SMED30001299

Overview
NameSMED30001299
Smed IDSMED30001299
Length (bp)3967
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30001299 (SMED30001299) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30001299 (SMED30001299) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001299 (SMED30001299) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001299 (SMED30001299) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001299

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001299h1SMcG0020508 SmedASXL_017833SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30001299h1SMcG0020508 dd_Smed_v4_13587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001299h1SMcG0020508 dd_Smed_v4_13587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001299h1SMcG0020508 dd_Smed_v4_13587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001299h1SMcG0020508 dd_Smed_v4_13587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001299h1SMcG0020508 dd_Smed_v4_13587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30001299h1SMcG0020508 dd_Smed_v4_13587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001299h1SMcG0020508 dd_Smed_v6_13587_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30001299 vs. TrEMBL
Match: A0A4Z2DMR9 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_010804 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 5.354e-26
Identity = 137/496 (27.62%), Postives = 213/496 (42.94%), Query Frame = 2
Query:  284 SILEMSPSGNYTIQMYIEIAD--GVDRFSEVYNEHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLA--------YPTS----ASGPNSLNHY-RSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPXXXXXXXXXXXXXXXXXSHPKCESARARCTDCQIFKCKTNKCCQ-----------------------------------LKSNCLLQD------------------SCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVSVTLD------------FINRKSKLKLQKRSVKFGGRFPDSNVLQFNN------LQLVFHPSLI--DSM-------------DEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTKS 1468
            S L   PSG   I +YI++ +   +  + +V +   +N  V+DS   S+  H  KPL++I +  C++PLPK Y + M  Y +R T A          TS    A+ P+    Y RSIN +CT      IL SD+    L   LNS YC+ NSPL+  LF E + E+++++    C++ R  C  C    C  +K                                      L+ N + Q+                  SCL Y++  C  +Y     N    C++GKT KFTL PEFDF+   + C+++     PK+  T++             I   S+LK     +K  GR+  S + + NN       QL  H  L+  D               D ++      E  +Y LK +  F    P +H+   + Y+ VQ  +PF ++T  W N+ C +NIS I++ Q I+   +K+P+E++      V KT S
Sbjct:  197 SFLLAYPSG---INVYIDVKNIRLLPEYEDVEHLSSDNGIVMDSSRKSNMQHWRKPLETIIKTACRYPLPKQYYLTMHPYLDRHTTARRHICQSNTVTSRLCPANYPSGYIFYDRSINGQCTQNLHNAILISDKA-SYLPPQLNSFYCTVNSPLVNNLFQENIVESQSYLKDLHCDTQRRICQTCLKQSCLQSKTEMNFEVSMKQTQSSIISNHVETITDSNFDDGIFYENLLRVNAIEQNIWQANDPDCCGIKCYSTPSCLDYFSFRC-EAYTSRHSNATEICLQGKTLKFTLNPEFDFSNGTYTCHVRYS--PPKILYTIETWLTLKTQSLPKLIWSSSRLKYDIY-LKNSGRYLGSRLSKLNNSSHNLERQLQKHGVLLLWDGSIYLEHQTDLPIWNDAIVHRSAEKEISLYQLKVLTDFGSEPPTLHRHREEKYVVVQFTKPFQYSTANWGNQTCLINISHIHRAQPIYAEHTKVPMEIIS----GVQKTTS 680          
BLAST of SMED30001299 vs. TrEMBL
Match: A0A4E0RZ73 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_001335 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 4.211e-25
Identity = 121/461 (26.25%), Postives = 196/461 (42.52%), Query Frame = 2
Query:  320 IQMYIEIAD--GVDRFSEVYNEHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYP----------------TSASGPNSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPXXXXXXXXXXXXXXXXXSHPKCESARARCTDCQIFKCKTNKCCQLKSNCLLQD--------------------------------SCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLK------------------KENLRPKVSVTLDFINRKSKLKLQKRSV--KFGGRF--------PDSNVL----QFNNLQLVFHPSLIDSMDEVIFGKKGF--------EHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELV 1432
            I +++ I D   +  + +V +E  +N  VLD+   S+  H   PL+++ ++ C++P+PK Y + M  Y++R T A                       P S+ + RSIN +CT       L +D+    L    NS YC+ NS L+TELF E + E ++++    C++ R  C  C    C T    Q   N L++D                                SC  YYN +C R Y          C++G+T KFTL PEFD N   + C+L+                  +   +P V +T+   +   + + Q  S   +F G           + N+L        L L  H   I+   ++    +G         +   + LK   +F   KP++ K   + Y+ +Q+ RPFL+NTETW N+ C +NIS I + Q I+  S+ +P+ L 
Sbjct:  265 INVHVAIMDIRLLPEYQDVEHEGSDNGIVLDTSRRSNMHHWRAPLQALLKSKCRYPIPKHYYLTMHPYSDRHTTAKRQICRRADEVHSRRRLCPKGLPPGSVYYQRSINGQCTQNLISATLITDKA-SFLPPQRNSFYCTTNSELVTELFNEHITERQSYLKDAHCDTQRRICQTCLRRSCWTESRRQTDGNDLIEDLTQSWDWMHDEVISAVKERYQKCCGVSCYSNPSCQEYYNPACQR-YTINQPEMDEICLQGQTLKFTLNPEFDLNNGSYLCHLRYNPPSHLYIIRTWLTIDNRWQTQP-VRMTVTAADSTHRHRAQSNSALPEFTGTMNHVQRHAQEEHNLLMARQNHGQLWLWNHAVKIEHHSKMPIWSEGIVQGESVTDQMTWHRLKTPDEFGLLKPELQKHRDEKYVVMQVTRPFLYNTETWGNQSCHMNISHIRRSQPIYAESTGLPVTLT 722          
BLAST of SMED30001299 vs. TrEMBL
Match: A0A5K4F6N1 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.605e-19
Identity = 124/477 (26.00%), Postives = 199/477 (41.72%), Query Frame = 2
Query:  284 SILEMSPSGNYTIQMYIEIADGVDRFSEVYNEHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYPTSASGPNSLN--------------HYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPXXXXXXXXXXXXXXXXXSHPKCESARARCTDC----------QIFKCKTNKCCQ-------------------------LKSNCLLQ--------DSC----------LTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVSVTLDF-----INRKSKLKLQKRSVKF------GGRFP--DSNVLQFN-------------------NLQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKM 1417
            S L   PSG  ++ + ++    +  + +V +   +N  V+D    S+  H  KPL++I +  C++PLPK Y + M  Y +R T A       PN++N              + RSIN +CT      IL SD+    L   LNS YC+ NSPL+ +LF E + E+++++    C++ R  C  C          ++F     K  Q                         L+ N + Q        D C          L Y+ + C  +Y     N    C++GKT KFTL PEFDF    + C+++     PK+  T++      I    KL      +K+       GR P   SN + ++                   N+ L     L    D ++      E  ++ LK +  F    P + +   + YI VQ  RPF ++T  W N+ CQ+NIS I++ Q I+  ++K+
Sbjct:  193 SFLLAYPSG-ISVHINVKNIRLLPEYEDVEHLASDNGIVMDPSRKSNMQHWRKPLETIIKTACRYPLPKQYYLAMHPYLDRHTTAR-RHVCQPNNVNSRLCPANYPSGYIFYDRSINGQCTQNLHNAILISDKA-SYLPPQLNSFYCTINSPLVNKLFQENIIESQSYLKDMHCDTQRRICQTCLKQSCLKSKTELFSEMNLKKAQHNLLSNHGEIENNHDFNEEIFYGNLLRVNTIEQNIWQANDPDCCGIKCYSNPSCLDYFGSRC-ETYTSRHSNATEICLQGKTLKFTLNPEFDFTNGTYTCHVQHR--PPKIIYTIETWLTLEIQGLPKLVWSSPRLKYNIQLMSNGRPPRRKSNKVDYDIQTLEQQFLKHGILLLWNENIYLEHKTGLPIWDDAIVHRSVDKEISLFQLKFLKDFGTEPPPLQRHKEEKYIVVQFSRPFQYSTSNWGNQTCQINISHIHRAQPIYAENTKV 663          
BLAST of SMED30001299 vs. TrEMBL
Match: A0A068WBT6 (Uncharacterized protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000826800 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.973e-18
Identity = 133/492 (27.03%), Postives = 197/492 (40.04%), Query Frame = 2
Query:  404 DSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYPTSAS-GPNSLNHYR------------SINDECTWEADGKILKSDETFELLDESLNSLYCSENSPXXXXXXXXXXXXXXXXXSHPKCESARARCTDCQIFKCKT------------------NKCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVS-------VTLDFINRKSKLKLQKRSVKFGGRFPDSNVLQFNNLQLVFHP----------------SLIDSMDEVIFGKK------GFEHFIYPL-KPVLKFDQSKP-KIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNIS-GIYKEQEIFEPSSKMPIELVKKQKMAVTKTKSVFSY---QFLPKGLETQKILFQISEKS---SLLSLYFCHGQQLHKPANI------------KVRVENIDEQNWR 1636
            DSH+      L   L+     FC+HPLPK Y + M  Y +R+T A   + S G +S  ++R            ++N+ C++      LKS+          NS YC+ NSPL+TE+F E + ++    S  +C+ AR  C  C +  C                    + CCQ+   C     CL Y+N  CY     +L   K  C +GKT KFTL P+FDF     QC++++   RP+ S         +DF   +  L   K   K G    +S  LQ   L   F P                S I  ++E I  KK        E F+  L +  +     KP ++ +   + YI  Q  +PF  NTE W  + C V IS G  +EQ     + K P               + F+Y   +F       +K+   IS K    SL+   FC+  QL K   +            K  +  +D+  W+
Sbjct:    8 DSHLAD----LKSLLQKEVATFCRHPLPKRYYLSMKPYPDRQTAAILRNFSIGIDSRTNFRQFENMEARLFQRTLNEPCSYSVPTP-LKSES---------NSFYCTTNSPLVTEVFKEHLMDSYVDQSDERCDKARRICHLCLMQSCGVKHIDWNMRLTSFALLGSNSSCCQVP--CYASPHCLRYFNRECYPLDRYSLEKPK-LCFRGKTLKFTLTPDFDFKNSGIQCHIRR---RPRSSSQKIILEFGMDFTTLRKNLD-SKHPEKIGTFHSNSYQLQ---LFFRFFPGKTGYFLQNHFIFDLRSNIPDLEEAILMKKVPNNSTEPEFFLVALARREISLSNKKPIQLFRQREQKYITFQNVKPFQFNTENWHKQGCSVQISTGTMQEQSAENATYKKP-------------PGAPFAYIINEF------DRKVQLHISAKGNHRSLMYAIFCNSPQLSKSPKLSHQLLRDAGHKFKFGLTKLDKSGWK 456          
BLAST of SMED30001299 vs. TrEMBL
Match: A0A3R7DBL8 (Uncharacterized protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=CSKR_5664s PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.225e-18
Identity = 86/287 (29.97%), Postives = 136/287 (47.39%), Query Frame = 2
Query:  803 KCKTNKCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKK---ENL--------------RPKVS--VTLDFIN--RKSKLKLQKRSVK-FGGRFPDSN--------VLQFNNLQLVFHPSLIDSMDEVIFGKKGF--EHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTKSVFSYQFLPKGLETQ-KILFQISEKSSLLSLYFC 1564
            + K  +CC +  +C    SCL Y++ +C ++Y     + +  C++GKT KFTL PEFD     F C+L +   ENL                 VS  V+L   N  R S+     +S+K    R  +S+        VL +N+   V H S     +++I  +K    + ++Y LK   +F  + P+  K   + Y  VQ   PFLHNTE+W NE CQ+NIS ++K Q I++ +S++PI L    +         F Y      L T+ ++  ++  + SLL    C
Sbjct:   94 RAKAKECCSV--DCYSIPSCLEYFSPTC-QAYTIHSQHVQEVCLQGKTLKFTLNPEFDLANGSFMCHLTRVPPENLYTINAWLVVNGTWKTDPVSHVVSLRPPNGIRDSRGAHSPQSMKHLRYRRAESSLNRNLRGVVLLWNDKLRVEHQSSASLWEQLILKRKNAPGQFYVYRLKSFEEFGLAPPQYEKHREEKYATVQFTTPFLHNTESWGNESCQLNISHMHKSQPIYDETSEIPIVLASPTRR---NANGAFQYTLNEAQLGTKIQVTMEVENQDSLLRSALC 374          
BLAST of SMED30001299 vs. Planmine SMEST
Match: SMESG000010387.1 (SMESG000010387.1)

HSP 1 Score: 2369.73 bits (6140), Expect = 0.000e+0
Identity = 1270/1286 (98.76%), Postives = 1277/1286 (99.30%), Query Frame = 2
Query:   86 MTNSQILFLLVLIGISKTFSKDEKSKFKYPRVQVEHLFSSEGVLVDNLANHFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADGVDRFSEVYNEHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYPTSASGPNSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPXXXXXXXXXXXXXXXXXSHPKCESARARCTDCQIFKCKTNKCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVSVTLDFINRKSKLKLQKRSVKFGGRFPDSNVLQFNNLQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTKSVFSYQFLPKGLETQKILFQISEKSSLLSLYFCHGQQLHKPANIKVRVENIDEQNWRLVITGKXXXXXXXXXXXXXXXXXXGETIYRADIVVSKSSKNLNTSEYFNISFKISNLEPNINESINLLLIDFDQCQRKFFQKSIFLKFSERLDPMKDSTEIERSVDISNFILVVFLATICICFFYFVLLAFQAARKSAIIKNAKNCCSVNKQSKKMNYKLFMKIIFYMTLKLFYTXXXXXXXXXXXXXXXXXFAIHSINQSNFVARQNVNLNKFPSTEKSDPFCNEIPKLISKHFLVKIRSQLANQEIVRSLSAQSIQSVSLHILNNISIPRFHNSILEIINKYXXXXXXXXXXXXXXXXXILKSLNQSKWLSPLQHWNATKMNNFFFNTDIFQNDQGGHLRISNLLGIYEFSSFLQSCKYLTKRLETTQERMKISLKPNDKEFKLRIAVKSGRFRRYFQTRIKQTTPYGNLSITHNKWQFHNKSLSFLTIDIFKIRLFFMLIDTALILYRCYWTFLDIRQMWNPKKQFIHLNQIILKANHSSSNVRTKSSLLHWTKHHHLECLVSAHXXXXXXXXXXXXXCMNLLVLLTSRDHSNWLSKKAGYSLRIRSIKDIKEELSKFNNEQINPVHRHWQTHKLSRIKQFMDHRKEAINRIMYLELFLNHQYFYELCGLQNLSIVPKLSLDFCHSLVPNHAIIPDVLCDRSLKYVPXXXXXXXXXXXXXXXXXXYQPLYLVLNILALFLFATSVVGILKVIRKSMEHKIFSFGKPVHIFLRSQRQMVMDNWKNPKALIKMKNLTTIPNVYSRNLEPPNQYQCKGDPFNETVNSSV 3943
            MTNSQILFLLVLIGISKTFSKDEKSKFKYPRVQVEHL SSEGVLVDNLANHFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADG+DRFSEVY+EHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYPTS SGPNSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPLLTELFGETVEE ETFVS PKCESARARCTDCQIFKCKTNKCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVSVTLDFINRKSKLKLQKRSVKFGGRFPDSNVLQFNNLQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTK+VFSYQFLPKGLETQKILFQISEKSSLLSLYFCHGQQLHKPANIKVRVENIDEQNWRLVITGKIIESISYFSLSISPSFSSGETIY+ADIVVSKSSKNLNTSEYFNISFKISNLEPNINESINLLLIDFDQCQRKFFQKSIFLKFSERLDPMKDSTEIERSVDISNFILVVFLATICICFFYFVLLAFQAARKSAIIKNAKNC SVNKQSKKMNYKLFMKIIFYMTLKLFYTVSFTLSLVLSVCLSLNVFAIHSINQSNFVARQNVNLNKFPSTEKSDPFCNEIPKLISKHFLVKIRSQLANQEIVRSLSAQSIQSVSLHILNNISIPRFHNSILEIINKYQRSLQQQNQLILNSNS+ILKSLNQSKWLSPLQHWNATKMNNFF NT+IFQNDQGGHLRISNLLGIYEFSSFLQSCKYLTKRLETTQERMKISLKPN+KEFKLRIAVKSGRFRRYFQTRIKQTTPYGNLSITHNKWQFHNKSLSFLTIDIFKIRLFFMLIDTALILYRCYWTFLDIRQMWNPKKQFIHLNQIILKANHSSSNVRTKSSLLHWTKHHHLECLVSAHLAIAAIIILLSIICMNLLVLLTSRDHSNWLSKKAG SLRIRSIKDIKEELSKFNNE INPVHRHWQTHKLSRIKQFMDHRKEAINRIMYLELFLNHQYFYELCGLQNLSIVPKLSLDFCHSLVPNHAIIPDVLCDRSLKYVPSLSFDLSSYVSSKSVIYIYQPLYLVLNILALFLFATSVVGILKVIRKSMEHKIFS GKPVHIFLRSQRQMVMDNWKNPKALIKMKNLTTIPNVYSRNLEPPNQYQCKGDPFNETVNSSV
Sbjct:    1 MTNSQILFLLVLIGISKTFSKDEKSKFKYPRVQVEHLLSSEGVLVDNLANHFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADGIDRFSEVYHEHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYPTSTSGPNSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPLLTELFGETVEEIETFVSRPKCESARARCTDCQIFKCKTNKCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVSVTLDFINRKSKLKLQKRSVKFGGRFPDSNVLQFNNLQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTKTVFSYQFLPKGLETQKILFQISEKSSLLSLYFCHGQQLHKPANIKVRVENIDEQNWRLVITGKIIESISYFSLSISPSFSSGETIYKADIVVSKSSKNLNTSEYFNISFKISNLEPNINESINLLLIDFDQCQRKFFQKSIFLKFSERLDPMKDSTEIERSVDISNFILVVFLATICICFFYFVLLAFQAARKSAIIKNAKNC-SVNKQSKKMNYKLFMKIIFYMTLKLFYTVSFTLSLVLSVCLSLNVFAIHSINQSNFVARQNVNLNKFPSTEKSDPFCNEIPKLISKHFLVKIRSQLANQEIVRSLSAQSIQSVSLHILNNISIPRFHNSILEIINKYQRSLQQQNQLILNSNSKILKSLNQSKWLSPLQHWNATKMNNFFSNTNIFQNDQGGHLRISNLLGIYEFSSFLQSCKYLTKRLETTQERMKISLKPNEKEFKLRIAVKSGRFRRYFQTRIKQTTPYGNLSITHNKWQFHNKSLSFLTIDIFKIRLFFMLIDTALILYRCYWTFLDIRQMWNPKKQFIHLNQIILKANHSSSNVRTKSSLLHWTKHHHLECLVSAHLAIAAIIILLSIICMNLLVLLTSRDHSNWLSKKAGNSLRIRSIKDIKEELSKFNNEHINPVHRHWQTHKLSRIKQFMDHRKEAINRIMYLELFLNHQYFYELCGLQNLSIVPKLSLDFCHSLVPNHAIIPDVLCDRSLKYVPSLSFDLSSYVSSKSVIYIYQPLYLVLNILALFLFATSVVGILKVIRKSMEHKIFSSGKPVHIFLRSQRQMVMDNWKNPKALIKMKNLTTIPNVYSRNLEPPNQYQCKGDPFNETVNSSV 1285          
BLAST of SMED30001299 vs. Planmine SMEST
Match: SMESG000010387.1 (SMESG000010387.1)

HSP 1 Score: 2363.57 bits (6124), Expect = 0.000e+0
Identity = 1270/1289 (98.53%), Postives = 1277/1289 (99.07%), Query Frame = 2
Query:   86 MTNSQILFLLVLIGISKTFSKDEKSKFKYPRVQVEHLFSSEGVLVDNLANHFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADGVDRFSEVYNEHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYPTSASGPNSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPXXXXXXXXXXXXXXXXXSHPKCESARARCTDCQIFKCKTNKCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVSVTLDFINRKSKLKLQKRSVKFGGRFPDSNVLQFNNLQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTKSVFSYQFLPKGLETQKILFQISEKSSLLSLYFCHGQQLHKPANIKVRVENIDEQNWRLVITGKXXXXXXXXXXXXXXXXXXGETIYRADIVVSKSSKNLNTSEYFNISFKISNLEPNINESINLLLIDFDQCQRKFFQKSIFLKFSERLDPMKDSTEIERSVDISNFILVVFLATICICFFYFVLLAFQAARKSAIIKNAKNCCSVNKQSKKMNYKLFMKIIFYMTLKLFYTXXXXXXXXXXXXXXXXXFAIHSINQSNFVARQNVNLNKFPSTEKSDPFCNEIPKLISKHFLVKIRSQLANQEIVRSLSAQSIQSVSLHILNNISIPRFHNSILEIINKYXXXXXXXXXXXXXXXXXILKSLNQSKWLSPLQHWNATKMNNFFFNTDIFQNDQGGHLRISNLLGIYEFSSFLQSCKYLTK---RLETTQERMKISLKPNDKEFKLRIAVKSGRFRRYFQTRIKQTTPYGNLSITHNKWQFHNKSLSFLTIDIFKIRLFFMLIDTALILYRCYWTFLDIRQMWNPKKQFIHLNQIILKANHSSSNVRTKSSLLHWTKHHHLECLVSAHXXXXXXXXXXXXXCMNLLVLLTSRDHSNWLSKKAGYSLRIRSIKDIKEELSKFNNEQINPVHRHWQTHKLSRIKQFMDHRKEAINRIMYLELFLNHQYFYELCGLQNLSIVPKLSLDFCHSLVPNHAIIPDVLCDRSLKYVPXXXXXXXXXXXXXXXXXXYQPLYLVLNILALFLFATSVVGILKVIRKSMEHKIFSFGKPVHIFLRSQRQMVMDNWKNPKALIKMKNLTTIPNVYSRNLEPPNQYQCKGDPFNETVNSSV 3943
            MTNSQILFLLVLIGISKTFSKDEKSKFKYPRVQVEHL SSEGVLVDNLANHFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADG+DRFSEVY+EHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYPTS SGPNSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPLLTELFGETVEE ETFVS PKCESARARCTDCQIFKCKTNKCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVSVTLDFINRKSKLKLQKRSVKFGGRFPDSNVLQFNNLQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTK+VFSYQFLPKGLETQKILFQISEKSSLLSLYFCHGQQLHKPANIKVRVENIDEQNWRLVITGKIIESISYFSLSISPSFSSGETIY+ADIVVSKSSKNLNTSEYFNISFKISNLEPNINESINLLLIDFDQCQRKFFQKSIFLKFSERLDPMKDSTEIERSVDISNFILVVFLATICICFFYFVLLAFQAARKSAIIKNAKN CSVNKQSKKMNYKLFMKIIFYMTLKLFYTVSFTLSLVLSVCLSLNVFAIHSINQSNFVARQNVNLNKFPSTEKSDPFCNEIPKLISKHFLVKIRSQLANQEIVRSLSAQSIQSVSLHILNNISIPRFHNSILEIINKYQRSLQQQNQLILNSNS+ILKSLNQSKWLSPLQHWNATKMNNFF NT+IFQNDQGGHLRISNLLGIYEFSSFLQSCKYLTK   RLETTQERMKISLKPN+KEFKLRIAVKSGRFRRYFQTRIKQTTPYGNLSITHNKWQFHNKSLSFLTIDIFKIRLFFMLIDTALILYRCYWTFLDIRQMWNPKKQFIHLNQIILKANHSSSNVRTKSSLLHWTKHHHLECLVSAHLAIAAIIILLSIICMNLLVLLTSRDHSNWLSKKAG SLRIRSIKDIKEELSKFNNE INPVHRHWQTHKLSRIKQFMDHRKEAINRIMYLELFLNHQYFYELCGLQNLSIVPKLSLDFCHSLVPNHAIIPDVLCDRSLKYVPSLSFDLSSYVSSKSVIYIYQPLYLVLNILALFLFATSVVGILKVIRKSMEHKIFS GKPVHIFLRSQRQMVMDNWKNPKALIKMKNLTTIPNVYSRNLEPPNQYQCKGDPFNETVNSSV
Sbjct:    1 MTNSQILFLLVLIGISKTFSKDEKSKFKYPRVQVEHLLSSEGVLVDNLANHFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADGIDRFSEVYHEHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYPTSTSGPNSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPLLTELFGETVEEIETFVSRPKCESARARCTDCQIFKCKTNKCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVSVTLDFINRKSKLKLQKRSVKFGGRFPDSNVLQFNNLQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTKTVFSYQFLPKGLETQKILFQISEKSSLLSLYFCHGQQLHKPANIKVRVENIDEQNWRLVITGKIIESISYFSLSISPSFSSGETIYKADIVVSKSSKNLNTSEYFNISFKISNLEPNINESINLLLIDFDQCQRKFFQKSIFLKFSERLDPMKDSTEIERSVDISNFILVVFLATICICFFYFVLLAFQAARKSAIIKNAKN-CSVNKQSKKMNYKLFMKIIFYMTLKLFYTVSFTLSLVLSVCLSLNVFAIHSINQSNFVARQNVNLNKFPSTEKSDPFCNEIPKLISKHFLVKIRSQLANQEIVRSLSAQSIQSVSLHILNNISIPRFHNSILEIINKYQRSLQQQNQLILNSNSKILKSLNQSKWLSPLQHWNATKMNNFFSNTNIFQNDQGGHLRISNLLGIYEFSSFLQSCKYLTKSIIRLETTQERMKISLKPNEKEFKLRIAVKSGRFRRYFQTRIKQTTPYGNLSITHNKWQFHNKSLSFLTIDIFKIRLFFMLIDTALILYRCYWTFLDIRQMWNPKKQFIHLNQIILKANHSSSNVRTKSSLLHWTKHHHLECLVSAHLAIAAIIILLSIICMNLLVLLTSRDHSNWLSKKAGNSLRIRSIKDIKEELSKFNNEHINPVHRHWQTHKLSRIKQFMDHRKEAINRIMYLELFLNHQYFYELCGLQNLSIVPKLSLDFCHSLVPNHAIIPDVLCDRSLKYVPSLSFDLSSYVSSKSVIYIYQPLYLVLNILALFLFATSVVGILKVIRKSMEHKIFSSGKPVHIFLRSQRQMVMDNWKNPKALIKMKNLTTIPNVYSRNLEPPNQYQCKGDPFNETVNSSV 1288          
BLAST of SMED30001299 vs. Planmine SMEST
Match: SMESG000010387.1 (SMESG000010387.1)

HSP 1 Score: 2316.96 bits (6003), Expect = 0.000e+0
Identity = 1251/1286 (97.28%), Postives = 1260/1286 (97.98%), Query Frame = 2
Query:   86 MTNSQILFLLVLIGISKTFSKDEKSKFKYPRVQVEHLFSSEGVLVDNLANHFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADGVDRFSEVYNEHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYPTSASGPNSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPXXXXXXXXXXXXXXXXXSHPKCESARARCTDCQIFKCKTNKCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVSVTLDFINRKSKLKLQKRSVKFGGRFPDSNVLQFNNLQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTKSVFSYQFLPKGLETQKILFQISEKSSLLSLYFCHGQQLHKPANIKVRVENIDEQNWRLVITGKXXXXXXXXXXXXXXXXXXGETIYRADIVVSKSSKNLNTSEYFNISFKISNLEPNINESINLLLIDFDQCQRKFFQKSIFLKFSERLDPMKDSTEIERSVDISNFILVVFLATICICFFYFVLLAFQAARKSAIIKNAKNCCSVNKQSKKMNYKLFMKIIFYMTLKLFYTXXXXXXXXXXXXXXXXXFAIHSINQSNFVARQNVNLNKFPSTEKSDPFCNEIPKLISKHFLVKIRSQLANQEIVRSLSAQSIQSVSLHILNNISIPRFHNSILEIINKYXXXXXXXXXXXXXXXXXILKSLNQSKWLSPLQHWNATKMNNFFFNTDIFQNDQGGHLRISNLLGIYEFSSFLQSCKYLTKRLETTQERMKISLKPNDKEFKLRIAVKSGRFRRYFQTRIKQTTPYGNLSITHNKWQFHNKSLSFLTIDIFKIRLFFMLIDTALILYRCYWTFLDIRQMWNPKKQFIHLNQIILKANHSSSNVRTKSSLLHWTKHHHLECLVSAHXXXXXXXXXXXXXCMNLLVLLTSRDHSNWLSKKAGYSLRIRSIKDIKEELSKFNNEQINPVHRHWQTHKLSRIKQFMDHRKEAINRIMYLELFLNHQYFYELCGLQNLSIVPKLSLDFCHSLVPNHAIIPDVLCDRSLKYVPXXXXXXXXXXXXXXXXXXYQPLYLVLNILALFLFATSVVGILKVIRKSMEHKIFSFGKPVHIFLRSQRQMVMDNWKNPKALIKMKNLTTIPNVYSRNLEPPNQYQCKGDPFNETVNSSV 3943
            MTNSQILFLLVLIGISKTFSKDEKSKFKYPRVQVEHL SSEGVLVDNLANHFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADG+DRFSEVY+EHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYPTS SGPNSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPLLTELFGETVEE ETFVS PKCESARARCTDCQIFKCKTNKCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVSVTLDFINRKSKLKLQKRSVKFGGRFPDSNVLQFNNLQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTK+      L    + QK      +KSSLLSLYFCHGQQLHKPANIKVRVENIDEQNWRLVITGKIIESISYFSLSISPSFSSGETIY+ADIVVSKSSKNLNTSEYFNISFKISNLEPNINESINLLLIDFDQCQRKFFQKSIFLKFSERLDPMKDSTEIERSVDISNFILVVFLATICICFFYFVLLAFQAARKSAIIKNAKNC SVNKQSKKMNYKLFMKIIFYMTLKLFYTVSFTLSLVLSVCLSLNVFAIHSINQSNFVARQNVNLNKFPSTEKSDPFCNEIPKLISKHFLVKIRSQLANQEIVRSLSAQSIQSVSLHILNNISIPRFHNSILEIINKYQRSLQQQNQLILNSNS+ILKSLNQSKWLSPLQHWNATKMNNFF NT+IFQNDQGGHLRISNLLGIYEFSSFLQSCKYLTKRLETTQERMKISLKPN+KEFKLRIAVKSGRFRRYFQTRIKQTTPYGNLSITHNKWQFHNKSLSFLTIDIFKIRLFFMLIDTALILYRCYWTFLDIRQMWNPKKQFIHLNQIILKANHSSSNVRTKSSLLHWTKHHHLECLVSAHLAIAAIIILLSIICMNLLVLLTSRDHSNWLSKKAG SLRIRSIKDIKEELSKFNNE INPVHRHWQTHKLSRIKQFMDHRKEAINRIMYLELFLNHQYFYELCGLQNLSIVPKLSLDFCHSLVPNHAIIPDVLCDRSLKYVPSLSFDLSSYVSSKSVIYIYQPLYLVLNILALFLFATSVVGILKVIRKSMEHKIFS GKPVHIFLRSQRQMVMDNWKNPKALIKMKNLTTIPNVYSRNLEPPNQYQCKGDPFNETVNSSV
Sbjct:    1 MTNSQILFLLVLIGISKTFSKDEKSKFKYPRVQVEHLLSSEGVLVDNLANHFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADGIDRFSEVYHEHDENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLAYPTSTSGPNSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPLLTELFGETVEEIETFVSRPKCESARARCTDCQIFKCKTNKCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCYLKKENLRPKVSVTLDFINRKSKLKLQKRSVKFGGRFPDSNVLQFNNLQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTKTT-----LIVSGQAQK------KKSSLLSLYFCHGQQLHKPANIKVRVENIDEQNWRLVITGKIIESISYFSLSISPSFSSGETIYKADIVVSKSSKNLNTSEYFNISFKISNLEPNINESINLLLIDFDQCQRKFFQKSIFLKFSERLDPMKDSTEIERSVDISNFILVVFLATICICFFYFVLLAFQAARKSAIIKNAKNC-SVNKQSKKMNYKLFMKIIFYMTLKLFYTVSFTLSLVLSVCLSLNVFAIHSINQSNFVARQNVNLNKFPSTEKSDPFCNEIPKLISKHFLVKIRSQLANQEIVRSLSAQSIQSVSLHILNNISIPRFHNSILEIINKYQRSLQQQNQLILNSNSKILKSLNQSKWLSPLQHWNATKMNNFFSNTNIFQNDQGGHLRISNLLGIYEFSSFLQSCKYLTKRLETTQERMKISLKPNEKEFKLRIAVKSGRFRRYFQTRIKQTTPYGNLSITHNKWQFHNKSLSFLTIDIFKIRLFFMLIDTALILYRCYWTFLDIRQMWNPKKQFIHLNQIILKANHSSSNVRTKSSLLHWTKHHHLECLVSAHLAIAAIIILLSIICMNLLVLLTSRDHSNWLSKKAGNSLRIRSIKDIKEELSKFNNEHINPVHRHWQTHKLSRIKQFMDHRKEAINRIMYLELFLNHQYFYELCGLQNLSIVPKLSLDFCHSLVPNHAIIPDVLCDRSLKYVPSLSFDLSSYVSSKSVIYIYQPLYLVLNILALFLFATSVVGILKVIRKSMEHKIFSSGKPVHIFLRSQRQMVMDNWKNPKALIKMKNLTTIPNVYSRNLEPPNQYQCKGDPFNETVNSSV 1274          
BLAST of SMED30001299 vs. Planmine SMEST
Match: SMESG000016698.1 (SMESG000016698.1)

HSP 1 Score: 144.05 bits (362), Expect = 2.707e-34
Identity = 135/498 (27.11%), Postives = 223/498 (44.78%), Query Frame = 2
Query:  206 EGVLVDNLANHFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADGVDRFSEVYNEHDE--NRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLA----------YPTSASGP-----NSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPXXXXXXXXXXXXXXXXXSHPKCESARARCTDCQIFKCKTN----------KCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCY--LKKENLRPKVSVTLDFIN-RKSKLKLQKRSVK--FGGRFPDSNVLQFNN--LQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQKMAVTKTKSVFSYQFLPKGLETQKILFQISEKSSLLSLYFCHGQQLHKPANI 1597
            E +L++   NH   +N    K  +  SI  +  SG   I+M I++ +    F     EH E  N F+L +   S    L KPL +I +NFC+ PLP  Y + +  + NR T               S   P       +  YR++ND+CT      + +  + F          YC++NSP+L  +F E + E     S  +C+  R  C  C   +C ++           CCQ  + CLLQ SC+ YY+ +CY  Y +   +  + CIKG TY+FTL P+F FN   F C+  L+KE +  +V + +   +  K +  L +   +    G+   + V  + +  +++     + +   + I   K  +  +Y LK   +F ++KP I K     Y K+Q   PF  N+  W    C  NI  +Y+ Q ++  S  + I+L+K +K         F+Y ++    ++  I     EKSS+L    C    L+  +N+
Sbjct:   78 EDLLLETSFNHIITVN----KVNQNASIEIIRRSG---IKMTIDLVNIKLHFKYQDVEHPESDNDFILHAKSPSVAADLQKPLLNIIQNFCREPLPDHYFLTVTPFKNRYTRGNKIICNQIQMTTGSVRCPEHYYNGQIYAYRTVNDQCTHNKATYLPQDTDKF----------YCTQNSPILNSIFHEKITEKIELQSFGECQLHRKNCEKCFRPRCASHFKSIDSYDYENCCQFIAQCLLQPSCIDYYSPTCY--YVDLAEHQHNLCIKGSTYQFTLNPQFSFNNKSFMCHMSLEKEKIIYQVKIKVSIPHWMKLEFHLSENVTRPNIKGKLTTTPVYTYESTLMKMQHRFRINEYFQDAILHFKSNKFHLYKLKE--RFSETKPIIKKHHQIKYTKIQASYPFAVNSRNWHKRSCYTNIEDLYENQLLYNESENISIKLLKLEKNNF----QAFNY-YVNNIDQSHDINIAFPEKSSILKSAICSLHHLNSRSNL 549          
BLAST of SMED30001299 vs. Planmine SMEST
Match: SMESG000016698.1 (SMESG000016698.1)

HSP 1 Score: 138.658 bits (348), Expect = 7.327e-34
Identity = 125/447 (27.96%), Postives = 205/447 (45.86%), Query Frame = 2
Query:  206 EGVLVDNLANHFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADGVDRFSEVYNEHDE--NRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETLA----------YPTSASGP-----NSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCSENSPXXXXXXXXXXXXXXXXXSHPKCESARARCTDCQIFKCKTN----------KCCQLKSNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNTDKFQCY--LKKENLRPKVSVTLDFIN-RKSKLKLQKRSVK--FGGRFPDSNVLQFNN--LQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFSKSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVKKQK 1444
            E +L++   NH   +N    K  +  SI  +  SG   I+M I++ +    F     EH E  N F+L +   S    L KPL +I +NFC+ PLP  Y + +  + NR T               S   P       +  YR++ND+CT         +  T+  L +  +  YC++NSP+L  +F E + E     S  +C+  R  C  C   +C ++           CCQ  + CLLQ SC+ YY+ +CY  Y +   +  + CIKG TY+FTL P+F FN   F C+  L+KE +  +V + +   +  K +  L +   +    G+   + V  + +  +++     + +   + I   K  +  +Y LK   +F ++KP I K     Y K+Q   PF  N+  W    C  NI  +Y+ Q ++  S  + I+L+K +K
Sbjct:   78 EDLLLETSFNHIITVN----KVNQNASIEIIRRSG---IKMTIDLVNIKLHFKYQDVEHPESDNDFILHAKSPSVAADLQKPLLNIIQNFCREPLPDHYFLTVTPFKNRYTRGNKIICNQIQMTTGSVRCPEHYYNGQIYAYRTVNDQCT--------HNKATY--LPQDTDKFYCTQNSPILNSIFHEKITEKIELQSFGECQLHRKNCEKCFRPRCASHFKSIDSYDYENCCQFIAQCLLQPSCIDYYSPTCY--YVDLAEHQHNLCIKGSTYQFTLNPQFSFNNKSFMCHMSLEKEKIIYQVKIKVSIPHWMKLEFHLSENVTRPNIKGKLTTTPVYTYESTLMKMQHRFRINEYFQDAILHFKSNKFHLYKLKE--RFSETKPIIKKHHQIKYTKIQASYPFAVNSRNWHKRSCYTNIEDLYENQLLYNESENISIKLLKLEK 503          
The following BLAST results are available for this feature:
BLAST of SMED30001299 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DMR95.354e-2627.62Uncharacterized protein OS=Schistosoma japonicum O... [more]
A0A4E0RZ734.211e-2526.25Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A5K4F6N11.605e-1926.00Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A068WBT61.973e-1827.03Uncharacterized protein OS=Echinococcus granulosus... [more]
A0A3R7DBL82.225e-1829.97Uncharacterized protein (Fragment) OS=Clonorchis s... [more]
back to top
BLAST of SMED30001299 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001299 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010387.10.000e+098.76SMESG000010387.1[more]
SMESG000010387.10.000e+098.53SMESG000010387.1[more]
SMESG000010387.10.000e+097.28SMESG000010387.1[more]
SMESG000016698.12.707e-3427.11SMESG000016698.1[more]
SMESG000016698.17.327e-3427.96SMESG000016698.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001299 ID=SMED30001299|Name=SMED30001299|organism=Schmidtea mediterranea sexual|type=transcript|length=3967bp
CACAGATTTGGATAATATTCAATCAAACGTTTGTTTTGACTCCAACAAAA
GATTATCATCATCCGGTTGAGCCTGATTTGAGTAAATGACCAACAGCCAA
ATTCTTTTCTTATTAGTTTTGATTGGAATTTCCAAGACCTTTTCCAAGGA
TGAAAAATCAAAATTTAAATATCCAAGAGTTCAAGTCGAACACTTATTCA
GCTCTGAAGGGGTCTTGGTTGACAATCTTGCGAATCATTTCCCGATGATA
AATTTGATAAAATTAAAACAACAAAAACAGCATTCAATATTAGAAATGTC
TCCTAGTGGAAACTATACGATCCAAATGTACATTGAAATAGCTGACGGAG
TTGACAGATTCAGTGAAGTGTATAACGAGCATGACGAAAACCGATTCGTT
CTCGATTCTCACATCACAAGTGACACCTTCCATTTGATCAAACCTCTCAA
GTCGATTACAGAAAACTTTTGCAAGCACCCTTTACCAAAGGGTTATAACA
TTTTTATGGATATTTATAATAACCGCGAGACCTTGGCATACCCGACAAGT
GCCAGTGGACCTAATTCCTTGAATCATTATAGGTCAATTAATGATGAATG
CACATGGGAGGCAGACGGGAAGATTCTTAAATCCGACGAAACTTTTGAAC
TGTTGGATGAAAGCCTCAATTCATTATATTGCTCGGAAAACTCTCCTTTG
TTGACGGAATTGTTCGGAGAAACTGTAGAGGAAACCGAAACGTTCGTGTC
CCATCCAAAGTGCGAAAGTGCCAGAGCGAGATGTACGGATTGTCAGATTT
TCAAGTGCAAAACTAATAAATGTTGTCAATTAAAATCAAATTGTTTACTG
CAAGATTCTTGTCTAACTTACTATAACACCAGTTGCTATAGATCATATGA
GGAAGCTTTGTACAACAACAAATCAAGATGCATCAAAGGGAAAACTTACA
AATTCACCCTGATTCCGGAATTCGATTTCAACACCGACAAATTCCAGTGC
TACCTGAAAAAGGAAAACCTCCGACCGAAAGTCTCGGTGACCTTGGACTT
CATTAATAGGAAATCGAAATTGAAGCTTCAGAAGCGCTCGGTTAAATTTG
GGGGCCGATTTCCTGATTCGAACGTTTTACAATTCAACAATCTTCAGCTC
GTCTTCCATCCATCCTTGATCGACTCGATGGACGAGGTGATCTTCGGCAA
GAAAGGATTTGAACATTTCATTTATCCCCTGAAACCGGTTCTCAAATTCG
ATCAAAGTAAACCGAAAATTCACAAATTATTTTCCAAATCTTACATCAAA
GTTCAGATGTACAGACCATTTCTCCACAATACTGAGACGTGGTCAAACGA
AAAATGCCAGGTTAACATTTCAGGAATATACAAAGAACAAGAGATCTTTG
AGCCCTCCTCAAAAATGCCGATTGAGTTGGTTAAAAAGCAAAAAATGGCA
GTCACAAAGACGAAATCGGTTTTCAGTTATCAATTCCTTCCAAAGGGCCT
CGAAACACAGAAAATTCTCTTTCAAATATCAGAAAAATCCTCCCTGTTGT
CATTGTATTTTTGTCACGGTCAACAGTTGCACAAGCCGGCCAATATCAAA
GTCAGAGTTGAAAATATTGATGAACAAAATTGGAGACTTGTTATAACAGG
TAAAATCATTGAATCAATATCGTATTTTAGTTTGTCAATTTCACCTAGTT
TTTCTTCTGGTGAGACTATTTACAGGGCCGATATTGTAGTGAGTAAATCA
TCAAAGAACTTAAATACCTCGGAATACTTCAATATATCCTTTAAAATATC
AAACCTTGAACCGAACATAAATGAGTCGATTAATTTACTTCTGATTGATT
TTGATCAGTGCCAACGAAAATTTTTTCAGAAATCGATTTTTCTAAAATTC
TCCGAAAGACTCGATCCAATGAAAGACTCGACTGAAATTGAGCGTTCCGT
TGACATTTCGAATTTCATCCTCGTCGTATTTCTAGCGACAATCTGTATCT
GTTTTTTCTATTTCGTACTGTTAGCGTTTCAAGCGGCACGAAAGTCCGCC
ATTATCAAAAATGCCAAGAACTGTTGTTCGGTGAATAAACAATCAAAAAA
GATGAATTATAAACTTTTTATGAAAATAATTTTTTACATGACCTTGAAAT
TGTTTTACACAGTATCTTTCACTCTGTCACTCGTGTTGTCGGTTTGTTTG
AGTTTGAATGTTTTTGCCATTCATTCCATCAATCAGTCAAATTTCGTTGC
CCGGCAAAATGTCAATTTAAACAAATTTCCATCGACCGAAAAATCCGATC
CGTTTTGCAATGAAATTCCCAAGTTGATCTCGAAACATTTTCTCGTGAAA
ATCAGAAGTCAATTGGCCAATCAGGAAATAGTCCGCTCGCTCAGTGCTCA
ATCGATCCAATCAGTTTCCTTGCACATTTTGAACAACATATCGATTCCTA
GATTTCACAATTCAATTTTGGAAATAATAAATAAATATCAGCGCTCTTTA
CAACAACAAAATCAATTAATTTTGAATTCAAATTCTAGGATTTTAAAATC
CCTTAATCAATCAAAATGGCTGTCACCTTTACAGCACTGGAATGCCACAA
AAATGAATAATTTTTTCTTTAATACAGATATTTTCCAAAATGACCAAGGT
GGCCATTTACGGATATCAAATCTTCTCGGAATATATGAATTTTCATCATT
TTTACAATCGTGCAAGTATCTTACAAAAAGATTAGAAACTACTCAGGAAC
GTATGAAAATTTCACTGAAACCTAATGATAAAGAATTTAAATTGAGAATT
GCTGTAAAATCTGGGAGGTTTAGAAGATATTTTCAGACTAGAATCAAACA
GACGACTCCGTACGGGAATTTATCAATCACCCACAACAAATGGCAGTTCC
ACAACAAAAGCCTTAGTTTTCTAACAATAGATATTTTCAAAATTCGATTA
TTTTTCATGCTTATTGATACGGCACTAATTCTGTACCGGTGCTATTGGAC
CTTCCTTGATATTCGCCAGATGTGGAACCCCAAGAAGCAATTTATCCATC
TCAATCAGATTATATTGAAGGCCAATCATAGCTCGAGTAACGTCCGAACA
AAATCCAGTCTTTTACATTGGACCAAGCATCATCACCTGGAATGCTTGGT
ATCAGCTCATTTGGCAATTGCCGCAATCATTATTCTCCTTTCAATCATTT
GCATGAACTTACTGGTTCTGTTGACGTCACGGGATCATTCAAATTGGTTG
TCAAAAAAAGCCGGATACAGCTTGAGAATTCGTAGCATCAAAGATATCAA
GGAAGAGCTATCGAAATTCAACAACGAGCAAATAAATCCAGTCCATCGGC
ATTGGCAGACTCACAAGTTATCAAGGATCAAACAGTTTATGGATCATAGA
AAAGAAGCGATTAATAGGATAATGTATCTTGAATTGTTTCTCAATCATCA
GTATTTCTATGAGTTGTGTGGTTTACAGAATCTTTCAATTGTTCCTAAAT
TGTCGTTGGATTTCTGCCACTCATTGGTGCCGAACCACGCAATCATTCCA
GACGTCCTTTGCGACCGATCTCTAAAATACGTTCCTTCGCTTTCTTTTGA
TTTATCCTCATACGTTTCCTCCAAATCCGTAATTTACATCTATCAACCCT
TGTATTTAGTCCTCAATATCTTAGCGTTGTTCTTGTTCGCTACCTCTGTG
GTCGGTATTCTGAAAGTGATTCGGAAATCTATGGAACACAAAATTTTCAG
TTTTGGCAAACCAGTTCACATTTTTCTGAGATCTCAACGCCAAATGGTTA
TGGATAATTGGAAAAATCCCAAAGCTTTAATAAAGATGAAAAATTTAACC
ACTATTCCCAATGTCTACAGTAGGAATCTGGAACCCCCCAATCAATATCA
ATGTAAAGGAGACCCCTTTAATGAAACTGTGAATTCTTCGGTGTAATTAT
AATAAATCTTTTTTTAT
back to top

protein sequence of SMED30001299-orf-1

>SMED30001299-orf-1 ID=SMED30001299-orf-1|Name=SMED30001299-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1287bp
MTNSQILFLLVLIGISKTFSKDEKSKFKYPRVQVEHLFSSEGVLVDNLAN
HFPMINLIKLKQQKQHSILEMSPSGNYTIQMYIEIADGVDRFSEVYNEHD
ENRFVLDSHITSDTFHLIKPLKSITENFCKHPLPKGYNIFMDIYNNRETL
AYPTSASGPNSLNHYRSINDECTWEADGKILKSDETFELLDESLNSLYCS
ENSPLLTELFGETVEETETFVSHPKCESARARCTDCQIFKCKTNKCCQLK
SNCLLQDSCLTYYNTSCYRSYEEALYNNKSRCIKGKTYKFTLIPEFDFNT
DKFQCYLKKENLRPKVSVTLDFINRKSKLKLQKRSVKFGGRFPDSNVLQF
NNLQLVFHPSLIDSMDEVIFGKKGFEHFIYPLKPVLKFDQSKPKIHKLFS
KSYIKVQMYRPFLHNTETWSNEKCQVNISGIYKEQEIFEPSSKMPIELVK
KQKMAVTKTKSVFSYQFLPKGLETQKILFQISEKSSLLSLYFCHGQQLHK
PANIKVRVENIDEQNWRLVITGKIIESISYFSLSISPSFSSGETIYRADI
VVSKSSKNLNTSEYFNISFKISNLEPNINESINLLLIDFDQCQRKFFQKS
IFLKFSERLDPMKDSTEIERSVDISNFILVVFLATICICFFYFVLLAFQA
ARKSAIIKNAKNCCSVNKQSKKMNYKLFMKIIFYMTLKLFYTVSFTLSLV
LSVCLSLNVFAIHSINQSNFVARQNVNLNKFPSTEKSDPFCNEIPKLISK
HFLVKIRSQLANQEIVRSLSAQSIQSVSLHILNNISIPRFHNSILEIINK
YQRSLQQQNQLILNSNSRILKSLNQSKWLSPLQHWNATKMNNFFFNTDIF
QNDQGGHLRISNLLGIYEFSSFLQSCKYLTKRLETTQERMKISLKPNDKE
FKLRIAVKSGRFRRYFQTRIKQTTPYGNLSITHNKWQFHNKSLSFLTIDI
FKIRLFFMLIDTALILYRCYWTFLDIRQMWNPKKQFIHLNQIILKANHSS
SNVRTKSSLLHWTKHHHLECLVSAHLAIAAIIILLSIICMNLLVLLTSRD
HSNWLSKKAGYSLRIRSIKDIKEELSKFNNEQINPVHRHWQTHKLSRIKQ
FMDHRKEAINRIMYLELFLNHQYFYELCGLQNLSIVPKLSLDFCHSLVPN
HAIIPDVLCDRSLKYVPSLSFDLSSYVSSKSVIYIYQPLYLVLNILALFL
FATSVVGILKVIRKSMEHKIFSFGKPVHIFLRSQRQMVMDNWKNPKALIK
MKNLTTIPNVYSRNLEPPNQYQCKGDPFNETVNSSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.707
NoneNo IPR availableTMHMMTMhelixcoord: 626..648
NoneNo IPR availableTMHMMTMhelixcoord: 1189..1211
NoneNo IPR availableTMHMMTMhelixcoord: 954..973
NoneNo IPR availableTMHMMTMhelixcoord: 680..702
NoneNo IPR availableTMHMMTMhelixcoord: 1023..1045