWMVTIVGETLGIPDTVMGMTLLAAGTSIPDTVASVMVAREGKSDMAMSNIVGSNVFDML-CLGLPWFIQTVFVDVGSPVDVNSSGLVFMSCTLLLSIIFLFLAVHINGWKLDWKLGLVCLACYILFATLSILYELGIIGN 505          
BLAST of slc24a-8 vs. Ensembl Zebrafish
Match: CABZ01081780.1 (sodium/potassium/calcium exchanger 2-like [Source:NCBI gene;Acc:571043])

HSP 1 Score: 264.618 bits (675), Expect = 5.689e-81
Identity = 177/486 (36.42%), Postives = 272/486 (55.97%), Query Frame = 1
Query:  238 TTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFV-----------------IQRL-------PRLKGYGEE---HNPLISQNL-PTSFGLLDSSEEEEIMETGDV-DSIHSRIRLDEDMTNLG--------ESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCP 1584
            +  S  ++P D  + ++R+ G ++ H+F  +Y+F+ALAI+CDE+FV +L  + E   I  DVAGATFMAAG SAPEL TSVIGVFI+ S+VGI TIVGSAVFN+L +I +C +F   +++L WWP+FRD   Y + +I LI+   D +I + E++ +L  Y AY++ + +NGN+   V                 + R+       PRL+  G     HN L+  ++       LD   E +  E   +   I  +    ED   +         + P     P S   R  ++ +LP+    + T+PD RKP   +K F VTF  ++ WI+  +Y++VW    +G+T+ I + IMGLT LAAGTSIPD I   +VA+ G GDMA+S+S+GSN+FDI + L  PW +  S +N    + V S+ L    + L   ++ ++ +I   KW++++ LGFI   LY++ + +S L E  ++       CP
Sbjct:   85 SNESQGDYPTDLFSLEDRRRGAVLLHMFGMLYMFIALAIVCDEFFVPALTVITEKLTISDDVAGATFMAAGGSAPELFTSVIGVFISHSNVGIGTIVGSAVFNILFVIGMCALFSKEILNLTWWPLFRDVSFYIIGLIMLIVFFLDNIITYCESISLLLAYAAYVLFMKFNGNVETLVKRMMNRNQVVEVEAQPKVNRMKHFENARPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLSEGKFREKASILHKIAKKKCQVEDSNGVAGAEEDEEDDQPLSLSWPESCQKRFTYLFILPIVFPLWITLPDVRKP-TSKKFFPVTFLGAICWIAGFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLL-FSMVNGMVPVQVSSNGLFCAIVLLFLMLLFVIVSIAACKWRMSKLLGFIMFLLYIVFLVVSVLLEDKVIA------CP 562          
BLAST of slc24a-8 vs. Ensembl Zebrafish
Match: CABZ01081780.1 (sodium/potassium/calcium exchanger 2-like [Source:NCBI gene;Acc:571043])

HSP 1 Score: 264.233 bits (674), Expect = 7.381e-81
Identity = 177/486 (36.42%), Postives = 272/486 (55.97%), Query Frame = 1
Query:  238 TTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFV-----------------IQRL-------PRLKGYGEE---HNPLISQNL-PTSFGLLDSSEEEEIMETGDV-DSIHSRIRLDEDMTNLG--------ESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCP 1584
            +  S  ++P D  + ++R+ G ++ H+F  +Y+F+ALAI+CDE+FV +L  + E   I  DVAGATFMAAG SAPEL TSVIGVFI+ S+VGI TIVGSAVFN+L +I +C +F   +++L WWP+FRD   Y + +I LI+   D +I + E++ +L  Y AY++ + +NGN+   V                 + R+       PRL+  G     HN L+  ++       LD   E +  E   +   I  +    ED   +         + P     P S   R  ++ +LP+    + T+PD RKP   +K F VTF  ++ WI+  +Y++VW    +G+T+ I + IMGLT LAAGTSIPD I   +VA+ G GDMA+S+S+GSN+FDI + L  PW +  S +N    + V S+ L    + L   ++ ++ +I   KW++++ LGFI   LY++ + +S L E  ++       CP
Sbjct:   94 SNESQGDYPTDLFSLEDRRRGAVLLHMFGMLYMFIALAIVCDEFFVPALTVITEKLTISDDVAGATFMAAGGSAPELFTSVIGVFISHSNVGIGTIVGSAVFNILFVIGMCALFSKEILNLTWWPLFRDVSFYIIGLIMLIVFFLDNIITYCESISLLLAYAAYVLFMKFNGNVETLVKRMMNRNQVVEVEAQPKVNRMKHFENARPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLSEGKFREKASILHKIAKKKCQVEDSNGVAGAEEDEEDDQPLSLSWPESCQKRFTYLFILPIVFPLWITLPDVRKP-TSKKFFPVTFLGAICWIAGFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLL-FSMVNGMVPVQVSSNGLFCAIVLLFLMLLFVIVSIAACKWRMSKLLGFIMFLLYIVFLVVSVLLEDKVIA------CP 571          
BLAST of slc24a-8 vs. Ensembl Zebrafish
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 198.364 bits (503), Expect = 1.363e-55
Identity = 99/164 (60.37%), Postives = 128/164 (78.05%), Query Frame = 1
Query:  229 KNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMY 720
            KNCT  +I EFP+D  T  ERK+G ++ HI  ++Y+F+ALAI+CD+YFV+SLE++CE  N+  DVAGATFMAAGSSAPEL  SVIGVFIT  DVG+ TIVGSAVFN+LCII +CGIF G V+ L WW +FRD   Y LS++ALI+ + D  I W+E+L+++ MY
Sbjct:  128 KNCTEPAIHEFPDDVFTNAERKSGAVLLHIIAALYMFLALAIVCDDYFVTSLEKICEKLNLSEDVAGATFMAAGSSAPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGIFAGQVVLLTWWAVFRDSFFYILSVVALIVFIYDEKIVWWESLVLVVMY 291          

HSP 2 Score: 176.407 bits (446), Expect = 1.022e-47
Identity = 99/233 (42.49%), Postives = 147/233 (63.09%), Query Frame = 1
Query:  883 METGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            +E G+V    S    + ++T      T F +P+   +R  W+   P+  I +FTIP+C K   W K F+++F +S +WI+V +Y +VWM+ +IG TL IPD IMG+TFLAAGTS+PD IA  +VA+ G GDMA+SN+IGSNVFDIL+ LG+PW ++T  +N GS + + S  L+++ + LL +V + +  I +N WKL+  LG   L LY + +  S + E N+    N P C
Sbjct:  408 IENGNVPEDKSTEEKESELT------TPFRLPDGCMNRTKWLISWPLLLILFFTIPNCAKSR-WEKYFMLSFILSTVWIAVFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWALQTMAVNYGSVVMINSRGLLYSVVLLLGSVALTILGIHLNHWKLDFKLGVYVLLLYAVFLCFSIMIEYNVFTFVNLPMC 633          
BLAST of slc24a-8 vs. Ensembl Zebrafish
Match: slc24a4a (solute carrier family 24 member 4a [Source:ZFIN;Acc:ZDB-GENE-050417-291])

HSP 1 Score: 192.2 bits (487), Expect = 1.529e-53
Identity = 101/202 (50.00%), Postives = 140/202 (69.31%), Query Frame = 1
Query:  145 GMYFFTKFKSNSDTMSELHGTGRKLLGL--------KNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVA 726
            G+     F ++SD +      GR+L+          KNCT  +I EFP D  T ++R  G ++ HIF ++Y+F+ALAI+CD+YFV+SLE++CE  ++  DVAGATFMAAGSSAPEL  S+IGVFIT  DVG+ TIVGSAVFN+LCII +CGIF G V+ L  + +FRD   Y +S+IALI+ + D  I W+E+L+++ MY+ 
Sbjct:   62 GLVMQEGFAASSDRL------GRRLMATVGDNETQEKNCTAPAIHEFPEDLFTNQQRSQGAVLLHIFAALYMFLALAIVCDDYFVTSLEKICEKLHLSEDVAGATFMAAGSSAPELFASIIGVFITHGDVGVGTIVGSAVFNILCIIGVCGIFAGQVVFLTKYAVFRDSSYYIISVIALIVFIYDDEILWWESLVLIVMYLG 257          

HSP 2 Score: 180.259 bits (456), Expect = 2.741e-49
Identity = 104/243 (42.80%), Postives = 154/243 (63.37%), Query Frame = 1
Query:  853 LLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            +L S ++ + ME G+V    +  +L E+  N   SP  F +P      + +    P++ + YFTIP+C K   W   F+++FF+S +WI+  +YILVWM+ ++G TL IPD IMG+TFLAAGTS+PD IA  +VA+ G GDMA+SN+IGSNVFDIL+ LG+PW I+T  +N GS + + S  L+++ + LL +V + V  I VN+W+L+  LG   L LY + +  S + E N+    N P C
Sbjct:  363 VLVSDQKADTMENGNV----AEDKLSEEQEN-EISP--FRLPEGAMDTVKFFISWPISLLLYFTIPNCAKKR-WECCFMLSFFLSTVWIAAFSYILVWMVTIVGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGIQTMAVNYGSVVKINSRGLVYSVVLLLGSVALTVLGIHVNRWRLDLRLGIYVLVLYAIFLTFSIMIEYNVFTFVNLPMC 597          
BLAST of slc24a-8 vs. Ensembl Xenopus
Match: SLC24A5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:100490024])

HSP 1 Score: 347.051 bits (889), Expect = 6.722e-114
Identity = 198/450 (44.00%), Postives = 289/450 (64.22%), Query Frame = 1
Query:  235 CTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLP------RLKGYGE-EHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
            C      EFP DF T +ERK GG+I H  + +Y+F+A+AI+C+ YF+ SLE + E   +  DVAGATFMA GSSAPE  T  +GVF+TK D+G+STIVGSAV+N+L I A C +   SV  L  WP+FRDC+ Y +S+ A+I I  D  I WYE+  ++ +Y  YI+ + ++  +  ++++R        R    G  EH PL+     +   +   S  +  +   + D     I L     +    P++F +P +   R+ WV  LP+  + Y T+PDCR+   W+ LF++TF +S +WIS  TYILVWM+ ++G+TL IPDT+MGLT LAAGTSIPD +A  LVA++G GDMA+SN +GSNVFD+L CLG+PWFI+T F++  + + V SS + +TTI+LL +++ +   I +N WKL++ LG + L +Y+L + LS L+EL I+GN
Sbjct:    8 CIASPSSEFPEDFFTEQERKQGGLIIHFLIILYMFLAVAIVCESYFIPSLEVISERLGLSQDVAGATFMAIGSSAPEFVTVFLGVFVTKGDIGVSTIVGSAVYNLLGICAACCLLSLSVSRLTCWPLFRDCVAYAISVAAVIAITFDNRIYWYESASLILIYGIYIVTMCFDIRINQYIMRRFSPCCTCCREAMVGNTEHEPLLGWKEDSLPVIRRHSRSDSGIFQEESDYSQLSISLSGLKESSNNPPSVFTMPENDLKRIIWVLSLPIITLLYLTVPDCRRKR-WKNLFILTFLMSAVWISAVTYILVWMVTVVGETLSIPDTVMGLTLLAAGTSIPDTVASVLVAREGKGDMAMSNIVGSNVFDML-CLGVPWFIKTVFVDRSAPVEVNSSGITYTTISLLFSILFIFVAIHLNGWKLDKKLGVMCLLMYLLFVTLSILYELGIIGN 455          
BLAST of slc24a-8 vs. Ensembl Xenopus
Match: SLC24A5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:100490024])

HSP 1 Score: 349.747 bits (896), Expect = 8.236e-114
Identity = 204/488 (41.80%), Postives = 301/488 (61.68%), Query Frame = 1
Query:  121 FFYFSLVIGMYFFTKFKSNSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLP------RLKGYGE-EHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
            F  F +V G  +     + S  ++      R +     C      EFP DF T +ERK GG+I H  + +Y+F+A+AI+C+ YF+ SLE + E   +  DVAGATFMA GSSAPE  T  +GVF+TK D+G+STIVGSAV+N+L I A C +   SV  L  WP+FRDC+ Y +S+ A+I I  D  I WYE+  ++ +Y  YI+ + ++  +  ++++R        R    G  EH PL+     +   +   S  +  +   + D     I L     +    P++F +P +   R+ WV  LP+  + Y T+PDCR+   W+ LF++TF +S +WIS  TYILVWM+ ++G+TL IPDT+MGLT LAAGTSIPD +A  LVA++G GDMA+SN +GSNVFD+L CLG+PWFI+T F++  + + V SS + +TTI+LL +++ +   I +N WKL++ LG + L +Y+L + LS L+EL I+GN
Sbjct:   53 FALFLIVCGTVYLVNQVATSLVVTGTQRIRRDVENETLCIASPSSEFPEDFFTEQERKQGGLIIHFLIILYMFLAVAIVCESYFIPSLEVISERLGLSQDVAGATFMAIGSSAPEFVTVFLGVFVTKGDIGVSTIVGSAVYNLLGICAACCLLSLSVSRLTCWPLFRDCVAYAISVAAVIAITFDNRIYWYESASLILIYGIYIVTMCFDIRINQYIMRRFSPCCTCCREAMVGNTEHEPLLGWKEDSLPVIRRHSRSDSGIFQEESDYSQLSISLSGLKESSNNPPSVFTMPENDLKRIIWVLSLPIITLLYLTVPDCRRKR-WKNLFILTFLMSAVWISAVTYILVWMVTVVGETLSIPDTVMGLTLLAAGTSIPDTVASVLVAREGKGDMAMSNIVGSNVFDML-CLGVPWFIKTVFVDRSAPVEVNSSGITYTTISLLFSILFIFVAIHLNGWKLDKKLGVMCLLMYLLFVTLSILYELGIIGN 538          
BLAST of slc24a-8 vs. Ensembl Xenopus
Match: SLC24A5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:100490024])

HSP 1 Score: 347.051 bits (889), Expect = 9.852e-114
Identity = 198/450 (44.00%), Postives = 289/450 (64.22%), Query Frame = 1
Query:  235 CTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLP------RLKGYGE-EHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
            C      EFP DF T +ERK GG+I H  + +Y+F+A+AI+C+ YF+ SLE + E   +  DVAGATFMA GSSAPE  T  +GVF+TK D+G+STIVGSAV+N+L I A C +   SV  L  WP+FRDC+ Y +S+ A+I I  D  I WYE+  ++ +Y  YI+ + ++  +  ++++R        R    G  EH PL+     +   +   S  +  +   + D     I L     +    P++F +P +   R+ WV  LP+  + Y T+PDCR+   W+ LF++TF +S +WIS  TYILVWM+ ++G+TL IPDT+MGLT LAAGTSIPD +A  LVA++G GDMA+SN +GSNVFD+L CLG+PWFI+T F++  + + V SS + +TTI+LL +++ +   I +N WKL++ LG + L +Y+L + LS L+EL I+GN
Sbjct:   20 CIASPSSEFPEDFFTEQERKQGGLIIHFLIILYMFLAVAIVCESYFIPSLEVISERLGLSQDVAGATFMAIGSSAPEFVTVFLGVFVTKGDIGVSTIVGSAVYNLLGICAACCLLSLSVSRLTCWPLFRDCVAYAISVAAVIAITFDNRIYWYESASLILIYGIYIVTMCFDIRINQYIMRRFSPCCTCCREAMVGNTEHEPLLGWKEDSLPVIRRHSRSDSGIFQEESDYSQLSISLSGLKESSNNPPSVFTMPENDLKRIIWVLSLPIITLLYLTVPDCRRKR-WKNLFILTFLMSAVWISAVTYILVWMVTVVGETLSIPDTVMGLTLLAAGTSIPDTVASVLVAREGKGDMAMSNIVGSNVFDML-CLGVPWFIKTVFVDRSAPVEVNSSGITYTTISLLFSILFIFVAIHLNGWKLDKKLGVMCLLMYLLFVTLSILYELGIIGN 467          
BLAST of slc24a-8 vs. Ensembl Xenopus
Match: SLC24A5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:100490024])

HSP 1 Score: 346.28 bits (887), Expect = 1.450e-113
Identity = 198/450 (44.00%), Postives = 289/450 (64.22%), Query Frame = 1
Query:  235 CTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLP------RLKGYGE-EHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
            C      EFP DF T +ERK GG+I H  + +Y+F+A+AI+C+ YF+ SLE + E   +  DVAGATFMA GSSAPE  T  +GVF+TK D+G+STIVGSAV+N+L I A C +   SV  L  WP+FRDC+ Y +S+ A+I I  D  I WYE+  ++ +Y  YI+ + ++  +  ++++R        R    G  EH PL+     +   +   S  +  +   + D     I L     +    P++F +P +   R+ WV  LP+  + Y T+PDCR+   W+ LF++TF +S +WIS  TYILVWM+ ++G+TL IPDT+MGLT LAAGTSIPD +A  LVA++G GDMA+SN +GSNVFD+L CLG+PWFI+T F++  + + V SS + +TTI+LL +++ +   I +N WKL++ LG + L +Y+L + LS L+EL I+GN
Sbjct:   14 CIASPSSEFPEDFFTEQERKQGGLIIHFLIILYMFLAVAIVCESYFIPSLEVISERLGLSQDVAGATFMAIGSSAPEFVTVFLGVFVTKGDIGVSTIVGSAVYNLLGICAACCLLSLSVSRLTCWPLFRDCVAYAISVAAVIAITFDNRIYWYESASLILIYGIYIVTMCFDIRINQYIMRRFSPCCTCCREAMVGNTEHEPLLGWKEDSLPVIRRHSRSDSGIFQEESDYSQLSISLSGLKESSNNPPSVFTMPENDLKRIIWVLSLPIITLLYLTVPDCRRKR-WKNLFILTFLMSAVWISAVTYILVWMVTVVGETLSIPDTVMGLTLLAAGTSIPDTVASVLVAREGKGDMAMSNIVGSNVFDML-CLGVPWFIKTVFVDRSAPVEVNSSGITYTTISLLFSILFIFVAIHLNGWKLDKKLGVMCLLMYLLFVTLSILYELGIIGN 461          
BLAST of slc24a-8 vs. Ensembl Xenopus
Match: SLC24A5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:100490024])

HSP 1 Score: 346.28 bits (887), Expect = 2.393e-113
Identity = 198/450 (44.00%), Postives = 289/450 (64.22%), Query Frame = 1
Query:  235 CTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLP------RLKGYGE-EHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
            C      EFP DF T +ERK GG+I H  + +Y+F+A+AI+C+ YF+ SLE + E   +  DVAGATFMA GSSAPE  T  +GVF+TK D+G+STIVGSAV+N+L I A C +   SV  L  WP+FRDC+ Y +S+ A+I I  D  I WYE+  ++ +Y  YI+ + ++  +  ++++R        R    G  EH PL+     +   +   S  +  +   + D     I L     +    P++F +P +   R+ WV  LP+  + Y T+PDCR+   W+ LF++TF +S +WIS  TYILVWM+ ++G+TL IPDT+MGLT LAAGTSIPD +A  LVA++G GDMA+SN +GSNVFD+L CLG+PWFI+T F++  + + V SS + +TTI+LL +++ +   I +N WKL++ LG + L +Y+L + LS L+EL I+GN
Sbjct:   31 CIASPSSEFPEDFFTEQERKQGGLIIHFLIILYMFLAVAIVCESYFIPSLEVISERLGLSQDVAGATFMAIGSSAPEFVTVFLGVFVTKGDIGVSTIVGSAVYNLLGICAACCLLSLSVSRLTCWPLFRDCVAYAISVAAVIAITFDNRIYWYESASLILIYGIYIVTMCFDIRINQYIMRRFSPCCTCCREAMVGNTEHEPLLGWKEDSLPVIRRHSRSDSGIFQEESDYSQLSISLSGLKESSNNPPSVFTMPENDLKRIIWVLSLPIITLLYLTVPDCRRKR-WKNLFILTFLMSAVWISAVTYILVWMVTVVGETLSIPDTVMGLTLLAAGTSIPDTVASVLVAREGKGDMAMSNIVGSNVFDML-CLGVPWFIKTVFVDRSAPVEVNSSGITYTTISLLFSILFIFVAIHLNGWKLDKKLGVMCLLMYLLFVTLSILYELGIIGN 478          
BLAST of slc24a-8 vs. Ensembl Mouse
Match: Slc24a5 (solute carrier family 24, member 5 [Source:MGI Symbol;Acc:MGI:2677271])

HSP 1 Score: 333.183 bits (853), Expect = 3.963e-108
Identity = 202/459 (44.01%), Postives = 292/459 (63.62%), Query Frame = 1
Query:  232 NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRL----PRLKGYGEEHNPLISQNLPTSFGLLDSSE----EEEIMETG--DVDSIHSRIRLD-EDMTNLGESP-TIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNR 1572
             C      EFP  F T++E  +GGI+ +  + +Y+ +A++I+CD+YF+ SLE + +   +  DVAGATFMAAGSSAPEL T+ +GVFITK D+GISTI+GSA++N+L I A CG+    V  L+ WP+FRDC +Y +S+ A+  I+ D  I WYE   +L +Y  Y+++L ++  +   V++      P L    EE    I Q   T  G  D S+     +   ++G    DS +S++ L    ++ + E P ++F +P +   R++WV  LP+  +   T PDCR+   W+  F++TFF+S +WIS  TYILVWM+ + G+TL IPDT+MGLT LAAGTSIPD +   LVA+ G GDMAISN +GSNVFD+L CLGLPWFI+T+F N  + I V S  L + TI+L  +++ L   +  N WKL+R LG + L LY+ +  LS L+E+ I+GN NR
Sbjct:   45 QCAVSPASEFPEGFFTKQESTDGGIVIYFLIILYMCMAISIVCDKYFLPSLEIISDSLGLSQDVAGATFMAAGSSAPELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNMVSTLSCWPLFRDCAVYAVSVGAVFGIIFDNRIYWYEGAGLLLIYGLYVLLLCFDTTISRHVMKTCSPCCPCLARAMEER---IEQQ--TLLGWEDESQLFIRRQSRTDSGIFQEDSGYSQLSLSLHGLSQVSEDPPSVFSMPEADLRRIFWVLSLPIITLLALTTPDCRRK-FWKNYFVITFFMSALWISAFTYILVWMVTVTGETLGIPDTVMGLTLLAAGTSIPDTVTSVLVARKGKGDMAISNIVGSNVFDML-CLGLPWFIKTAFTNASAPIEVNSKGLTYITISLNISILFLFLAVHFNGWKLDRKLGVVCLVLYLGLATLSVLYEIGIIGN-NR 495          
BLAST of slc24a-8 vs. Ensembl Mouse
Match: Slc24a4 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 4 [Source:MGI Symbol;Acc:MGI:2447362])

HSP 1 Score: 189.119 bits (479), Expect = 1.142e-52
Identity = 97/183 (53.01%), Postives = 130/183 (71.04%), Query Frame = 1
Query:  175 NSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYV 723
            N   M+ ++GT       KNCT  +I EFP D  + KER++G ++ HI  ++Y+F ALAI+CD++FV SLE++CE  ++  DVAGATFMAAGSS PEL  SVIGVFIT  DVG+ TIVGSAVFN+LCII +CG+F G V+ L WW + RD + Y LS+I LI  + D  I W+E L+++ +YV
Sbjct:   61 NRKLMAPINGTPLA----KNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSVIVLIAFIYDEEIVWWEGLVLIILYV 239          

HSP 2 Score: 150.214 bits (378), Expect = 9.254e-39
Identity = 70/141 (49.65%), Postives = 100/141 (70.92%), Query Frame = 1
Query:  967 FEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVE 1389
            F +P +   +  WV   P+  +   TIP+C KP  W K F+VTF  + +WI+V +Y++VW++ +IG TL IPD IMG+TFLAAGTS+PD +A  +VA+ G GDMA+SN+IGSNVFDIL+ LG+PW ++T  +N GS + + 
Sbjct:  396 FSMPEAKGDKAKWVFTWPLIFLLCVTIPNCSKPR-WEKFFMVTFITATLWIAVFSYLMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGLQTMVINYGSTVKIN 535          
BLAST of slc24a-8 vs. Ensembl Mouse
Match: Slc24a4 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 4 [Source:MGI Symbol;Acc:MGI:2447362])

HSP 1 Score: 189.504 bits (480), Expect = 1.790e-52
Identity = 97/183 (53.01%), Postives = 130/183 (71.04%), Query Frame = 1
Query:  175 NSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYV 723
            N   M+ ++GT       KNCT  +I EFP D  + KER++G ++ HI  ++Y+F ALAI+CD++FV SLE++CE  ++  DVAGATFMAAGSS PEL  SVIGVFIT  DVG+ TIVGSAVFN+LCII +CG+F G V+ L WW + RD + Y LS+I LI  + D  I W+E L+++ +YV
Sbjct:   44 NRKLMAPINGTPLA----KNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSVIVLIAFIYDEEIVWWEGLVLIILYV 222          

HSP 2 Score: 174.866 bits (442), Expect = 3.548e-47
Identity = 93/205 (45.37%), Postives = 136/205 (66.34%), Query Frame = 1
Query:  967 FEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            F +P +   +  WV   P+  +   TIP+C KP  W K F+VTF  + +WI+V +Y++VW++ +IG TL IPD IMG+TFLAAGTS+PD +A  +VA+ G GDMA+SN+IGSNVFDIL+ LG+PW ++T  +N GS + + S  L+++ + LL +V + V  I +NKW+L+R LG   L LY + +  S + E N+    N P C
Sbjct:  398 FSMPEAKGDKAKWVFTWPLIFLLCVTIPNCSKPR-WEKFFMVTFITATLWIAVFSYLMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGLQTMVINYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGIYVLVLYAVFLCFSIMIEFNVFTFVNLPMC 601          
BLAST of slc24a-8 vs. Ensembl Mouse
Match: Slc24a4 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 4 [Source:MGI Symbol;Acc:MGI:2447362])

HSP 1 Score: 189.504 bits (480), Expect = 2.139e-52
Identity = 97/183 (53.01%), Postives = 130/183 (71.04%), Query Frame = 1
Query:  175 NSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYV 723
            N   M+ ++GT       KNCT  +I EFP D  + KER++G ++ HI  ++Y+F ALAI+CD++FV SLE++CE  ++  DVAGATFMAAGSS PEL  SVIGVFIT  DVG+ TIVGSAVFN+LCII +CG+F G V+ L WW + RD + Y LS+I LI  + D  I W+E L+++ +YV
Sbjct:   61 NRKLMAPINGTPLA----KNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSVIVLIAFIYDEEIVWWEGLVLIILYV 239          

HSP 2 Score: 175.252 bits (443), Expect = 3.227e-47
Identity = 93/205 (45.37%), Postives = 136/205 (66.34%), Query Frame = 1
Query:  967 FEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            F +P +   +  WV   P+  +   TIP+C KP  W K F+VTF  + +WI+V +Y++VW++ +IG TL IPD IMG+TFLAAGTS+PD +A  +VA+ G GDMA+SN+IGSNVFDIL+ LG+PW ++T  +N GS + + S  L+++ + LL +V + V  I +NKW+L+R LG   L LY + +  S + E N+    N P C
Sbjct:  415 FSMPEAKGDKAKWVFTWPLIFLLCVTIPNCSKPR-WEKFFMVTFITATLWIAVFSYLMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGLQTMVINYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGIYVLVLYAVFLCFSIMIEFNVFTFVNLPMC 618          
BLAST of slc24a-8 vs. Ensembl Mouse
Match: Slc24a4 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 4 [Source:MGI Symbol;Acc:MGI:2447362])

HSP 1 Score: 188.734 bits (478), Expect = 2.422e-52
Identity = 97/183 (53.01%), Postives = 130/183 (71.04%), Query Frame = 1
Query:  175 NSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYV 723
            N   M+ ++GT       KNCT  +I EFP D  + KER++G ++ HI  ++Y+F ALAI+CD++FV SLE++CE  ++  DVAGATFMAAGSS PEL  SVIGVFIT  DVG+ TIVGSAVFN+LCII +CG+F G V+ L WW + RD + Y LS+I LI  + D  I W+E L+++ +YV
Sbjct:   61 NRKLMAPINGTPLA----KNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSVIVLIAFIYDEEIVWWEGLVLIILYV 239          

HSP 2 Score: 174.866 bits (442), Expect = 2.886e-47
Identity = 93/205 (45.37%), Postives = 136/205 (66.34%), Query Frame = 1
Query:  967 FEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            F +P +   +  WV   P+  +   TIP+C KP  W K F+VTF  + +WI+V +Y++VW++ +IG TL IPD IMG+TFLAAGTS+PD +A  +VA+ G GDMA+SN+IGSNVFDIL+ LG+PW ++T  +N GS + + S  L+++ + LL +V + V  I +NKW+L+R LG   L LY + +  S + E N+    N P C
Sbjct:  396 FSMPEAKGDKAKWVFTWPLIFLLCVTIPNCSKPR-WEKFFMVTFITATLWIAVFSYLMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGLQTMVINYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGIYVLVLYAVFLCFSIMIEFNVFTFVNLPMC 599          
BLAST of slc24a-8 vs. UniProt/SwissProt
Match: sp|Q49SH1|NCKX5_DANRE (Sodium/potassium/calcium exchanger 5 OS=Danio rerio OX=7955 GN=slc24a5 PE=2 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 4.865e-116
Identity = 199/459 (43.36%), Postives = 298/459 (64.92%), Query Frame = 1
Query:  211 RKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRL--------PRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
            R L     C      EFP  F T +ERK+GGI+ +  +  Y+ ++++I+CDEYF+ SLE + E   +  DVAGATFMAAGSSAPEL T+ +GVF+TK D+G+STI+GSAV+N+LCI A CG+   +V  L+ WP+FRDC+ Y +S+ A+I I++D  + WY+   +L +Y  Y+ +L ++  +  +V+QR         PR +  GE+  PL+  +  +S  +   S  +  +   D    H  + L        E  ++F +P+    R+ WV  LPV+ + + ++PDCR+P  W+  +++TF +S +WIS  TY+LVWM+ ++G+TL IPDT+MG+T LAAGTSIPD +A  +VA++G  DMA+SN +GSNVFD+L CLGLPWFI+T F++ GS + V SS L+F + TLL +++ L   + +N WKL+  LG + LA Y+L   LS L+EL I+GN
Sbjct:   50 RDLENASECVQPQSSEFPEGFFTVQERKDGGILIYFMIIFYMLLSVSIVCDEYFLPSLEVISERLGLSQDVAGATFMAAGSSAPELVTAFLGVFVTKGDIGVSTIMGSAVYNLLCICAACGLLSSAVGRLSCWPLFRDCVAYAISVAAVIAIISDNRVYWYDGACLLLVYGVYVAVLCFDLRISEYVMQRFSPCCWCLKPRDRDSGEQQ-PLVGWSDDSSLRVQRRSRNDSGIFQDDSGYSHLSLSLHGLNEISDEHKSVFSMPDHDLKRILWVLSLPVSTLLFVSVPDCRRP-FWKNFYMLTFLMSAVWISAFTYVLVWMVTIVGETLGIPDTVMGMTLLAAGTSIPDTVASVMVAREGKSDMAMSNIVGSNVFDML-CLGLPWFIQTVFVDVGSPVEVNSSGLVFMSCTLLLSIIFLFLAVHINGWKLDWKLGLVCLACYILFATLSILYELGIIGN 505          
BLAST of slc24a-8 vs. UniProt/SwissProt
Match: sp|Q71RS6|NCKX5_HUMAN (Sodium/potassium/calcium exchanger 5 OS=Homo sapiens OX=9606 GN=SLC24A5 PE=1 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 3.326e-115
Identity = 201/460 (43.70%), Postives = 292/460 (63.48%), Query Frame = 1
Query:  232 NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQR-----------LPR-----LKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
             C      EFP  F TR+ER++GGII +  + +Y+F+A++I+CDEYF+ SLE + E   +  DVAG TFMAAGSSAPEL T+ +GVFITK D+GISTI+GSA++N+L I A CG+   +V  L+ WP+FRDC  Y +S  A++ I+ D  + WYE  ++L +Y  Y+++L ++  +  ++I++           + R     L G+ +E  P I +   T  G+         +      S+H   ++ ED       P++F +P +   R++WV  LP+  + + T PDCRK   W+  F++TFF+S IWIS  TYILVWM+ + G+TL+IPDT+MGLT LAAGTSIPD IA  LVA+ G GDMA+SN +GSNVFD+L CLG+PWFI+T+F+N  +   V S  L + TI+L  +++ L   +  N WKL+R LG + L  Y+ +  LS L+EL I+GN
Sbjct:   45 QCVISPSSEFPEGFFTRQERRDGGIIIYFLIIVYMFMAISIVCDEYFLPSLEIISESLGLSQDVAGTTFMAAGSSAPELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNTVSTLSCWPLFRDCAAYTISAAAVLGIIYDNQVYWYEGALLLLIYGLYVLVLCFDIKINQYIIKKCSPCCACLAKAMERSEQQPLMGWEDEGQPFIRRQSRTDSGIFYEDSGYSQLSI----SLHGLSQVSED------PPSVFNMPEADLKRIFWVLSLPIITLLFLTTPDCRKK-FWKNYFVITFFMSAIWISAFTYILVWMVTITGETLEIPDTVMGLTLLAAGTSIPDTIASVLVARKGKGDMAMSNIVGSNVFDML-CLGIPWFIKTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLATLSVLYELGIIGN 492          
BLAST of slc24a-8 vs. UniProt/SwissProt
Match: sp|Q8C261|NCKX5_MOUSE (Sodium/potassium/calcium exchanger 5 OS=Mus musculus OX=10090 GN=Slc24a5 PE=2 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 2.772e-107
Identity = 202/459 (44.01%), Postives = 292/459 (63.62%), Query Frame = 1
Query:  232 NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRL----PRLKGYGEEHNPLISQNLPTSFGLLDSSE----EEEIMETG--DVDSIHSRIRLD-EDMTNLGESP-TIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNR 1572
             C      EFP  F T++E  +GGI+ +  + +Y+ +A++I+CD+YF+ SLE + +   +  DVAGATFMAAGSSAPEL T+ +GVFITK D+GISTI+GSA++N+L I A CG+    V  L+ WP+FRDC +Y +S+ A+  I+ D  I WYE   +L +Y  Y+++L ++  +   V++      P L    EE    I Q   T  G  D S+     +   ++G    DS +S++ L    ++ + E P ++F +P +   R++WV  LP+  +   T PDCR+   W+  F++TFF+S +WIS  TYILVWM+ + G+TL IPDT+MGLT LAAGTSIPD +   LVA+ G GDMAISN +GSNVFD+L CLGLPWFI+T+F N  + I V S  L + TI+L  +++ L   +  N WKL+R LG + L LY+ +  LS L+E+ I+GN NR
Sbjct:   45 QCAVSPASEFPEGFFTKQESTDGGIVIYFLIILYMCMAISIVCDKYFLPSLEIISDSLGLSQDVAGATFMAAGSSAPELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNMVSTLSCWPLFRDCAVYAVSVGAVFGIIFDNRIYWYEGAGLLLIYGLYVLLLCFDTTISRHVMKTCSPCCPCLARAMEER---IEQQ--TLLGWEDESQLFIRRQSRTDSGIFQEDSGYSQLSLSLHGLSQVSEDPPSVFSMPEADLRRIFWVLSLPIITLLALTTPDCRRK-FWKNYFVITFFMSALWISAFTYILVWMVTVTGETLGIPDTVMGLTLLAAGTSIPDTVTSVLVARKGKGDMAISNIVGSNVFDML-CLGLPWFIKTAFTNASAPIEVNSKGLTYITISLNISILFLFLAVHFNGWKLDRKLGVVCLVLYLGLATLSVLYEIGIIGN-NR 495          
BLAST of slc24a-8 vs. UniProt/SwissProt
Match: sp|Q9VN12|NCKXH_DROME (Probable sodium/potassium/calcium exchanger CG1090 OS=Drosophila melanogaster OX=7227 GN=CG1090 PE=2 SV=4)

HSP 1 Score: 194.897 bits (494), Expect = 1.587e-53
Identity = 101/196 (51.53%), Postives = 142/196 (72.45%), Query Frame = 1
Query: 1003 WVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRT 1590
            W  + P+  +C  T+PDCR+   +R  +  TF +S++WIS  +Y +VWMI +IG TL IPDT+MGLTF+AAG S+PDA++   V K+G+GDMA+SN+IGSNVFDIL+CLGLPWFI+T+ + PGS + V S  L ++T++L STVV L+ +  +N WKL++ LG I +  Y+  I L+SL+ELN+ G  N P CP T
Sbjct:  438 WYVVYPIHFLCKKTMPDCRQEQ-YRNWYPFTFLMSMVWISFYSYFMVWMITVIGSTLAIPDTVMGLTFVAAGVSVPDALSSIAVIKEGFGDMAVSNAIGSNVFDILVCLGLPWFIQTAIIKPGSHVNVISKGLAYSTLSLFSTVVFLILSTHLNGWKLDKRLGIILMVWYLFFITLASLYELNVFGYMNPPECPST 632          

HSP 2 Score: 177.948 bits (450), Expect = 2.211e-47
Identity = 89/165 (53.94%), Postives = 124/165 (75.15%), Query Frame = 1
Query:  232 NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVA 726
            NCT  +IE+FP   M +  R++GG+I HI V+++ F  LAI+CDEYFV+SL+RLCE   +  DVAGATFMAAGSSAPEL T VIGVF  K D+GIS ++GSAVFN++ +I++C +  G+V  LNWWP+ RDC  YC+SI+ ++II+ + +I  +E+++ML  YV 
Sbjct:   90 NCTPPAIEQFPQPLMNKWARQHGGLILHILVAVFTFFGLAIVCDEYFVASLDRLCEELKLSPDVAGATFMAAGSSAPELATVVIGVFFAKDDIGISGVIGSAVFNIMFVISVCALCSGTVCQLNWWPLVRDCFFYCVSILVMLIIIFNDVISCFESVVMLLCYVG 254          
BLAST of slc24a-8 vs. UniProt/SwissProt
Match: sp|Q9HC58|NCKX3_HUMAN (Sodium/potassium/calcium exchanger 3 OS=Homo sapiens OX=9606 GN=SLC24A3 PE=2 SV=4)

HSP 1 Score: 191.045 bits (484), Expect = 5.035e-52
Identity = 95/165 (57.58%), Postives = 129/165 (78.18%), Query Frame = 1
Query:  229 KNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYV 723
            KNCT  ++ EFPND  T ++R+ G ++ H+  +IY+F ALAI+CD++FV SLE++CE  ++  DVAGATFMAAGSSAPEL TSVIGVFITK DVG+ TIVGSAVFN+LCII +CG+F G V+ L+ W + RD I Y LS+IALI+ + D  + W+E+L+++ MY+
Sbjct:   85 KNCTEPALHEFPNDIFTNEDRRQGAVVLHVLCAIYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVIALIVFIYDEKVSWWESLVLVLMYL 249          

HSP 2 Score: 173.711 bits (439), Expect = 9.982e-46
Identity = 98/207 (47.34%), Postives = 138/207 (66.67%), Query Frame = 1
Query:  961 TIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            T F+ P+     + W    P++ + YFT+P+C KP  W K F+VTF  S +WI+  +Y++VWM+ +IG TL IPD IMG+TFLAAGTS+PD +A  +VA+ G GDMA+SNSIGSNVFDILI LGLPW ++T  ++ GS I + S  LI++   LL++V V V  + +NKW+L++ LG   L LY + +  S + E N+    N P C
Sbjct:  436 TPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPR-WEKWFMVTFASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVHLNKWQLDKKLGCGCLLLYGVFLCFSIMTEFNVFTFVNLPMC 641          
BLAST of slc24a-8 vs. TrEMBL
Match: A0A0H3YKA3 (Slc24a-8 OS=Schmidtea mediterranea OX=79327 GN=slc24a-8 PE=2 SV=1)

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 505/505 (100.00%), Postives = 505/505 (100.00%), Query Frame = 1
Query:   82 MLKKNHGAYFKILFFYFSLVIGMYFFTKFKSNSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRTSS 1596
            MLKKNHGAYFKILFFYFSLVIGMYFFTKFKSNSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCIIYCLSIIALIIILNDGLIQWYEALIMLFMYVAYIIILYYNGNLYGFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVESSSLIFTTITLLSTVVVLVATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRTSS
Sbjct:    1 MLKKNHGAYFKILFFYFSLVIGMYFFTKFKSNSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCIIYCLSIIALIIILNDGLIQWYEALIMLFMYVAYIIILYYNGNLYGFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVESSSLIFTTITLLSTVVVLVATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRTSS 505          
BLAST of slc24a-8 vs. TrEMBL
Match: A0A0H3YJ53 (Slc24a-6 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc24a-6 PE=2 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 3.798e-175
Identity = 277/507 (54.64%), Postives = 367/507 (72.39%), Query Frame = 1
Query:   91 KNHGAYFKILFFYFSLVIGMYFFTKFKSNSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLP-RLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDS---IHSRIR--LDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRTS 1593
            K H  + KI+  YFSL+ G  F  K        +   G  RKLL L NCT RS+EEFP+DFMTR ++KNGG++FHI +S YLF+A+AI+CD+YFVSSLER+CEV +++HDVAGATFMA G SAPELCT+VI VFIT SDVG+STI+GSA+FNVLC+ AICGIF G VI L WWP+FRDC+IYC++II L I+LND  + WYE LIML +Y  YI++LY N ++Y  V++ LP   +    E  PL  +N   +  L+D SE ++ +E  D++S    + RI    +ED     +  ++F +P+SF  RL+WV MLPV  +C+ TIPDCR+PGI++KLF +TF +S++WI++  Y+LVWMIC+ GD L IPDT+MGLT LAAG SIPDAI+ +LV K+G+GDMA+  SIGSN  D+L+ LGLPW ++T  ++PGS I + SS L +T++TLLSTV +LV  I +NKW+LNR LG IF  LY  ++  S L+ELN+ G F  PPCPRT 
Sbjct:    1 KKHKNFLKIILCYFSLIFGSIFLLKVNDIGGKDANFDGKSRKLLSLSNCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSSLERICEVLHMRHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIGSALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDEQVHWYEGLIMLIIYSLYILLLYKNDSVYQIVVKLLPISKRKLDPEKKPLFYENDSLAKILID-SENDDDLEKEDLNSNFQTNKRIHGCDNEDSIEGDKLESMFAIPDSFVSRLHWVTMLPVTVLCFLTIPDCRRPGIYKKLFFLTFLMSLVWITICIYLLVWMICITGDALGIPDTVMGLTLLAAGASIPDAISSFLVMKEGHGDMALCTSIGSNTLDVLVGLGLPWLLKTGMIHPGSTIQISSSGLTYTSLTLLSTVFILVICIFINKWRLNRLLGSIFFLLYSTVVIFSCLYELNVFGQFALPPCPRTK 506          
BLAST of slc24a-8 vs. TrEMBL
Match: A0A210QG44 (Sodium/potassium/calcium exchanger 5 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19355 PE=3 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 1.051e-135
Identity = 224/466 (48.07%), Postives = 323/466 (69.31%), Query Frame = 1
Query:  232 NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLPRLKG----YGEEHNPLISQNLPTSFGLLDSSE----EEEIMETGDVDSIHSRIRLDEDMT----NLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKP-GIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRT 1590
            +C  RS+EEFP +FM+ ++ ++GG + HI   +Y+F A+AI+CD+YFV+SLE +C+   +  DVAGATFMAAGSSAPELCTS+IGVFI +SDVG+ TIVGSAVFN+L II +C IF G V+ L WWPMFRDC+ Y  S+IAL+++++D  + WYE LI+  MY+ YI+++Y+N  ++ F  +     K     Y  ++N    Q L  +  +LDS +    +E+     D ++  +    +   T    +  ESP +  +P++   R +W+AMLP+  + Y T+PDCRKP G WRKL+ +TF +S++W+   +Y++VWM+ + GD L+IPDT+MGLT LAAGTS+PD +A   VA+DGYGDMAISNSIGSNVFD+L+CLG+PW IR++ ++ G  I + S  L ++ +TLLSTV  +   +++ KWKL R  G + L  Y+++IALS L+ELN+ G FN P CPRT
Sbjct:   84 SCIPRSVEEFPGNFMSLEDTQDGGFLIHILFVVYIFGAIAIVCDDYFVASLEIICDELQLSEDVAGATFMAAGSSAPELCTSLIGVFIAESDVGVGTIVGSAVFNILFIIGVCAIFAGMVVELTWWPMFRDCLFYLFSVIALVVVIHDNRVHWYEGLILFLMYLVYILVMYFNKTIHAFAERIRADFKSGNLTYDADNN---RQGLLEAQKVLDSEKSTGNDEKARNQTDAETTFTNSNTESSQTVAEEDKYESPWV--IPDTLVARSFWIAMLPMKVLFYVTVPDCRKPWGHWRKLYPLTFMMSIVWLVGLSYVMVWMVAIAGDALEIPDTVMGLTLLAAGTSVPDCLASLFVARDGYGDMAISNSIGSNVFDVLVCLGIPWLIRSAAIDDGEPIMITSDGLTYSALTLLSTVFFIGIAVILAKWKLGRTFGVVCLIAYVVVIALSCLYELNVFGTFNSPTCPRT 544          
BLAST of slc24a-8 vs. TrEMBL
Match: A0A1I8HC93 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 410.609 bits (1054), Expect = 2.287e-134
Identity = 235/458 (51.31%), Postives = 313/458 (68.34%), Query Frame = 1
Query:  223 GLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMET---GDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPR 1587
            G   CT RS+E FP D  T ++++ G II H+ V+++LF ALA++CD+YFVSSLE +C+V ++K DVAGATFMAAGSSAPEL TS+IGVF  KSDVGISTIVGSAVFN+L I+++CG+F    I+L+WWP+FRDC  YCLS++ALI+++ +G + WYE++I + MY  YI+I+YYN  +   +  R P L                    + D  E   I+ +   G   + +S++R  E      ESP    +P     R+YWV MLP   +  FTIPDCR+PG WRK F +TF  SV+WI+  +Y+LVWM+C +GDTL IPDT+MGLT LAAGTS+PDA+A   VA+DG+GDMA+SNSIGSNVFDIL+ LG+PWFI T    PGS + V S+ L ++TI LLSTVV L   + +NK +L+R LG   L +Y++ I  S L+E N+ G  N PPCPR
Sbjct:   92 GKNACTPRSVETFPPDLFTLEQKRQGAIIIHVLVAVWLFAALAVVCDDYFVSSLEVICDVLDLKSDVAGATFMAAGSSAPELFTSIIGVFFAKSDVGISTIVGSAVFNILFIVSLCGVFATQAIYLSWWPIFRDCGYYCLSVVALIVVIQNGFVDWYESVIFVVMYALYIVIMYYNEAIDRNISDRYPSLGTGASAAAAAGGARRLDESNMDD--ERVAIVPSSGEGGGTTTYSQLRGGEGNVEEFESP--LTMPQGLVKRIYWVVMLPWTCVFLFTIPDCRRPGRWRKFFFITFINSVLWIAGMSYLLVWMVCAVGDTLGIPDTVMGLTILAAGTSVPDAMASVFVARDGFGDMAVSNSIGSNVFDILVGLGVPWFIDTIIREPGSTVVVNSNGLTYSTIMLLSTVVFLFVAVYLNKMRLDRKLGAACLVVYIVFITFSILYETNVFGEMNPPPCPR 545          
BLAST of slc24a-8 vs. TrEMBL
Match: A0A1S3H8R1 (sodium/potassium/calcium exchanger 3 OS=Lingula unguis OX=7574 GN=LOC106153130 PE=3 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 2.861e-133
Identity = 231/467 (49.46%), Postives = 321/467 (68.74%), Query Frame = 1
Query:  229 KNCTTRSIEEFPNDFMTRKERKNGGIIF-HIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLPR-----------LKGY-GEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRT 1590
            +NCT RS+EEFP D  T ++++  G+IF H   ++Y+F ALAI+CD+YFV SLE +C    +  DVAGATFMAAGSSAPEL TS+IGVFI +SDVG+ TIVGSAVFN+L I+A+C +F G VI L WWP+FRDC  Y LS+I L +++ DG + WYEALIM  MY+ Y+  +Y+N  +  + I ++             LKG+ GEE  PL+ ++   S     S E E     G+  +  S    DED     ESP  + VP SF  R YWVAMLPV+A+ + T+PD R+ G+W++LFL++F +SV+WIS  +Y++VWM+ ++GDT +IPD +MGLT LAAGTS+PDA++   VA+DG+GDMAISNS+GSN+FDIL+CLGLPW I       G+ + + S +++FT+I+LL+TV+ L+  + VN WKLN+  G I L +Y++ +  S ++ELN+ G  N P CPR 
Sbjct:   76 QNCTKRSVEEFPPDLFTLEQKQRYGLIFLHCLGALYMFSALAIVCDDYFVPSLEHICTRLGLSPDVAGATFMAAGSSAPELATSIIGVFIAQSDVGLGTIVGSAVFNILIIVAMCSLFAGMVIPLTWWPLFRDCSYYALSVIVLTVVIQDGEVHWYEALIMFTMYILYVTFMYFNPRVSSWAIAKVHEFQHRRGHFPGNLKGHAGEESAPLLGEDAEKSSVSFKSGETETHF-GGENSATESED--DEDF----ESP--WTVPESFLKRFYWVAMLPVSALLFLTVPDSRRGGVWKRLFLLSFIMSVVWISGFSYVMVWMVAIMGDTWNIPDAVMGLTILAAGTSVPDAMSSLFVARDGFGDMAISNSVGSNIFDILLCLGLPWMIEC--FRVGAPVDINSKTIVFTSISLLATVIFLLVAVAVNGWKLNKKFGIICLFVYVVFMLFSCMYELNVFGEINFPSCPRN 531          
BLAST of slc24a-8 vs. Ensembl Cavefish
Match: slc24a5 (solute carrier family 24 member 5 [Source:ZFIN;Acc:ZDB-GENE-031210-1])

HSP 1 Score: 291.582 bits (745), Expect = 1.794e-93
Identity = 182/417 (43.65%), Postives = 258/417 (61.87%), Query Frame = 1
Query:  334 LFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQR-------LPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
            + +A++IICD+YF+ SLE + E   +  DVAGATFMAAGSSAPEL T+ +GVF+TK D+G+STIVGSAV+N+L I A CGI    V  L  WP+FRDC          +   N  L+Q Y+A  +L +Y  YI++L ++  +  ++++R       L +      E  PL+  N  +S  +   S  +  +   D    H  + L            + E+P +       V  LPV  + Y TIPDCR+   WRK +++TFF+S +WIS  TY+LVWM+ +IG+TL IPDT+MGLT LAAGTSIPD +A  +VA++G  DMA+SN +GSNVFD+L CLGLPWFI+T+F++    + V S+ ++F T TLL ++V L   + +N WKL+  LG + L  Y+L   LS L+EL I+GN
Sbjct:    1 MLLAVSIICDDYFLPSLEVISERLGLSQDVAGATFMAAGSSAPELVTAFLGVFVTKGDIGVSTIVGSAVYNLLGICAACGILTAVVGRLTCWPLFRDC----------VAYANQLLLQQYDAACLLLVYGVYIVVLCFDLRISEYMMRRFSPCCVCLSKSVNERSEQQPLMGWNNESSLRVPRRSRTDSGIFHDDSGYSHLSLSLHG----------LHEIPEADPG----VLSLPVIVLLYLTIPDCRRR-YWRKCYMLTFFMSAVWISAFTYVLVWMVTIIGETLAIPDTVMGLTLLAAGTSIPDTVASVMVAREGKADMAMSNIVGSNVFDML-CLGLPWFIKTAFVDTTGPVVVNSTGMVFITSTLLLSIVFLFLAVHINGWKLDWKLGIVCLLCYILFATLSILYELGIIGN 391          
BLAST of slc24a-8 vs. Ensembl Cavefish
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:103026719])

HSP 1 Score: 257.299 bits (656), Expect = 4.462e-78
Identity = 176/496 (35.48%), Postives = 268/496 (54.03%), Query Frame = 1
Query:  238 TTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFV---IQR-------------LPRLKGYGEE---HNPLISQNL---------PTSFGL----------------------------LDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNIL 1557
               S  ++P D  + ++R+ G ++ H+   +Y+F+ALAI+CDE+FV +L  + E   I  DVAGATFMAAG SAPEL TSVIGVFI+ S+VGI TIVGSAVFN+L +I +C +F   +++L WWP+FRD   Y L +I LI+   D  I ++E++ +L  Y  Y+I + YNG +  F+   I R              PRL+  G     HN L+  ++         P S G                             L +S   E+  T  ++    +     +     + P     P +   R  ++ +LP+    + T+PD RKP   +K F +TF  ++ WI+  +Y++VW    +G+T+ I + IMGLT LAAGTSIPD I   +VA+ G GDMA+S+S+GSN+FDI + L  PW +  S +N    I V S+ L    + L   ++ ++ +I   KWK+++ LGFI   LY++ + +S + E  I+
Sbjct:   85 ANESQGDYPEDLFSLEQRRRGAVVLHMIGMLYMFIALAIVCDEFFVPALTVITEKLAISDDVAGATFMAAGGSAPELFTSVIGVFISHSNVGIGTIVGSAVFNILFVIGMCAVFSKEILNLTWWPLFRDVSFYILGLIMLIVFFLDNYISYWESIALLTAYACYVIFMKYNGQVEMFIKGLINRNQVVEVVEAPPKAKPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLSEGKFREKASILHKIAKKKCQVEDANGVADKNLPNSSNVEVEVTPPLNGTAGQEGDTGEEDEEDDQPLSLSWPETCRKRFTYLFILPIVFPLWITLPDVRKP-TSKKFFPITFLGAICWIAAFSYLMVWWAHQVGETIGITEEIMGLTMLAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLLY-SLINGLKPIVVSSNGLFCAIVLLFLMLLFVIISIAACKWKMSKLLGFIMFLLYLVFLVVSVMLEDKII 578          
BLAST of slc24a-8 vs. Ensembl Cavefish
Match: slc24a4b (sodium/potassium/calcium exchanger 4 [Source:NCBI gene;Acc:103043044])

HSP 1 Score: 201.06 bits (510), Expect = 8.174e-57
Identity = 102/181 (56.35%), Postives = 133/181 (73.48%), Query Frame = 1
Query:  208 GRKLLG--------LKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVA 726
            GRKL+          KNCT  +I EFP+D+ T  ERK+G ++ HI  ++Y+F+ALAI+CD+YFV+SLE+LCE  ++  DVAGATFMAAGSSAPEL  SVIGVFIT  DVG+ TIVGSAVFN+LCII +CGIF G V+ L WW +FRD + Y  S++ALI  + D  I W+E+L+++ MY  
Sbjct:   63 GRKLMASAADNDTERKNCTEPAIREFPDDYFTNAERKSGAVLLHILAALYMFLALAIVCDDYFVTSLEKLCEKLDLSEDVAGATFMAAGSSAPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGIFAGQVVLLTWWAVFRDSLYYTFSVVALIAFIYDEKIVWWESLVLVVMYAG 243          

HSP 2 Score: 181.8 bits (460), Expect = 7.816e-50
Identity = 96/211 (45.50%), Postives = 140/211 (66.35%), Query Frame = 1
Query:  949 GESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            GE  + F +P    ++  W+   P+  + +FTIP+C KP  W K F+++F +S +WI++ +Y +VWM+ +IG TL IPD IMG+TFLAAGTS+PD IA  +VA+ G GDMA+SN+IGSNVFDIL+ LGLPW ++T  +N GSE+ + S  L+++ + LL +V + +  I VN WKL+  LG   L LY + +  S + E N+    N P C
Sbjct:  393 GELTSPFRLPRGCMNKTKWLISWPLLLLLFFTIPNCAKPR-WEKYFMLSFLLSTVWIAIFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGLPWALQTMAINYGSEVMINSRGLVYSVVLLLGSVALTILGIHVNHWKLDFKLGMYVLVLYAIFLCFSIMIEYNVFTFVNLPMC 602          
BLAST of slc24a-8 vs. Ensembl Cavefish
Match: slc24a3 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:103023188])

HSP 1 Score: 191.045 bits (484), Expect = 4.381e-53
Identity = 91/165 (55.15%), Postives = 124/165 (75.15%), Query Frame = 1
Query:  229 KNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYV 723
            KNCT   + EFP+D  T++ER  G +  H+F ++Y+F ALA++CD+YFV SLE++CE  ++  DVAGATFMAAGSSAPEL TSVIGVFITK DVG+ TIVGSAVFN+LCII +CGIF G  + L+ W + RD   Y +S+  LI+ + D  + W+E+L+++ MY+
Sbjct:   77 KNCTPPGVHEFPDDIFTKQERMEGAVALHVFCAMYMFYALALVCDDYFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGIFAGQAVRLSCWTLMRDSTYYTISVTTLIVFIYDEKVTWWESLVLILMYL 241          

HSP 2 Score: 169.859 bits (429), Expect = 1.981e-45
Identity = 93/205 (45.37%), Postives = 135/205 (65.85%), Query Frame = 1
Query:  967 FEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            F  P   C++  W+   P++ + +FT+P+C  P  W + F+ TF  S +WI+  +YI+VWM+ +IG TL IPD IMG+TFLAAGTS+PD +A  +VA+ G GDMA+SNSIGSNVFDIL+ LGLPW ++T  ++ GS I + S  LI +   LL++V + V  + +NKW L++ LG + L +Y + +  S L E N+    N P C
Sbjct:  430 FRCPGGVCNKFKWLLAWPLSLLLFFTVPNCNSPR-WERWFMFTFISSTLWIAGFSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNSIGSNVFDILVGLGLPWALQTLAIDYGSVIHLNSRGLIISVGLLLASVFLTVLGVHLNKWTLDKRLGILCLLMYAVFLCFSILIEFNVFIFVNLPTC 633          
BLAST of slc24a-8 vs. Ensembl Cavefish
Match: slc24a4b (sodium/potassium/calcium exchanger 4 [Source:NCBI gene;Acc:103043044])

HSP 1 Score: 184.111 bits (466), Expect = 2.762e-51
Identity = 82/126 (65.08%), Postives = 103/126 (81.75%), Query Frame = 1
Query:  247 SIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRD 624
            +I EFP+D+ T  ERK+G ++ HI  ++Y+F+ALAI+CD+YFV+SLE+LCE  ++  DVAGATFMAAGSSAPEL  SVIGVFIT  DVG+ TIVGSAVFN+LCII +CGIF G V+ L WW +FRD
Sbjct:   16 AIREFPDDYFTNAERKSGAVLLHILAALYMFLALAIVCDDYFVTSLEKLCEKLDLSEDVAGATFMAAGSSAPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGIFAGQVVLLTWWAVFRD 141          

HSP 2 Score: 174.096 bits (440), Expect = 1.099e-47
Identity = 92/197 (46.70%), Postives = 134/197 (68.02%), Query Frame = 1
Query:  991 HRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            ++  W+   P+  + +FTIP+C KP  W K F+++F +S +WI++ +Y +VWM+ +IG TL IPD IMG+TFLAAGTS+PD IA  +VA+ G GDMA+SN+IGSNVFDIL+ LGLPW ++T  +N GSE+ + S  L+++ + LL +V + +  I VN WKL+  LG   L LY + +  S + E N+    N P C
Sbjct:  321 NKTKWLISWPLLLLLFFTIPNCAKPR-WEKYFMLSFLLSTVWIAIFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGLPWALQTMAINYGSEVMINSRGLVYSVVLLLGSVALTILGIHVNHWKLDFKLGMYVLVLYAIFLCFSIMIEYNVFTFVNLPMC 516          
BLAST of slc24a-8 vs. Ensembl Sea Lamprey
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 182.185 bits (461), Expect = 4.323e-51
Identity = 91/166 (54.82%), Postives = 127/166 (76.51%), Query Frame = 1
Query:  235 CTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVI----GVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMY 720
            C   +I EFP D  T +ERK+GG++ H+F ++Y+F ALA++CD++FV SLE++ E   +  DVAGATFMAAGSSAPEL TSVI    GVF+TK DVG+ TIVGSAVFN+LCII +CG+F G ++ L WW +FRD + Y +SIIALI+ + D ++ W+E++I++ +Y
Sbjct:    1 CVVAAINEFPKDIFTNEERKHGGLLLHVFCTMYMFYALALVCDDFFVPSLEKISERLQLSEDVAGATFMAAGSSAPELFTSVIVWCEGVFVTKGDVGVGTIVGSAVFNILCIIGVCGLFAGQIVRLTWWSLFRDSVFYTISIIALILFICDEIVSWWESVILIMLY 166          

HSP 2 Score: 181.415 bits (459), Expect = 8.872e-51
Identity = 95/207 (45.89%), Postives = 139/207 (67.15%), Query Frame = 1
Query:  967 FEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPR 1587
              +P+  C++L W+   P+  + YFT+P+C K   W   F+ +F IS IWI+V +Y++VWM+ +IG TL IPD IMG+TFLAAGTS+PD +A  +VA+ G GDMA+SNSIGSNVFDIL+ LGLPW ++T  ++ GS + + S  LI++ + LL++V + V  I +N WKL+R LG   L +Y + +  S + E N+    N P C +
Sbjct:  341 LRIPDGVCNKLKWMFAWPLGLLLYFTVPNCAKAR-WENWFMASFVISTIWIAVFSYVMVWMVTVIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILVGLGLPWALQTLLVDYGSHVEINSRGLIYSVVLLLASVGITVLGIYLNNWKLDRKLGLACLFVYAVFLCFSIMIEFNVFTFVNLPMCRK 546          
BLAST of slc24a-8 vs. Ensembl Sea Lamprey
Match: slc24a1 (solute carrier family 24 member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-191])

HSP 1 Score: 163.696 bits (413), Expect = 2.262e-44
Identity = 95/203 (46.80%), Postives = 135/203 (66.50%), Query Frame = 1
Query:  256 EFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRL--------PRLKGYGEEHNPLISQNLP 840
            ++P D  T ++RK G ++ H+   IY+F+ALAI+CDE+FV +L  + E   I  DVAGATFMAAG SAPEL TS+IGVFI+ S+VGI TIVGSAVFN+L +I +C +F   ++ L WWP+FRD   Y + +  LII   D LIQW+E++++L  YV+Y++ + +N  +  FV QRL        P     G++++P    NLP
Sbjct:   18 DYPRDLFTLEQRKRGAVVLHMLGMIYMFIALAIVCDEFFVPALGVITEKLAISDDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSAVFNILFVIGMCAVFSREILVLTWWPLFRDVSFYIVGLSMLIIFFLDNLIQWWESMLLLSCYVSYVVFMKFNAKVESFVKQRLSMDPPAKIPGGIDEGDKNDP----NLP 216          

HSP 2 Score: 126.716 bits (317), Expect = 2.283e-31
Identity = 79/212 (37.26%), Postives = 123/212 (58.02%), Query Frame = 1
Query:  955 SPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRT 1590
             P     P S   ++ +V +LP+    + T+PD R     RK F+VTFF S++WI++ +Y++VW    +G+T+ I + IMGLT LAAGTSIPD I   +VA+ G GDMA+S+S+GSN+FDI + L +PW +  S +   + + V S+ L    + L   ++ ++ TI   +W +N+ LGF    LY + + +S + E   L       CP T
Sbjct:  350 KPLSMRWPESTKKQISYVFLLPLVLPLWITLPDVRNHRS-RKFFMVTFFGSILWIAIFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPMPWLM-FSLVKGFAPVQVSSNGLFCAIVLLFLMLLFVILTIAACRWHMNKLLGFCMFLLYFVFLIISVMLETRTLH------CPVT 553          
BLAST of slc24a-8 vs. Ensembl Sea Lamprey
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 58.9214 bits (141), Expect = 1.106e-9
Identity = 34/103 (33.01%), Postives = 54/103 (52.43%), Query Frame = 1
Query: 1027 AICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGL 1335
            A+  F     + P       ++ F +S +W++     +V ++   G    I  T++GLT LA G S+PD +A   +A+ GY  MAIS   G  VF+IL+ +GL
Sbjct:  184 AVVAFITTSEQPPAFQLAFAVLGFVVSALWMNAIANEVVNLLQTFGVVFGISSTVLGLTLLAWGNSVPDFVADITMARQGYPRMAISACFGGIVFNILVGIGL 286          
BLAST of slc24a-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000794.1 (pep scaffold:Pmarinus_7.0:GL477892:73629:76552:-1 gene:ENSPMAG00000000728.1 transcript:ENSPMAT00000000794.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.236e-7
Identity = 41/110 (37.27%), Postives = 54/110 (49.09%), Query Frame = 1
Query:  307 IFHIFVSIYLFVALAIICDEYFVS-----SLER--------------LCEVFNIKHDVAGATFMAAGSSAPELCTSVI---GVFITKSDVGISTIVGSAVFNVLCIIAIC 570
            I +    IY+F+ ++II D +  S     S E+                 V+N    V+  T MA GSSAPE+  S+I   G      D+G STIVGSA FN+  IIAIC
Sbjct:   82 IVYFVALIYMFLGVSIIADRFMASIEVITSQEKEITIKRPDGETTTTTVRVWN--ETVSNLTLMALGSSAPEILLSIIEICGHGFEAGDLGPSTIVGSAAFNMFVIIAIC 189          
BLAST of slc24a-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006683.1 (pep scaffold:Pmarinus_7.0:GL476710:281470:285756:-1 gene:ENSPMAG00000006040.1 transcript:ENSPMAT00000006683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 2.521e-7
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 1
Query: 1096 FFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVA-KDGYGDMAISNSIGSNVFDILICLGLPWFIRT 1353
            F +S+  I + T ++  +    G T+ + D++  + F+A GTSIPD  A  + A +D + D ++ N  GSN  ++ + +G+ W I +
Sbjct:  126 FLVSISVIGLLTAMIGDLASHFGCTVGLKDSVTAVVFVALGTSIPDTFASKVAAVQDQFADASVGNVTGSNAVNVFLGIGIAWTIAS 212          
BLAST of slc24a-8 vs. Ensembl Nematostella
Match: EDO32048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW69])

HSP 1 Score: 307.76 bits (787), Expect = 4.731e-99
Identity = 189/489 (38.65%), Postives = 290/489 (59.30%), Query Frame = 1
Query:  232 NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQ----RLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIME--TGDVDSIHSRI--RLDEDMTNLG--ESPTI-----------------------------FEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            NCT  +I EFP+DF T+++R+ G ++ +  +S+Y+F A+AI+CD+YFV  LE +C+   ++ DVAGATFMA GSSAPEL  SVIGVFITK D+G+ TI+GSAVFNVL +I +CG+  G+V++L WWPM RD + Y  S++ L+++L D ++ W EA  M+  Y  Y++I+Y+N  +  ++ +      P  K    E     ++  P      D+  E EI++   G  D+    +  R+ E   N    +SP I                             F  P +   R+ WV  LP+    + TIPD +KP    K  +++F I ++WI V +Y+LVWM+ +IG T  IPD++MGL+ +A G+S+PD ++   VA+ G GDMA+S+++GSNVFDIL+CLG+PW I+T+     S + + S  L  +   +L ++ V +  I   KW LN+ +G I+L  Y + +++S + E+N  GNFN P C
Sbjct:    1 NCTPPAILEFPDDFFTQRQRQRGAVVLNFIISLYMFWAVAIVCDDYFVPCLEIICDRLGLQTDVAGATFMALGSSAPELFASVIGVFITKGDIGVGTILGSAVFNVLFVIGVCGVGAGTVLYLAWWPMVRDSVFYLFSLVGLMLVLMDNVVVWSEATAMVSFYSVYLLIMYFNPRIEAYLYRVTKTTTPEYKSDLHEQKATKTKYDPVQ--QTDNEVEAEILDNVNGSDDTTKKGLLGRIYELYFNKEKVKSPLIVGFGEHLAHHHEYEQHVPHDVPDLTLGSPFSPPENVWPRICWVLGLPINLSFFLTIPDVKKPSC-EKWVVLSFIICIVWIGVTSYVLVWMVTVIGYTFLIPDSVMGLSLVAFGSSVPDCLSSLFVARKGDGDMAVSHTVGSNVFDILLCLGIPWLIKTTVWEYDSSVVINSHGLFISCFFILGSIAVTLIIIWYYKWTLNKKVGCIYLVFYFIFMSISVVVEMNAFGNFNPPMC 486          
BLAST of slc24a-8 vs. Ensembl Nematostella
Match: EDO48007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKL4])

HSP 1 Score: 296.975 bits (759), Expect = 1.313e-95
Identity = 179/438 (40.87%), Postives = 262/438 (59.82%), Query Frame = 1
Query:  235 CTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEE-EIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFE 1545
            C   +IEEFP D +T+ +R  GG++ H+  S++LF AL ++C+++FV+SL R+     +K DVAGATFMA GSSAP L  ++I +F T+ D+G+ TIVGS +FN L IIA+C I  G  + L  +P+ RD  +Y  S+I L++ + D  + WYE LI + +Y  YI+I+Y                  + ++   L               E E + ++    +     +   ED        T  + P   C R  WV  LP   + Y TIPDCRK   WRK +LVTF ++VIW++V +Y LVWM+ +IG T  IP+ +MG+TFLAAG+S+PDAIA  +VAK G GDMA+SN IGSNVFD+L CLG+PW I+++FL PG  + ++S ++ FT+  L+ ++ V    I  NKWKLN  +G  FL +Y L + +++  E
Sbjct:    1 CRPPNIEEFPPDVLTQDQRFYGGVMLHVIFSLHLFCALTVVCEDFFVASLNRISMCLGLKPDVAGATFMAVGSSAPTLFIAIISIFFTEGDIGLGTIVGSTIFNTLFIIALCAIGSGVTLQLACYPISRDSTVYVASVIVLMVSIYDNKVYWYEGLIFVIVYAIYIVIMY------------------FNDQVEGLCKTVKKKLKKKKVKPEGEGQGVDEDGGEESEDELNKSEDWGFHDTPRTRLKPPEGACARALWVFTLPSILVFYVTIPDCRKK-TWRKFYLVTFTVAVIWMAVLSYFLVWMVAIIGYTYTIPECVMGMTFLAAGSSLPDAIASLVVAKQGSGDMAVSNCIGSNVFDML-CLGIPWLIKSAFLQPGKPVVIQSENIFFTSAMLIGSIAVTFLLIQFNKWKLNVKVGIAFLIMYFLFLIVATYIE 418          
BLAST of slc24a-8 vs. Ensembl Nematostella
Match: EDO48300 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJP5])

HSP 1 Score: 184.111 bits (466), Expect = 4.741e-55
Identity = 107/207 (51.69%), Postives = 159/207 (76.81%), Query Frame = 1
Query:  961 TIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            +IF +P      + W+ MLP++ + + TIPDCR+P  WRK + +TF ISV+WI+  +YILVWM+ +IG TL+IPD +MGLTF+AAG+S+PD I+  +VA+ G GDMA+SN+IGSNVFDIL+CLGLPW ++T+ +  G  + V S S+I+T+I+L  TVVV +  +++N+W+LNR LG +F+ LY+  I++++LFELN++G+FN P C
Sbjct:    4 SIFVMPEGTLKAIIWIIMLPISCLFFITIPDCRRPR-WRKWYFLTFLISVLWIAGLSYILVWMVEIIGYTLEIPDVVMGLTFVAAGSSVPDGISSLIVARHGDGDMAVSNTIGSNVFDILLCLGLPWLLKTTAVEHGGVVTVLSGSIIYTSISLFGTVVVTILLVVLNRWRLNRLLGCVFMILYIAFISVATLFELNVIGDFNLPIC 209          
BLAST of slc24a-8 vs. Ensembl Nematostella
Match: EDO48302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJP9])

HSP 1 Score: 172.94 bits (437), Expect = 6.723e-51
Identity = 83/116 (71.55%), Postives = 97/116 (83.62%), Query Frame = 1
Query:  229 KNCTTRSIEEFPNDFMTRKER-KNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICG 573
            KNC   SI +FP+DFMT+ +R K GGI+FH+FV+IY F ALA +CDEYFVSSLER+C+  N+K DVAGATFMAAGSSAPE  TSVIGVFITK D+GI TIVGSAVFN+L I+AIC 
Sbjct:   65 KNCVNPSISDFPSDFMTQYQRQKQGGIVFHVFVAIYTFAALATVCDEYFVSSLERICDGLNLKSDVAGATFMAAGSSAPEFFTSVIGVFITKGDIGIGTIVGSAVFNILFIVAICA 180          
BLAST of slc24a-8 vs. Ensembl Nematostella
Match: EDO48006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKL3])

HSP 1 Score: 167.933 bits (424), Expect = 4.360e-45
Identity = 98/274 (35.77%), Postives = 154/274 (56.20%), Query Frame = 1
Query:  775 QRLPRLKG--YGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGES--------------PTI-FEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFE 1545
             +L  L G  + +++   I +        L+   E +    G +D  + RI   ED T  G S              P+  F  P++F  R+ W+ MLPV    Y T+PDCR    W   +  TF +S+IW++  +Y+LVW + +IG+T  IP+ IMGLT LAAG+S+PD ++  +VAK G GDMA++N IGSN+FD+L CLGLPW + T+ ++P S + + S  +++ ++ L  TV+ +V+ I +N W+L+R LG I    Y   +  + + E
Sbjct:  330 NKLTELDGATHNKQNEDKIDEKNENEHNKLNEHCEGDSHNEGKMDKENERIEQKEDATKSGASGSHQNTPSHIHGFKPSCPFTPPSTFSKRIVWIFMLPVHLAFYVTMPDCRVKK-WEAWYPATFALSIIWMAALSYVLVWTVSIIGETFSIPEYIMGLTLLAAGSSVPDVMSSLIVAKHGMGDMALANCIGSNIFDVL-CLGLPWLLATTAVHPNSVVLIHSGHIVYVSMCLFGTVLTIVSAIHLNGWRLDRRLGVILFIAYAFFLTSAVILE 601          

HSP 2 Score: 141.739 bits (356), Expect = 4.795e-36
Identity = 75/150 (50.00%), Postives = 110/150 (73.33%), Query Frame = 1
Query:  277 TRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVA 726
            T +ER++G +I H F+ +Y FVALAI+CD YF +SLE+LC+   I  DVAGATFMAAGSS P L  ++  VF+ + D+G+ TI+GS++FN+L I AICG+F G VI L+ WP+ RD  +Y ++++ L+I+++D +I +YEALI   +Y  
Sbjct:   41 TLQERRHGAVIIHTFICLYCFVALAILCDNYFCASLEKLCKRLRIPTDVAGATFMAAGSSMPTLFIAIASVFMGEGDIGLGTIIGSSMFNILFITAICGLFSGMVISLHTWPIVRDSCVYVVNLVGLLIVIHDNVIHFYEALIFPVLYTG 190          
BLAST of slc24a-8 vs. Ensembl Medaka
Match: slc24a5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:101173921])

HSP 1 Score: 348.591 bits (893), Expect = 4.406e-114
Identity = 208/500 (41.60%), Postives = 305/500 (61.00%), Query Frame = 1
Query:   88 KKNHGAYFKILFFYFSLVIGMYFFTKFKSNSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLPRL-----KGYGE--EHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDE-DMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
            KK    +      +   + G +    F + +   +      R L     C +    EFP+ F T +ERK+GG++ +  +  Y+ +A+AI+CD+YF+ SLE + E   +  DVAGATFMAAGSSAPEL T+ +GVF+TK D+G+STIVGSAV+N+L I A CGI       L  WP+FRDC+ Y +S+ A+I I++D  + WYEA  +L +Y  YI++L ++  +  FV+++L         G  +  E  PL   N  T   +   S  +  +   D    H  + L   +  +  E  ++F VP S   R+ WV  LPV  + + T+PDCR+   W++ F++TFF+S +WIS  TY+LVWM+ ++G+TL IPDT+MGLT LAAGTSIPD +A  +VA++G  DMA+SN +GSNVFD+L CLGLPWFI+T F++  + + V SS L+F + TLL ++V L   + +N WKL+  LG + L  Y+L   LS L+EL I+GN
Sbjct:    9 KKTRKDFIPYFLGFVIFLYGTFHLISFTAKTAEFAPTVRVRRALENETECISPQASEFPDGFFTVQERKDGGLVIYFMIIFYMLLAVAIVCDDYFLPSLEVISERLGLSQDVAGATFMAAGSSAPELVTAFLGVFVTKGDIGVSTIVGSAVYNLLGICAACGILASVARRLTCWPLFRDCLAYGISVAAVIGIISDNKVYWYEAACLLLVYGVYIVVLCFDLRISEFVLRKLSPCCTCLSSGSADKMETQPLTGWNDDTRLRICGRSRTDSGIFHDDSGYSHLSLSLHGLNEISDAEQKSVFSVPESDLKRILWVLSLPVIVLLFLTVPDCRRR-FWKQWFMITFFMSAVWISAFTYVLVWMVTVVGETLGIPDTVMGLTLLAAGTSIPDTVASVMVAREGKADMAMSNIVGSNVFDML-CLGLPWFIKTVFVDTINPVEVNSSGLVFVSCTLLLSIVFLFVAVHINGWKLDWKLGLVSLICYILFATLSILYELGIIGN 506          
BLAST of slc24a-8 vs. Ensembl Medaka
Match: slc24a5 (solute carrier family 24 member 5 [Source:NCBI gene;Acc:101173921])

HSP 1 Score: 343.584 bits (880), Expect = 9.462e-113
Identity = 202/452 (44.69%), Postives = 292/452 (64.60%), Query Frame = 1
Query:  232 NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLPRL-----KGYGE--EHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDE-DMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGN 1563
             C +    EFP+ F T +ERK+GG++ +  +  Y+ +A+AI+CD+YF+ SLE + E   +  DVAGATFMAAGSSAPEL T+ +GVF+TK D+G+STIVGSAV+N+L I A CGI       L  WP+FRDC+ Y +S+ A+I I++D  + WYEA  +L +Y  YI++L ++  +  FV+++L         G  +  E  PL   N  T   +   S  +  +   D    H  + L   +  +  E  ++F VP S   R+ WV  LPV  + + T+PDCR+   W++ F++TFF+S +WIS  TY+LVWM+ ++G+TL IPDT+MGLT LAAGTSIPD +A  +VA++G  DMA+SN +GSNVFD+L CLGLPWFI+T F++  + + V SS L+F + TLL ++V L   + +N WKL+  LG + L  Y+L   LS L+EL I+GN
Sbjct:   14 ECISPQASEFPDGFFTVQERKDGGLVIYFMIIFYMLLAVAIVCDDYFLPSLEVISERLGLSQDVAGATFMAAGSSAPELVTAFLGVFVTKGDIGVSTIVGSAVYNLLGICAACGILASVARRLTCWPLFRDCLAYGISVAAVIGIISDNKVYWYEAACLLLVYGVYIVVLCFDLRISEFVLRKLSPCCTCLSSGSADKMETQPLTGWNDDTRLRICGRSRTDSGIFHDDSGYSHLSLSLHGLNEISDAEQKSVFSVPESDLKRILWVLSLPVIVLLFLTVPDCRRR-FWKQWFMITFFMSAVWISAFTYVLVWMVTVVGETLGIPDTVMGLTLLAAGTSIPDTVASVMVAREGKADMAMSNIVGSNVFDML-CLGLPWFIKTVFVDTINPVEVNSSGLVFVSCTLLLSIVFLFVAVHINGWKLDWKLGLVSLICYILFATLSILYELGIIGN 463          
BLAST of slc24a-8 vs. Ensembl Medaka
Match: slc24a4b (solute carrier family 24 member 4 [Source:NCBI gene;Acc:101164447])

HSP 1 Score: 196.052 bits (497), Expect = 5.112e-55
Identity = 119/274 (43.43%), Postives = 166/274 (60.58%), Query Frame = 1
Query:  193 ELHGTGRKLLGL-------KNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSR---IRLDEDMTNLGESPTIFEVPNS 984
            +L   GR+LL L       KNC+   I EFP D  +  ERK+G ++ HI  ++Y+F+ALAI CDEYFV+SLE++CE  ++  DVAGATFMAAGSSAPEL  SVIGVFIT  DVG+ TIVGSAVFN+LCII +CGIF G V+ L  W +FRD   Y LS++ALI  + D  I W+E+LI++ MY  YI+++ +N ++  F   +  +    G        ++  T + + D      ++        +SR   + +DE M     SP+ F  P +
Sbjct:   64 DLDHLGRRLLALSENETEPKNCSEPGIHEFPEDLFSNAERKSGAVLLHIVATLYMFLALAITCDEYFVTSLEKICEKLDLSEDVAGATFMAAGSSAPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGIFAGQVVMLTRWAVFRDSFYYILSVVALIAFIYDEKIDWWESLILVVMYAGYILVMKFNSSMQRFFTGKSNKNVANGNAAASSEMEDGNTCYYIWDDDPSSPLLLAVKPSKAYSRGSVVMVDEIMN---ASPSKFRFPEA 334          

HSP 2 Score: 171.785 bits (434), Expect = 3.055e-46
Identity = 102/250 (40.80%), Postives = 159/250 (63.60%), Query Frame = 1
Query:  865 SEEEEIMETG---DVDSIHSRIRLD-----EDM-TNLGESPTI--FEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            +E +++++T    +   I  ++ ++     ED  T   E+ TI  F VP+    ++ W+   P+  + +FTIP+C KP  W + F+++F +S +WI++ +Y++VWM+ + G TL IPD IMG+TFLAAGTS+PD IA  +VA+ G GDMA+SN+IGSNVFDIL+ LG+PW I+T  ++ GSE+ + S  L+++ + LL +V + V  I  NKW+L+  LG   L LY + +  S L E N+    N P C
Sbjct:  359 TERQKLVQTANGVETQVIDGKVEIENGNVPEDKPTEAEENDTISPFHVPSGIGSKVKWLLSWPLLLLLFFTIPNCAKPR-WERFFMLSFILSTVWIAIFSYVMVWMVTVAGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWAIQTICVSYGSEVAINSRGLVYSVVLLLGSVALTVLGIHFNKWRLDFKLGVYVLVLYAVFLCFSILIEYNVFTFVNLPMC 607          
BLAST of slc24a-8 vs. Ensembl Medaka
Match: ENSORLT00000003048.2 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:101170984])

HSP 1 Score: 187.963 bits (476), Expect = 1.073e-51
Identity = 93/166 (56.02%), Postives = 120/166 (72.29%), Query Frame = 1
Query:  223 GLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMY 720
            G KNCTT ++ EFP D  T +ER  G +  H+  + Y+F ALA++CD+YFV SLE++CE  ++  DVAGATFMAAGSSAPEL TSVIGVFITK DVG+ TIVGSAVFN+LCII +CG F G  + L+ W + RD   Y  SI ALI  + D  + W+E+L+++ MY
Sbjct:  102 GSKNCTTPALHEFPTDLFTNEERTEGAVALHVLCTFYMFCALALVCDDYFVPSLEKICERLDLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGFFAGQAVKLSHWALLRDSTYYTFSITALIAFIYDENVCWWESLVLVLMY 267          

HSP 2 Score: 179.489 bits (454), Expect = 1.034e-48
Identity = 97/205 (47.32%), Postives = 141/205 (68.78%), Query Frame = 1
Query:  967 FEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            F+VP   C++L W+ M P++ + +FT+P+C K   W + F+V+FF + IWI+  +YI+VWM+ +IG TL +PD IMG+TFLAAGTS+PD +A  +VA+ G GDMAISNSIGSNVFDIL+ LGLPW ++T  ++ GS I + S  L+F+   LL++V   V  + +NKW L+  LG + L +Y + + +S L E N+    N P C
Sbjct:  458 FKVPAGVCNKLKWLFMWPLSLLLFFTVPNCGKRR-WERWFMVSFFTATIWIAGLSYIMVWMVTVIGFTLGLPDVIMGITFLAAGTSVPDCMASVIVARQGMGDMAISNSIGSNVFDILVGLGLPWALQTLCIDYGSVIHLNSRGLVFSVGLLLASVFFTVLGVHLNKWTLDWRLGLVCLVMYAVFLCISILIEFNVFIFVNLPMC 661          
BLAST of slc24a-8 vs. Ensembl Medaka
Match: ENSORLT00000009286.2 (sodium/potassium/calcium exchanger 3 [Source:NCBI gene;Acc:101155536])

HSP 1 Score: 182.57 bits (462), Expect = 4.321e-50
Identity = 91/158 (57.59%), Postives = 121/158 (76.58%), Query Frame = 1
Query:  247 SIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMY 720
            +I EFP D  TR++RKNG ++ H   +IY+F ALAI+CD+YFV SLE++ E   +  DVAGATFMAAGSSAPEL TS+IGVFITK DVG+ TIVGSAVFN+L II +CGIF G  + L WW +FRD   Y L+++ALI+++ D  + W+E+L+++ MY
Sbjct:   72 AIHEFPQDIFTREQRKNGAVLLHALCAIYMFYALAIVCDDYFVPSLEKISENLQLSEDVAGATFMAAGSSAPELFTSLIGVFITKGDVGVGTIVGSAVFNILVIIGLCGIFAGQTVVLTWWSLFRDATYYILAVLALILVIYDDTVLWWESLLLITMY 229          

HSP 2 Score: 152.14 bits (383), Expect = 2.954e-39
Identity = 89/191 (46.60%), Postives = 131/191 (68.59%), Query Frame = 1
Query:  970 EVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLF 1542
             +P S   R+ WV   P++ + Y T+P+C  P  W + F+VTF  S +WI+V +Y +VWM+ +I  TLDIPD IMG+TFLAAGTS+PD +A  +VA+ G GDMA+SNSIGSN+FDIL+ LG PW +RT  ++ GS + + +  L+++ I LL++V + V ++ +N W+L+R LG   L LY + +  S LF
Sbjct:  412 RIPGSCGARVKWVITWPLSLLLYCTVPNCVLPR-WHRWFMVTFVASTMWIAVFSYQMVWMVTIISYTLDIPDYIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNIFDILLGLGFPWALRTLVVDHGSTVSINNKGLVYSVILLLASVFLTVISVHLNHWRLDRRLGLGLLFLYAIFLLCSILF 601          
BLAST of slc24a-8 vs. Planmine SMEST
Match: SMESG000030115.1 (SMESG000030115.1)

HSP 1 Score: 858.21 bits (2216), Expect = 0.000e+0
Identity = 480/484 (99.17%), Postives = 482/484 (99.59%), Query Frame = 1
Query:  148 MYFFTKFKSNSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNL-GESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRTSS 1596
            MYFFTKFKSNSDTMSELHGT RKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVS+YLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCIIYCLSIIALIIILNDGLIQWYEAL+MLFMYVAYIIILYYNGNLYGFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNL GESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVESSSLIFTTITLLSTVVVLVATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRTSS
Sbjct:    1 MYFFTKFKSNSDTMSELHGTSRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSMYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCIIYCLSIIALIIILNDGLIQWYEALVMLFMYVAYIIILYYNGNLYGFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLEGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVESSSLIFTTITLLSTVVVLVATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPCPRTSS 484          
BLAST of slc24a-8 vs. Planmine SMEST
Match: SMESG000030115.1 (SMESG000030115.1)

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 456/460 (99.13%), Postives = 458/460 (99.57%), Query Frame = 1
Query:   82 MLKKNHGAYFKILFFYFSLVIGMYFFTKFKSNSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNL-GESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIM 1458
            MLKKNHGAYFKILFFYFSLVIGMYFFTKFKSNSDTMSELHGT RKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVS+YLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCIIYCLSIIALIIILNDGLIQWYEAL+MLFMYVAYIIILYYNGNLYGFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNL GESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVESSSLIFTTITLLSTVVVLVATIM
Sbjct:    1 MLKKNHGAYFKILFFYFSLVIGMYFFTKFKSNSDTMSELHGTSRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSMYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCIIYCLSIIALIIILNDGLIQWYEALVMLFMYVAYIIILYYNGNLYGFVIQRLPRLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLEGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVESSSLIFTTITLLSTVVVLVATIM 460          
BLAST of slc24a-8 vs. Planmine SMEST
Match: SMESG000030111.1 (SMESG000030111.1)

HSP 1 Score: 366.696 bits (940), Expect = 4.780e-123
Identity = 194/364 (53.30%), Postives = 263/364 (72.25%), Query Frame = 1
Query:   91 KNHGAYFKILFFYFSLVIGMYFFTKFKSNSDTMSELHGTGRKLLGLKNCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMYVAXXXXXXXXXXXXXFVIQRLP-RLKGYGEEHNPLISQNLPTSFGLLDSSEEEEIMETGDVDS---IHSRIR--LDEDMTNLGESPTIFEVPNSFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIG 1164
            K H ++ KI+  YFSL+ G  FF K        +   G  RKLL L NCT RS+EEFP+DFMTR ++KNGG++FHI +S YLF+A+AI+CD+YFVSSLE +CEV +++HDVAGATFMA G SAPELCT+VI VFIT SDVG+STI+GSA+FNVLC+ AICGIF G VI L WWP+FRDC+IYC++II L I+LND L+ WYE LIML +Y  YI++LY N ++Y  V++ LP   +    E  PL  +N   +  L+DS  +++ +E  D++S    + RI    +ED     +  ++F +P+SF  RL+WV MLPV  +C+ TIPDCR+PGI++KLF +TF +S++WI++  Y+LVWMIC+ G
Sbjct:    4 KKHKSFLKIILCYFSLIFGSIFFLKVNDIGGKDANFDGKSRKLLSLSNCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSSLESICEVLHLRHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIGSALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDELVHWYEGLIMLIIYSLYILLLYKNDSVYQIVVKLLPISKRKLDPEKKPLFYENDSLAKSLIDSENDDD-LEKEDLNSNFQTNKRIHGCDNEDSIEGDKLESMFAIPDSFVSRLHWVTMLPVTVLCFLTIPDCRRPGIYKKLFFLTFLMSLVWITICIYLLVWMICITG 366          
BLAST of slc24a-8 vs. Planmine SMEST
Match: SMESG000010390.1 (SMESG000010390.1)

HSP 1 Score: 309.686 bits (792), Expect = 3.935e-99
Identity = 195/508 (38.39%), Postives = 294/508 (57.87%), Query Frame = 1
Query:  154 FFTKFKSNSDTMS-ELHGTGRKLLGLK-NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMY----VAXXXXXXXXXXXXXFVIQRLPRLKGYGEE--------HNPLISQNLPTSFGLL---DSSEEEEIMETGDVDSIHSR----IRLDEDMTN-------LGESPTIFEVPNSFCHR----LYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            F+  +K + + ++ +     R+LL  K NC+ ++I+ FP D  +++ R++G +I H  ++IY+F+ LAI+C++YFV  LE +CE   ++ DVAGATFMAAGSSAPEL T++IGVFI K D+ +  +VGSA +N++ +I +  +F  +VI LNWWP+FRDC  Y +SII L +++ D L+ WYEA++ +F Y    V               V + LP      E          N +      TS G+      +E +E  E+G +    +R       D D          L       E+P+    R     Y+    P+      +IPDCR+   +RK F +TF  S IWI + +YI++WMI +IG TL IPD++MGLTF+AAG+S+PDAIA  LV ++G GDMA+SN++GSNVFDILIC+G+PW I+   L  G  I + S  L++ TITL  TV  LV    +  WK+ +  G+I + +Y+  + +  ++ELN+ G  + P C
Sbjct:    8 FYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKEARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAIVFIFFYGIYIVLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAEDLHTTSTGIEMINSGTESDEDYESGKLIGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCRER-FFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 512          
BLAST of slc24a-8 vs. Planmine SMEST
Match: SMESG000010390.1 (SMESG000010390.1)

HSP 1 Score: 308.145 bits (788), Expect = 1.014e-98
Identity = 193/500 (38.60%), Postives = 293/500 (58.60%), Query Frame = 1
Query:  154 FFTKFKSNSDTMS-ELHGTGRKLLGLK-NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSSLERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVGSAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCXXXXXXXXXXXXXXXXXXXQWYEALIMLFMY----VAXXXXXXXXXXXXXFVIQRLPRLKGYGE---EHNPLISQNLPTSFGLLDSSEEEEIMETGDVDSIHSR----IRLDEDMTN-------LGESPTIFEVPNSFCHR----LYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVATYILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMAISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVEXXXXXXXXXXXXXXXXXXXATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC 1581
            F+  +K + + ++ +     R+LL  K NC+ ++I+ FP D  +++ R++G +I H  ++IY+F+ LAI+C++YFV  LE +CE   ++ DVAGATFMAAGSSAPEL T++IGVFI K D+ +  +VGSA +N++ +I +  +F  +VI LNWWP+FRDC  Y +SII L +++ D L+ WYEA++ +F Y    V               V + LP      E   +   L+S  +     L  +S   E++ +G      +R       D D          L       E+P+    R     Y+    P+      +IPDCR+   +RK F +TF  S IWI + +YI++WMI +IG TL IPD++MGLTF+AAG+S+PDAIA  LV ++G GDMA+SN++GSNVFDILIC+G+PW I+   L  G  I + S  L++ TITL  TV  LV    +  WK+ +  G+I + +Y+  + +  ++ELN+ G  + P C
Sbjct:    8 FYANYKHDINPINNDKSYISRQLLSYKANCSPKAIDNFPEDLFSKEARQSGALIIHFLITIYMFIGLAIVCEDYFVPCLECICENLKLQPDVAGATFMAAGSSAPELATTIIGVFIAKDDIALGAVVGSADYNLMFVIGLSALFAKTVIQLNWWPLFRDCAFYSISIILLALVIYDNLVYWYEAIVFIFFYGIYIVLNYFNKSLELWAKMLVTKYLPNCTINNENLSDEAFLMSNEVAED--LHTTSTGIEMINSGTESGTRNRNGSCCSSDIDFAKKTGCAMCLRSCFATLELPDKKKARWWNYFYYGLCYPLRFFLCVSIPDCRER-FFRKWFWITFINSCIWIGMYSYIMIWMITVIGFTLGIPDSVMGLTFIAAGSSVPDAIASVLVVREGQGDMAVSNAVGSNVFDILICMGVPWLIKC--LTLGKPILIYSKGLLYATITLFMTVFGLVFITHLYSWKMTKSFGYILIIIYVAFLVVCCMYELNVFGLVHPPEC 502          
The following BLAST results are available for this feature:
BLAST of slc24a-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC24A56.926e-11643.70solute carrier family 24 member 5 [Source:HGNC Sym... [more]
SLC24A52.657e-9343.32solute carrier family 24 member 5 [Source:HGNC Sym... [more]
SLC24A31.048e-5257.58solute carrier family 24 member 3 [Source:HGNC Sym... [more]
SLC24A31.048e-5257.58solute carrier family 24 member 3 [Source:HGNC Sym... [more]
SLC24A42.172e-5252.46solute carrier family 24 member 4 [Source:HGNC Sym... [more]
back to top
BLAST of slc24a-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncx-53.279e-4548.48Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
ncx-49.530e-4151.92Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q1Z... [more]
ncx-41.470e-1939.86Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q1Z... [more]
ncx-69.755e-1033.91Putative sodium/calcium exchanger 6 [Source:UniPr... [more]
ncx-73.365e-832.99Putative sodium/calcium exchanger 7 [Source:UniPr... [more]
back to top
BLAST of slc24a-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zyd6.980e-9837.30gene:FBgn0265767 transcript:FBtr0340198[more]
CG120616.240e-7635.03gene:FBgn0040031 transcript:FBtr0332625[more]
CG120611.282e-5733.68gene:FBgn0040031 transcript:FBtr0333740[more]
CG10901.583e-5451.53gene:FBgn0037238 transcript:FBtr0335201[more]
CG10901.583e-5451.53gene:FBgn0037238 transcript:FBtr0335203[more]
back to top
BLAST of slc24a-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc24a57.256e-11743.36solute carrier family 24 member 5 [Source:ZFIN;Acc... [more]
CABZ01081780.15.689e-8136.42sodium/potassium/calcium exchanger 2-like [Source:... [more]
CABZ01081780.17.381e-8136.42sodium/potassium/calcium exchanger 2-like [Source:... [more]
slc24a4b1.363e-5560.37solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
slc24a4a1.529e-5350.00solute carrier family 24 member 4a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc24a-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC24A56.722e-11444.00solute carrier family 24 member 5 [Source:NCBI gen... [more]
SLC24A58.236e-11441.80solute carrier family 24 member 5 [Source:NCBI gen... [more]
SLC24A59.852e-11444.00solute carrier family 24 member 5 [Source:NCBI gen... [more]
SLC24A51.450e-11344.00solute carrier family 24 member 5 [Source:NCBI gen... [more]
SLC24A52.393e-11344.00solute carrier family 24 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc24a-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc24a53.963e-10844.01solute carrier family 24, member 5 [Source:MGI Sym... [more]
Slc24a41.142e-5253.01solute carrier family 24 (sodium/potassium/calcium... [more]
Slc24a41.790e-5253.01solute carrier family 24 (sodium/potassium/calcium... [more]
Slc24a42.139e-5253.01solute carrier family 24 (sodium/potassium/calcium... [more]
Slc24a42.422e-5253.01solute carrier family 24 (sodium/potassium/calcium... [more]
back to top
BLAST of slc24a-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q49SH1|NCKX5_DANRE4.865e-11643.36Sodium/potassium/calcium exchanger 5 OS=Danio reri... [more]
sp|Q71RS6|NCKX5_HUMAN3.326e-11543.70Sodium/potassium/calcium exchanger 5 OS=Homo sapie... [more]
sp|Q8C261|NCKX5_MOUSE2.772e-10744.01Sodium/potassium/calcium exchanger 5 OS=Mus muscul... [more]
sp|Q9VN12|NCKXH_DROME1.587e-5351.53Probable sodium/potassium/calcium exchanger CG1090... [more]
sp|Q9HC58|NCKX3_HUMAN5.035e-5257.58Sodium/potassium/calcium exchanger 3 OS=Homo sapie... [more]
back to top
BLAST of slc24a-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKA30.000e+0100.00Slc24a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJ533.798e-17554.64Slc24a-6 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A210QG441.051e-13548.07Sodium/potassium/calcium exchanger 5 OS=Mizuhopect... [more]
A0A1I8HC932.287e-13451.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3H8R12.861e-13349.46sodium/potassium/calcium exchanger 3 OS=Lingula un... [more]
back to top
BLAST of slc24a-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc24a51.794e-9343.65solute carrier family 24 member 5 [Source:ZFIN;Acc... [more]
SLC24A24.462e-7835.48solute carrier family 24 member 2 [Source:NCBI gen... [more]
slc24a4b8.174e-5756.35sodium/potassium/calcium exchanger 4 [Source:NCBI ... [more]
slc24a34.381e-5355.15solute carrier family 24 member 3 [Source:NCBI gen... [more]
slc24a4b2.762e-5165.08sodium/potassium/calcium exchanger 4 [Source:NCBI ... [more]
back to top
BLAST of slc24a-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc24a4b4.323e-5154.82solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
slc24a12.262e-4446.80solute carrier family 24 member 1 [Source:ZFIN;Acc... [more]
SLC8B11.106e-933.01solute carrier family 8 member B1 [Source:HGNC Sym... [more]
ENSPMAT00000000794.11.236e-737.27pep scaffold:Pmarinus_7.0:GL477892:73629:76552:-1 ... [more]
ENSPMAT00000006683.12.521e-729.89pep scaffold:Pmarinus_7.0:GL476710:281470:285756:-... [more]
back to top
BLAST of slc24a-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc24a-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320484.731e-9938.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480071.313e-9540.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483004.741e-5551.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483026.723e-5171.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480064.360e-4535.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc24a-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc24a54.406e-11441.60solute carrier family 24 member 5 [Source:NCBI gen... [more]
slc24a59.462e-11344.69solute carrier family 24 member 5 [Source:NCBI gen... [more]
slc24a4b5.112e-5543.43solute carrier family 24 member 4 [Source:NCBI gen... [more]
ENSORLT00000003048.21.073e-5156.02solute carrier family 24 member 3 [Source:NCBI gen... [more]
ENSORLT00000009286.24.321e-5057.59sodium/potassium/calcium exchanger 3 [Source:NCBI ... [more]
back to top
BLAST of slc24a-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030115.10.000e+099.17SMESG000030115.1[more]
SMESG000030115.10.000e+099.13SMESG000030115.1[more]
SMESG000030111.14.780e-12353.30SMESG000030111.1[more]
SMESG000010390.13.935e-9938.39SMESG000010390.1[more]
SMESG000010390.11.014e-9838.60SMESG000010390.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30001319
GenBankAKN21568.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001319 ID=SMED30001319|Name=slc24a-8|organism=Schmidtea mediterranea sexual|type=transcript|length=1611bp
ATTTATCTGAGATATTTGGCCACTTATTTAGTACTCAAAAATGAGGGTAT
TGCAACATGAAATTTTGAGAAAATGTCATAGATGTTGAAAAAGAATCATG
GAGCTTATTTTAAGATATTATTCTTTTACTTTTCACTTGTGATTGGAATG
TATTTCTTCACAAAATTCAAATCGAATTCAGACACAATGAGTGAATTACA
TGGGACGGGTCGTAAATTACTTGGATTGAAAAATTGTACTACAAGGTCCA
TTGAAGAGTTTCCAAATGATTTCATGACCAGGAAAGAAAGAAAAAATGGA
GGAATTATATTCCACATTTTCGTTTCTATATATTTATTTGTTGCTTTAGC
AATAATTTGTGACGAATATTTCGTATCTTCTCTAGAAAGACTTTGTGAAG
TGTTCAATATAAAACACGATGTTGCGGGCGCCACATTTATGGCGGCGGGA
AGCTCAGCCCCTGAACTATGTACATCTGTGATAGGTGTATTCATTACAAA
AAGTGATGTTGGAATCAGTACAATTGTTGGATCGGCAGTATTTAATGTAC
TCTGTATTATTGCTATATGCGGGATTTTTGTTGGTTCAGTAATTCATTTG
AATTGGTGGCCAATGTTCCGGGACTGTATCATTTATTGCCTTTCAATCAT
TGCCCTCATCATTATTCTAAACGACGGTCTCATTCAGTGGTACGAAGCTC
TAATAATGCTCTTCATGTATGTTGCATACATTATTATACTATATTACAAT
GGAAATCTTTATGGATTTGTAATTCAACGGTTACCGCGATTAAAAGGTTA
CGGCGAAGAGCACAACCCACTTATCTCTCAAAACTTACCAACTTCATTCG
GTCTCTTAGATAGTAGTGAAGAAGAAGAAATAATGGAAACTGGTGATGTG
GACTCCATACATTCTCGAATAAGACTTGACGAAGACATGACAAATCTTGG
CGAGTCACCAACAATTTTTGAAGTGCCGAATTCATTTTGTCATAGATTGT
ATTGGGTCGCCATGCTCCCAGTAGCCGCTATTTGCTATTTTACAATCCCA
GACTGTCGAAAACCAGGAATTTGGAGAAAATTATTCTTGGTAACATTTTT
TATAAGTGTGATTTGGATTTCCGTTGCTACCTACATTTTAGTTTGGATGA
TATGTTTAATTGGGGATACTCTCGATATTCCCGACACAATAATGGGGTTG
ACATTTCTAGCTGCAGGGACCTCTATTCCAGATGCAATTGCAGGGTATTT
AGTAGCCAAAGATGGTTATGGTGACATGGCCATTTCCAATAGCATCGGCA
GCAATGTATTTGATATTCTTATTTGCTTAGGACTGCCATGGTTTATTCGA
ACAAGTTTCTTGAATCCTGGGTCTGAAATCCCTGTCGAAAGCTCCAGTCT
CATCTTTACAACCATTACATTGCTCTCTACAGTTGTTGTTTTGGTGGCAA
CTATTATGGTTAATAAATGGAAACTCAATCGTTTCCTTGGGTTCATATTC
TTAGCATTATATATGTTAATTATAGCATTATCCTCTCTGTTCGAATTGAA
TATCCTTGGAAATTTCAATCGGCCCCCTTGCCCACGCACCAGTTCATGAA
ATTATGACAGG
back to top

protein sequence of SMED30001319-orf-1

>SMED30001319-orf-1 ID=SMED30001319-orf-1|Name=SMED30001319-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=506bp
MLKKNHGAYFKILFFYFSLVIGMYFFTKFKSNSDTMSELHGTGRKLLGLK
NCTTRSIEEFPNDFMTRKERKNGGIIFHIFVSIYLFVALAIICDEYFVSS
LERLCEVFNIKHDVAGATFMAAGSSAPELCTSVIGVFITKSDVGISTIVG
SAVFNVLCIIAICGIFVGSVIHLNWWPMFRDCIIYCLSIIALIIILNDGL
IQWYEALIMLFMYVAYIIILYYNGNLYGFVIQRLPRLKGYGEEHNPLISQ
NLPTSFGLLDSSEEEEIMETGDVDSIHSRIRLDEDMTNLGESPTIFEVPN
SFCHRLYWVAMLPVAAICYFTIPDCRKPGIWRKLFLVTFFISVIWISVAT
YILVWMICLIGDTLDIPDTIMGLTFLAAGTSIPDAIAGYLVAKDGYGDMA
ISNSIGSNVFDILICLGLPWFIRTSFLNPGSEIPVESSSLIFTTITLLST
VVVLVATIMVNKWKLNRFLGFIFLALYMLIIALSSLFELNILGNFNRPPC
PRTSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000047collecting duct
PLANA:0000070intestinal phagocyte
PLANA:0000087proximal tubule
PLANA:0000421tail
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR004481K/Na/Ca-exchanger
IPR004837NaCa_Exmemb
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0006813potassium ion transport
GO:0006814sodium ion transport
GO:0006816calcium ion transport
GO:0006874cellular calcium ion homeostasis
GO:0034220ion transmembrane transport
GO:0035725sodium ion transmembrane transport
GO:0048021regulation of melanin biosynthetic process
GO:0048022negative regulation of melanin biosynthetic process
GO:0050896response to stimulus
GO:0070588calcium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005794Golgi apparatus
GO:0005802trans-Golgi network
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0032588trans-Golgi network membrane
GO:0042470melanosome
Vocabulary: molecular function
TermDefinition
GO:0005262calcium channel activity
GO:0005509calcium ion binding
GO:0008273calcium, potassium:sodium antiporter activity
GO:0015293symporter activity
GO:0015297antiporter activity
GO:0030955potassium ion binding
GO:0031402sodium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004481Sodium/potassium/calcium exchangerTIGRFAMTIGR00367TIGR00367coord: 77..479
e-value: 5.4E-81
score: 270.1
IPR004481Sodium/potassium/calcium exchangerPANTHERPTHR10846SODIUM/POTASSIUM/CALCIUM EXCHANGERcoord: 57..500
IPR004837Sodium/calcium exchanger membrane regionPFAMPF01699Na_Ca_excoord: 79..221
e-value: 5.4E-24
score: 84.9
coord: 335..484
e-value: 5.9E-29
score: 101.0
NoneNo IPR availableGENE3DG3DSA:1.20.1420.30coord: 110..232
e-value: 4.0E-27
score: 97.0
coord: 306..486
e-value: 2.3E-27
score: 97.7
NoneNo IPR availableTMHMMTMhelixcoord: 439..461
NoneNo IPR availableTMHMMTMhelixcoord: 182..204
NoneNo IPR availableTMHMMTMhelixcoord: 335..357
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 370..392
NoneNo IPR availableTMHMMTMhelixcoord: 405..424
NoneNo IPR availableTMHMMTMhelixcoord: 468..487
NoneNo IPR availableTMHMMTMhelixcoord: 74..93
NoneNo IPR availableTMHMMTMhelixcoord: 148..170
NoneNo IPR availableTMHMMTMhelixcoord: 116..138
NoneNo IPR availableTMHMMTMhelixcoord: 209..231