Disks large homolog 1

Overview
NameDisks large homolog 1
Smed IDSMED30001292
Length (bp)1067
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Disks large homolog 1 (SMED30001292) t-SNE clustered cells

Violin plots show distribution of expression levels for Disks large homolog 1 (SMED30001292) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Disks large homolog 1 (SMED30001292) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Disks large homolog 1 (SMED30001292) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001292

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30001292h1SMcG0021441 dd_Smed_v4_5092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001292h1SMcG0021441 dd_Smed_v4_5092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001292h1SMcG0021441 dd_Smed_v4_5092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001292h1SMcG0021441 dd_Smed_v4_5092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001292h1SMcG0021441 dd_Smed_v4_5092_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG2 (discs large MAGUK scaffold protein 2 [Source:HGNC Symbol;Acc:HGNC:2901])

HSP 1 Score: 88.9669 bits (219), Expect = 5.458e-20
Identity = 73/217 (33.64%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN  + V + VG+
Sbjct:   10 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSEVVYLKVGK 195          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG2 (discs large MAGUK scaffold protein 2 [Source:HGNC Symbol;Acc:HGNC:2901])

HSP 1 Score: 92.0485 bits (227), Expect = 1.389e-19
Identity = 73/216 (33.80%), Postives = 107/216 (49.54%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                   I ++           +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN  + V + VG+
Sbjct:  235 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR------------------PILETV----------VEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSEVVYLKVGK 420          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG2 (discs large MAGUK scaffold protein 2 [Source:HGNC Symbol;Acc:HGNC:2901])

HSP 1 Score: 91.6633 bits (226), Expect = 1.436e-19
Identity = 73/217 (33.64%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN  + V + VG+
Sbjct:  198 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSEVVYLKVGK 383          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG2 (discs large MAGUK scaffold protein 2 [Source:HGNC Symbol;Acc:HGNC:2901])

HSP 1 Score: 91.6633 bits (226), Expect = 1.622e-19
Identity = 73/217 (33.64%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN  + V + VG+
Sbjct:  132 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSEVVYLKVGK 317          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG2 (discs large MAGUK scaffold protein 2 [Source:HGNC Symbol;Acc:HGNC:2901])

HSP 1 Score: 91.2781 bits (225), Expect = 1.989e-19
Identity = 73/217 (33.64%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN  + V + VG+
Sbjct:   93 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSEVVYLKVGK 278          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 71.633 bits (174), Expect = 1.617e-13
Identity = 64/243 (26.34%), Postives = 113/243 (46.50%), Query Frame = 1
Query:  193 NNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHE----GVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRF 909
            N E++S+  + SQ +  Q    G E +   + + K  KG G + +         D +  T ++HE    G A  DGRLK GD ++ VN      V ++++I+ LR   P + + + R        D N  ++  +  +I + F           E++LVK+   GLGI+I          + +  + +S++   G+A +DGRL  GD IL+V+ +   G    +   +LK    +V + +GR+
Sbjct:   14 NQEELSRKKSFSQER-TQAIENGRETM---IEIDKDGKGLGLSIVGGA------DTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR--------DVNLQLSLLDPTQIYNIF-----------EIDLVKKTGRGLGISI-------VGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW 220          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 72.0182 bits (175), Expect = 2.190e-13
Identity = 64/243 (26.34%), Postives = 113/243 (46.50%), Query Frame = 1
Query:  193 NNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHE----GVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRF 909
            N E++S+  + SQ +  Q    G E +   + + K  KG G + +         D +  T ++HE    G A  DGRLK GD ++ VN      V ++++I+ LR   P + + + R        D N  ++  +  +I + F           E++LVK+   GLGI+I          + +  + +S++   G+A +DGRL  GD IL+V+ +   G    +   +LK    +V + +GR+
Sbjct: 1746 NQEELSRKKSFSQER-TQAIENGRETM---IEIDKDGKGLGLSIVGGA------DTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR--------DVNLQLSLLDPTQIYNIF-----------EIDLVKKTGRGLGISI-------VGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW 1952          

HSP 2 Score: 53.1434 bits (126), Expect = 2.074e-7
Identity = 28/85 (32.94%), Postives = 49/85 (57.65%), Query Frame = 1
Query:  268 W--IFIKVHLKKGRKGFGFAFINDR-SIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLR--NIGP 507
            W  + + +HL K  +G GF+ ++ +   HR++  I +  +V  GVAQ DGR+  GD ++ VN+ D      E+A++ L+   +GP
Sbjct:  619 WNCVPLVIHLCKDSRGLGFSIVDYKDPTHRDESVIVVQSLVPGGVAQADGRVVPGDRLLFVNNHDLSNSSLERAVAVLKAARMGP 703          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 72.0182 bits (175), Expect = 2.268e-13
Identity = 64/243 (26.34%), Postives = 113/243 (46.50%), Query Frame = 1
Query:  193 NNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHE----GVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRF 909
            N E++S+  + SQ +  Q    G E +   + + K  KG G + +         D +  T ++HE    G A  DGRLK GD ++ VN      V ++++I+ LR   P + + + R        D N  ++  +  +I + F           E++LVK+   GLGI+I          + +  + +S++   G+A +DGRL  GD IL+V+ +   G    +   +LK    +V + +GR+
Sbjct: 1728 NQEELSRKKSFSQER-TQAIENGRETM---IEIDKDGKGLGLSIVGGA------DTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR--------DVNLQLSLLDPTQIYNIF-----------EIDLVKKTGRGLGISI-------VGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW 1934          

HSP 2 Score: 53.1434 bits (126), Expect = 2.166e-7
Identity = 28/85 (32.94%), Postives = 49/85 (57.65%), Query Frame = 1
Query:  268 W--IFIKVHLKKGRKGFGFAFINDR-SIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLR--NIGP 507
            W  + + +HL K  +G GF+ ++ +   HR++  I +  +V  GVAQ DGR+  GD ++ VN+ D      E+A++ L+   +GP
Sbjct:  601 WNCVPLVIHLCKDSRGLGFSIVDYKDPTHRDESVIVVQSLVPGGVAQADGRVVPGDRLLFVNNHDLSNSSLERAVAVLKAARMGP 685          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 72.0182 bits (175), Expect = 2.312e-13
Identity = 64/243 (26.34%), Postives = 113/243 (46.50%), Query Frame = 1
Query:  193 NNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHE----GVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRF 909
            N E++S+  + SQ +  Q    G E +   + + K  KG G + +         D +  T ++HE    G A  DGRLK GD ++ VN      V ++++I+ LR   P + + + R        D N  ++  +  +I + F           E++LVK+   GLGI+I          + +  + +S++   G+A +DGRL  GD IL+V+ +   G    +   +LK    +V + +GR+
Sbjct: 1937 NQEELSRKKSFSQER-TQAIENGRETM---IEIDKDGKGLGLSIVGGA------DTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR--------DVNLQLSLLDPTQIYNIF-----------EIDLVKKTGRGLGISI-------VGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW 2143          

HSP 2 Score: 53.1434 bits (126), Expect = 2.261e-7
Identity = 28/85 (32.94%), Postives = 49/85 (57.65%), Query Frame = 1
Query:  268 W--IFIKVHLKKGRKGFGFAFINDR-SIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLR--NIGP 507
            W  + + +HL K  +G GF+ ++ +   HR++  I +  +V  GVAQ DGR+  GD ++ VN+ D      E+A++ L+   +GP
Sbjct:  810 WNCVPLVIHLCKDSRGLGFSIVDYKDPTHRDESVIVVQSLVPGGVAQADGRVVPGDRLLFVNNHDLSNSSLERAVAVLKAARMGP 894          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 72.0182 bits (175), Expect = 2.372e-13
Identity = 64/243 (26.34%), Postives = 113/243 (46.50%), Query Frame = 1
Query:  193 NNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHE----GVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRF 909
            N E++S+  + SQ +  Q    G E +   + + K  KG G + +         D +  T ++HE    G A  DGRLK GD ++ VN      V ++++I+ LR   P + + + R        D N  ++  +  +I + F           E++LVK+   GLGI+I          + +  + +S++   G+A +DGRL  GD IL+V+ +   G    +   +LK    +V + +GR+
Sbjct: 1915 NQEELSRKKSFSQER-TQAIENGRETM---IEIDKDGKGLGLSIVGGA------DTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR--------DVNLQLSLLDPTQIYNIF-----------EIDLVKKTGRGLGISI-------VGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW 2121          

HSP 2 Score: 53.1434 bits (126), Expect = 2.319e-7
Identity = 28/85 (32.94%), Postives = 49/85 (57.65%), Query Frame = 1
Query:  268 W--IFIKVHLKKGRKGFGFAFINDR-SIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLR--NIGP 507
            W  + + +HL K  +G GF+ ++ +   HR++  I +  +V  GVAQ DGR+  GD ++ VN+ D      E+A++ L+   +GP
Sbjct:  788 WNCVPLVIHLCKDSRGLGFSIVDYKDPTHRDESVIVVQSLVPGGVAQADGRVVPGDRLLFVNNHDLSNSSLERAVAVLKAARMGP 872          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0301288)

HSP 1 Score: 74.3294 bits (181), Expect = 4.501e-14
Identity = 71/220 (32.27%), Postives = 109/220 (49.55%), Query Frame = 1
Query:  268 WIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQ-PEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDL----QSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            W++  + L++G  G GF+     D      D +I ITK++  G A  DGRL I DIIVSVNDV   +VP+  A+  L+  G  + + V+R +             P       D+ +S    P+   +E++LVK    GLG +I  G         DN I ++KL   G A  DGRL +GD ++ V      ++ + +TH  AV  LK+   +VT+ +G+
Sbjct:  450 WLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKRKRGTA--------TTPAAGSAAGDARDSAASGPKV--IEIDLVKGG-KGLGFSI-AGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGK 657          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0073484)

HSP 1 Score: 73.9442 bits (180), Expect = 4.807e-14
Identity = 71/220 (32.27%), Postives = 109/220 (49.55%), Query Frame = 1
Query:  268 WIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQ-PEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDL----QSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            W++  + L++G  G GF+     D      D +I ITK++  G A  DGRL I DIIVSVNDV   +VP+  A+  L+  G  + + V+R +             P       D+ +S    P+   +E++LVK    GLG +I  G         DN I ++KL   G A  DGRL +GD ++ V      ++ + +TH  AV  LK+   +VT+ +G+
Sbjct:  509 WLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKRKRGTA--------TTPAAGSAAGDARDSAASGPKV--IEIDLVKGG-KGLGFSI-AGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGK 716          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0073489)

HSP 1 Score: 73.9442 bits (180), Expect = 5.258e-14
Identity = 71/220 (32.27%), Postives = 109/220 (49.55%), Query Frame = 1
Query:  268 WIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQ-PEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDL----QSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            W++  + L++G  G GF+     D      D +I ITK++  G A  DGRL I DIIVSVNDV   +VP+  A+  L+  G  + + V+R +             P       D+ +S    P+   +E++LVK    GLG +I  G         DN I ++KL   G A  DGRL +GD ++ V      ++ + +TH  AV  LK+   +VT+ +G+
Sbjct:   36 WLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKRKRGTA--------TTPAAGSAAGDARDSAASGPKV--IEIDLVKGG-KGLGFSI-AGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGK 243          

HSP 2 Score: 55.0694 bits (131), Expect = 7.170e-8
Identity = 35/104 (33.65%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  247 RDSEGHEWIFIKVHLKKGRKGFGFAF---INDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSV----NDVDFDEVPYEKAISTLRNIGPNLTMTVRRLK 537
            RDS       I++ L KG KG GF+    I ++ I   D+ I +TK++  G AQ DGRL IGD +++V    ++ + + V +E A++TL++I   +T+ + + +
Sbjct:  143 RDSAASGPKVIEIDLVKGGKGLGFSIAGGIGNQHIP-GDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGKTQ 245          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0308089)

HSP 1 Score: 73.9442 bits (180), Expect = 5.258e-14
Identity = 71/220 (32.27%), Postives = 109/220 (49.55%), Query Frame = 1
Query:  268 WIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQ-PEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDL----QSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            W++  + L++G  G GF+     D      D +I ITK++  G A  DGRL I DIIVSVNDV   +VP+  A+  L+  G  + + V+R +             P       D+ +S    P+   +E++LVK    GLG +I  G         DN I ++KL   G A  DGRL +GD ++ V      ++ + +TH  AV  LK+   +VT+ +G+
Sbjct:   36 WLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKRKRGTA--------TTPAAGSAAGDARDSAASGPKV--IEIDLVKGG-KGLGFSI-AGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGK 243          

HSP 2 Score: 55.0694 bits (131), Expect = 7.170e-8
Identity = 35/104 (33.65%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  247 RDSEGHEWIFIKVHLKKGRKGFGFAF---INDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSV----NDVDFDEVPYEKAISTLRNIGPNLTMTVRRLK 537
            RDS       I++ L KG KG GF+    I ++ I   D+ I +TK++  G AQ DGRL IGD +++V    ++ + + V +E A++TL++I   +T+ + + +
Sbjct:  143 RDSAASGPKVIEIDLVKGGKGLGFSIAGGIGNQHIP-GDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGKTQ 245          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0112812)

HSP 1 Score: 73.9442 bits (180), Expect = 5.430e-14
Identity = 71/220 (32.27%), Postives = 109/220 (49.55%), Query Frame = 1
Query:  268 WIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQ-PEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDL----QSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            W++  + L++G  G GF+     D      D +I ITK++  G A  DGRL I DIIVSVNDV   +VP+  A+  L+  G  + + V+R +             P       D+ +S    P+   +E++LVK    GLG +I  G         DN I ++KL   G A  DGRL +GD ++ V      ++ + +TH  AV  LK+   +VT+ +G+
Sbjct:  153 WLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKRKRGTA--------TTPAAGSAAGDARDSAASGPKV--IEIDLVKGG-KGLGFSI-AGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGK 360          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 90.5077 bits (223), Expect = 2.285e-19
Identity = 87/273 (31.87%), Postives = 119/273 (43.59%), Query Frame = 1
Query:  193 NNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQDARHLRDR*SEINGENLLTLPRIYSLIV 1005
            N   I  N  S     Y   S+G  + + ++ L++G  G GF+     D     +D  I ITKI+  G A  DGRL + D ++ VNDVD  EV + KA+  L+  GP + + VRR +             PP                   LEVNL+K    GLG +I  G         DN I I+K+   G A  DGRLQ GD +L V+      + H EAV  LKN    V + V     K    HL D  +  +  + L LP  +  +V
Sbjct:  122 NPPPIIVNADSLDAGPYVNGSDGM-YKYEEIILERGNSGLGFSIAGGMDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSKAVEALKEAGPVVRLLVRRRQA------------PPETI----------------LEVNLLK-GPKGLGFSI-AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVA----KPGPVHLNDMYAPPDYSSSLGLPPAFPTMV 359          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: patj (PATJ crumbs cell polarity complex component [Source:ZFIN;Acc:ZDB-GENE-030616-129])

HSP 1 Score: 90.5077 bits (223), Expect = 2.927e-19
Identity = 76/239 (31.80%), Postives = 107/239 (44.77%), Query Frame = 1
Query:  283 VHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYE--------------------ISD--------------------SFESDDQPEFQQLEV-NLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNC 876
            + + KGR G G + +  +      DAI I ++  EG A +DGRL  GD I+ VN VD   V +E AI+ LR   P + +TV R  E  Y  +EN D+ P    +                    ISD                    S + +D  +  Q  V  ++K     LGI+I      +     D  I I+ +  NGVAA   RL+VGD I+ ++ QS DGLTH + V +LKN 
Sbjct: 1468 IEISKGRSGLGLSIVGGKDTQL--DAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPPKVRLTVLR-DEAQYRDEENLDVFPVELQKKTGRGLGLSIVGKRNGKGVFISDVVKGGAADLDGRLMQGDQILSVDGEDMRQASQETVAAILKGPTDALGISI---AGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNA 1700          

HSP 2 Score: 57.3806 bits (137), Expect = 2.002e-8
Identity = 62/211 (29.38%), Postives = 93/211 (44.08%), Query Frame = 1
Query:  289 LKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVK-------RAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFV 900
            LK      G +    +     D  I I  I   GVA +  RLK+GD IVS+N    D + +   ++ L+N    + + V         +D N          +S S      PE + +E    K       +   GLG +I GG+ + + D     I +  +   G AA DGRL+ GD +L V+ +S +G+TH +AV ILK     VT+ V
Sbjct: 1630 LKGPTDALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYGAIILQVV--------ADTNISAIASQVESLSSSSAPSTNPEVRLVEPETPKPKSITLEKGSEGLGFSIVGGFGSPHGDLP---IYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1829          

HSP 3 Score: 50.0618 bits (118), Expect = 3.405e-6
Identity = 26/81 (32.10%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  283 VHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTV 525
            + L+KG +G GF+ +        D  I +  +  +G A  DGRLK GD ++SVN    + V +E+A++ L+    ++T++V
Sbjct: 1749 ITLEKGSEGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1829          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: patj (PATJ crumbs cell polarity complex component [Source:ZFIN;Acc:ZDB-GENE-030616-129])

HSP 1 Score: 90.5077 bits (223), Expect = 2.927e-19
Identity = 76/239 (31.80%), Postives = 107/239 (44.77%), Query Frame = 1
Query:  283 VHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYE--------------------ISD--------------------SFESDDQPEFQQLEV-NLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNC 876
            + + KGR G G + +  +      DAI I ++  EG A +DGRL  GD I+ VN VD   V +E AI+ LR   P + +TV R  E  Y  +EN D+ P    +                    ISD                    S + +D  +  Q  V  ++K     LGI+I      +     D  I I+ +  NGVAA   RL+VGD I+ ++ QS DGLTH + V +LKN 
Sbjct: 1468 IEISKGRSGLGLSIVGGKDTQL--DAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPPKVRLTVLR-DEAQYRDEENLDVFPVELQKKTGRGLGLSIVGKRNGKGVFISDVVKGGAADLDGRLMQGDQILSVDGEDMRQASQETVAAILKGPTDALGISI---AGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNA 1700          

HSP 2 Score: 57.3806 bits (137), Expect = 2.002e-8
Identity = 62/211 (29.38%), Postives = 93/211 (44.08%), Query Frame = 1
Query:  289 LKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVK-------RAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFV 900
            LK      G +    +     D  I I  I   GVA +  RLK+GD IVS+N    D + +   ++ L+N    + + V         +D N          +S S      PE + +E    K       +   GLG +I GG+ + + D     I +  +   G AA DGRL+ GD +L V+ +S +G+TH +AV ILK     VT+ V
Sbjct: 1630 LKGPTDALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYGAIILQVV--------ADTNISAIASQVESLSSSSAPSTNPEVRLVEPETPKPKSITLEKGSEGLGFSIVGGFGSPHGDLP---IYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1829          

HSP 3 Score: 50.0618 bits (118), Expect = 3.405e-6
Identity = 26/81 (32.10%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  283 VHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTV 525
            + L+KG +G GF+ +        D  I +  +  +G A  DGRLK GD ++SVN    + V +E+A++ L+    ++T++V
Sbjct: 1749 ITLEKGSEGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1829          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg2 (discs, large homolog 2 (Drosophila) [Source:NCBI gene;Acc:497638])

HSP 1 Score: 90.1225 bits (222), Expect = 3.408e-19
Identity = 71/217 (32.72%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQL-EVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+ D  EV + KA+  L+  G  + + VRR +                             P  + + E+ L+K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  + + +TH EAV ILKN    V + VG+
Sbjct:  131 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNESDVSEVSHSKAVEALKAAGSIVRLYVRRRR-----------------------------PMLETVTEIKLIK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYTLEEVTHEEAVAILKNTSDVVYLKVGK 316          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 89.7373 bits (221), Expect = 4.276e-19
Identity = 80/241 (33.20%), Postives = 107/241 (44.40%), Query Frame = 1
Query:  289 LKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQDARHLRDR*SEINGENLLTLPRIYSLIV 1005
            L++G  G GF+     D     +D  I ITKI+  G A  DGRL + D ++ VNDVD  EV + KA+  L+  GP + + VRR +             PP                   LEVNL+K    GLG +I  G         DN I I+K+   G A  DGRLQ GD +L V+      + H EAV  LKN    V + V     K    HL D  +  +  + L LP  +  +V
Sbjct:  135 LERGNSGLGFSIAGGMDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSKAVEALKEAGPVVRLLVRRRQA------------PPETI----------------LEVNLLK-GPKGLGFSI-AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVA----KPGPVHLNDMYAPPDYSSSLGLPPAFPTMV 341          

HSP 2 Score: 71.633 bits (174), Expect = 4.292e-13
Identity = 68/253 (26.88%), Postives = 113/253 (44.66%), Query Frame = 1
Query:  274 FIKVHLKKGRKGFGFAF---INDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRR-----LKEYCYESDENDDMNPPNAYEI----------SDSFES--DDQPEFQQLEVN------------------------LVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFV 900
             ++V+L KG KG GF+    I ++ I   D++I ITKI+  G AQ+DGRL+ GD +++VN++   +V +E+A++ L+N    + + V +     L +     D +  +  P A+            S ++    + +P +Q  +V                         L+ +   GLG NI          E+   I +S +   G A   G L+ GD IL V+  +    TH +A   LK  G+ VTI  
Sbjct:  225 ILEVNLLKGPKGLGFSIAGGIGNQHI-PGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSSLGLPPAFPTMVDNHVGHNSSMAYMGGMEPKPVYQPPQVTPSRYSPVPRHMLGEEDFTREPRKILLHKGSTGLGFNI-------VGGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIA 469          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hmmr (hyaluronan-mediated motility receptor (RHAMM) [Source:Xenbase;Acc:XB-GENE-5851601])

HSP 1 Score: 89.3521 bits (220), Expect = 8.868e-19
Identity = 71/208 (34.13%), Postives = 98/208 (47.12%), Query Frame = 1
Query:  289 LKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            L++G  G GF+     D     +D  I ITKI+  G A  DGRL + D ++ VNDVD  EV + KA+  L+  GP + + VRR +            +PP                   +EVNL+K    GLG +I  G         DN I I+K+   G A  DGRLQ+GD +L V+  +   + H EAV  LKN    V + V +
Sbjct:  143 LERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLSVSDCVLRVNDVDVTEVVHSKAVEALKEAGPVVRLLVRRRQ------------SPPETI----------------VEVNLLK-GPKGLGFSI-AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAK 320          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hmmr (hyaluronan-mediated motility receptor (RHAMM) [Source:Xenbase;Acc:XB-GENE-5851601])

HSP 1 Score: 89.3521 bits (220), Expect = 9.084e-19
Identity = 71/208 (34.13%), Postives = 98/208 (47.12%), Query Frame = 1
Query:  289 LKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            L++G  G GF+     D     +D  I ITKI+  G A  DGRL + D ++ VNDVD  EV + KA+  L+  GP + + VRR +            +PP                   +EVNL+K    GLG +I  G         DN I I+K+   G A  DGRLQ+GD +L V+  +   + H EAV  LKN    V + V +
Sbjct:  143 LERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLSVSDCVLRVNDVDVTEVVHSKAVEALKEAGPVVRLLVRRRQ------------SPPETI----------------VEVNLLK-GPKGLGFSI-AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAK 320          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hjv (hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB-GENE-922976])

HSP 1 Score: 88.9669 bits (219), Expect = 1.011e-18
Identity = 72/217 (33.18%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + +A+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN    V + VG+
Sbjct:  100 EYEFEEITLERGNSGLGFSIAGGIDNPHVGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSRAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGK 285          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hmmr (hyaluronan-mediated motility receptor (RHAMM) [Source:Xenbase;Acc:XB-GENE-5851601])

HSP 1 Score: 88.5817 bits (218), Expect = 1.351e-18
Identity = 71/215 (33.02%), Postives = 102/215 (47.44%), Query Frame = 1
Query:  268 WIFIKVHLKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            + + ++ L++G  G GF+     D     +D  I ITKI+  G A  DGRL + D ++ VNDVD  EV + KA+  L+  GP + + VRR +            +PP                   +EVNL+K    GLG +I  G         DN I I+K+   G A  DGRLQ+GD +L V+  +   + H EAV  LKN    V + V +
Sbjct:   50 YKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLSVSDCVLRVNDVDVTEVVHSKAVEALKEAGPVVRLLVRRRQ------------SPPETI----------------VEVNLLK-GPKGLGFSI-AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAK 234          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hmmr (hyaluronan-mediated motility receptor (RHAMM) [Source:Xenbase;Acc:XB-GENE-5851601])

HSP 1 Score: 88.5817 bits (218), Expect = 1.546e-18
Identity = 71/215 (33.02%), Postives = 102/215 (47.44%), Query Frame = 1
Query:  268 WIFIKVHLKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            + + ++ L++G  G GF+     D     +D  I ITKI+  G A  DGRL + D ++ VNDVD  EV + KA+  L+  GP + + VRR +            +PP                   +EVNL+K    GLG +I  G         DN I I+K+   G A  DGRLQ+GD +L V+  +   + H EAV  LKN    V + V +
Sbjct:   50 YKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLSVSDCVLRVNDVDVTEVVHSKAVEALKEAGPVVRLLVRRRQ------------SPPETI----------------VEVNLLK-GPKGLGFSI-AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAK 234          

HSP 2 Score: 76.6406 bits (187), Expect = 1.216e-14
Identity = 73/225 (32.44%), Postives = 112/225 (49.78%), Query Frame = 1
Query:  277 IKVHLKKGRKGFGFAF---INDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRR-----LKE-YC---YESDENDDMNPPNAYEISDSF-------ESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTI 894
            ++V+L KG KG GF+    I ++ I   D++I ITKI+  G AQ+DGRL+IGD +++VN+ +  +V +E+A++ L+N    + + V +     L E Y    Y S       PP       S        E D   E +++   ++ +   GLG NI GG + E        I +S +   G A   G L+ GD IL V+  +    TH +A   LK  G+ VTI
Sbjct:  148 VEVNLLKGPKGLGFSIAGGIGNQHIP-GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNEIYAPPDYASSNKSPYPPPQVTPSRFSPVPRHMLGEEDFTREPRKI---ILHKGSTGLGFNIVGGEDGEG-------IFVSFILAGGPADLSGELRRGDRILSVNGVNLRSATHEQAAAALKRAGQTVTI 361          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg2 (discs large MAGUK scaffold protein 2 [Source:MGI Symbol;Acc:MGI:1344351])

HSP 1 Score: 90.8929 bits (224), Expect = 1.874e-19
Identity = 73/217 (33.64%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN    V + VG+
Sbjct:  128 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGK 313          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg2 (discs large MAGUK scaffold protein 2 [Source:MGI Symbol;Acc:MGI:1344351])

HSP 1 Score: 90.8929 bits (224), Expect = 1.927e-19
Identity = 73/217 (33.64%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN    V + VG+
Sbjct:  235 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGK 420          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg2 (discs large MAGUK scaffold protein 2 [Source:MGI Symbol;Acc:MGI:1344351])

HSP 1 Score: 90.5077 bits (223), Expect = 2.414e-19
Identity = 73/217 (33.64%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN    V + VG+
Sbjct:  128 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGK 313          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg2 (discs large MAGUK scaffold protein 2 [Source:MGI Symbol;Acc:MGI:1344351])

HSP 1 Score: 90.5077 bits (223), Expect = 2.462e-19
Identity = 73/217 (33.64%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN    V + VG+
Sbjct:   93 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGK 278          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg2 (discs large MAGUK scaffold protein 2 [Source:MGI Symbol;Acc:MGI:1344351])

HSP 1 Score: 90.5077 bits (223), Expect = 2.752e-19
Identity = 73/217 (33.64%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN    V + VG+
Sbjct:   93 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGK 278          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q15700|DLG2_HUMAN (Disks large homolog 2 OS=Homo sapiens OX=9606 GN=DLG2 PE=1 SV=3)

HSP 1 Score: 91.2781 bits (225), Expect = 9.551e-19
Identity = 73/217 (33.64%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN  + V + VG+
Sbjct:   93 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSEVVYLKVGK 278          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q91XM9|DLG2_MOUSE (Disks large homolog 2 OS=Mus musculus OX=10090 GN=Dlg2 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 1.925e-18
Identity = 73/217 (33.64%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN    V + VG+
Sbjct:   93 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGK 278          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q63622|DLG2_RAT (Disks large homolog 2 OS=Rattus norvegicus OX=10116 GN=Dlg2 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.357e-18
Identity = 73/217 (33.64%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + KA+  L+  G  + + VRR +                             P  +  +E+ L K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  S + +TH EAV ILKN    V + VG+
Sbjct:   93 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRR-----------------------------PILETVVEIKLFK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGK 278          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q5PYH7|DLG2_DANRE (Disks large homolog 2 OS=Danio rerio OX=7955 GN=dlg2 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.238e-18
Identity = 71/217 (32.72%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQL-EVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+ D  EV + KA+  L+  G  + + VRR +                             P  + + E+ L+K    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  + + +TH EAV ILKN    V + VG+
Sbjct:  150 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNESDVSEVSHSKAVEALKAAGSIVRLYVRRRR-----------------------------PMLETVTEIKLIK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYTLEEVTHEEAVAILKNTSDVVYLKVGK 335          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q5PYH6|DLG1_DANRE (Disks large homolog 1 OS=Danio rerio OX=7955 GN=dlg1 PE=2 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 5.759e-18
Identity = 79/250 (31.60%), Postives = 115/250 (46.00%), Query Frame = 1
Query:  163 GILREPPESRNNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
             I+  P    +   +  NT S     Y   +E  ++ + ++ L++G  G GF+     D     ED +I ITKI+  G A QDGRL++ D I+ VNDVD  +V +  A+  L+  G  + + VRR K              P + +I D              V LVK    GLG +I  G         DN I I+K+   G A  DGRLQ+GD +L V+    + +TH +AV  LKN    V + V +
Sbjct:  192 AIIPAPASQASPAPVVVNTESLDSSPYVNGTEA-DYEYEEITLERGNSGLGFSIAGGTDNPHIGEDPSIFITKIIPGGAAAQDGRLRVNDCILRVNDVDVRDVTHSNAVEALKEAGCIVRLYVRRRK--------------PLSEKIMD--------------VKLVK-GPKGLGFSI-AGGVGNQHIPGDNSIYITKIIEGGAAHKDGRLQIGDKLLAVNAVCLEEVTHEDAVAALKNTPDVVYLKVAK 410          

HSP 2 Score: 75.485 bits (184), Expect = 1.668e-13
Identity = 72/238 (30.25%), Postives = 108/238 (45.38%), Query Frame = 1
Query:  274 FIKVHLKKGRKGFGFAF---INDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIG---------------------PNLTMTVRRLKE-----YCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFV 900
             + V L KG KG GF+    + ++ I   D++I ITKI+  G A +DGRL+IGD +++VN V  +EV +E A++ L+N                       P++T +  +  E       Y S       P     +S     DD+   +  ++ ++ R   GLG NI GG + E        I IS +   G A   G L+ GD I+ V+       TH +A   LKN G+ VTI  
Sbjct:  323 IMDVKLVKGPKGLGFSIAGGVGNQHI-PGDNSIYITKIIEGGAAHKDGRLQIGDKLLAVNAVCLEEVTHEDAVAALKNTPDVVYLKVAKPTSVFMNDSYAPPDVTSSYSQHMENHISTQSYLSQPLTPATPSRYSPVSKGMLGDDEITREPRKI-VLHRGTTGLGFNIVGGEDGEG-------IFISFILAGGPADLCGELRKGDRIVSVNGVDLRSATHEQAAAALKNAGQTVTIIA 551          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A5K3F3U2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 9.672e-22
Identity = 75/248 (30.24%), Postives = 119/248 (47.98%), Query Frame = 1
Query:  181 PESRNNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKG---RKGFGFAFINDRSIHRE--DDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVG-GLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            PE  N       + +  R+D     E  EW +I+V + +     + FGF+        +E  D +I +T++   G+A+ D RL+  D I+SVN  D   V  ++A+  LR  G  L M +RR       S E D  +P +A  + D   + D   +   E NLVK +   GLG  I      +  +     I ++K+   G+A  DG++Q GD ++QV+ Q  DG TH +AV +L+  G  V + + R
Sbjct:   37 PEDFNPTNSRTPSLAPGREDLMSPVESSEWEYIEVVISRPAGQNQSFGFSIAGGYDAPQENGDPSIYVTRLAPGGIAELDNRLRPFDQIISVNGTDLTCVSNQEAVKILRESGDTLAMIIRRFSGAEVVSSEGDPYSPMSAENVQDDERTLDDDLY--YEANLVKPSASVGLGFTI---AGGQVAEGGPEGIFVTKITPGGLAEKDGQIQPGDRLIQVNGQKLDGATHEDAVHLLRTAGTYVHLVLSR 279          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A5K3F109 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.775e-21
Identity = 75/248 (30.24%), Postives = 119/248 (47.98%), Query Frame = 1
Query:  181 PESRNNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKG---RKGFGFAFINDRSIHRE--DDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVG-GLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            PE  N       + +  R+D     E  EW +I+V + +     + FGF+        +E  D +I +T++   G+A+ D RL+  D I+SVN  D   V  ++A+  LR  G  L M +RR       S E D  +P +A  + D   + D   +   E NLVK +   GLG  I      +  +     I ++K+   G+A  DG++Q GD ++QV+ Q  DG TH +AV +L+  G  V + + R
Sbjct:   78 PEDFNPTNSRTPSLAPGREDLMSPVESSEWEYIEVVISRPAGQNQSFGFSIAGGYDAPQENGDPSIYVTRLAPGGIAELDNRLRPFDQIISVNGTDLTCVSNQEAVKILRESGDTLAMIIRRFSGAEVVSSEGDPYSPMSAENVQDDERTLDDDLY--YEANLVKPSASVGLGFTI---AGGQVAEGGPEGIFVTKITPGGLAEKDGQIQPGDRLIQVNGQKLDGATHEDAVHLLRTAGTYVHLVLSR 320          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A3P6H738 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS938 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 4.635e-20
Identity = 71/229 (31.00%), Postives = 112/229 (48.91%), Query Frame = 1
Query:  238 DYQRDSEGHEWIFIKVHLKKG---RKGFGFAFINDRSIHRE--DDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVG-GLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            D     E  EW +I+V + +     + FGF+        +E  D +I +T++   G+A+ D RL+  D I+SVN  D   V  ++A+  LR  G  L M +RR       S E D  +P +A  + D   + D   +   E NLVK +   GLG  I      +  +     I ++K+   G+A  DG++Q GD ++QV+ Q  DG TH +AV +L+  G  V + + R
Sbjct:   51 DLMSPVESSEWEYIEVVISRPAGQNQSFGFSIAGGYDAPQENGDPSIYVTRLAPGGIAELDNRLRPFDQIISVNGTDLTCVSNQEAVKILRESGDTLAMIIRRFSGAEVVSSEGDPYSPMSAENVQDDERTLDDDLY--YEANLVKPSASVGLGFTI---AGGQVAEGGPEGIFVTKITPGGLAEKDGQIQPGDRLIQVNGQKLDGATHEDAVHLLRTAGTYVHLVLSR 274          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A3S3PPP9 (Uncharacterized protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_05294 PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 6.785e-19
Identity = 76/220 (34.55%), Postives = 108/220 (49.09%), Query Frame = 1
Query:  253 SEGHEWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEF--QQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFV 900
            S    W F ++ L++G  G GF+     D     +D++I ITK++  G A  DGRL++ DII+ VNDVD  EVP+  A+  L+  G  + + V+R KE  Y                     S  QP    Q L + L+K    GLG +I  G         DN I ++K+  NG A  DGRL VGD ++ V+ ++ D +TH EAV  LK     V + V
Sbjct:  272 SSPSSWEFEEIILERGNAGLGFSIAGGTDNPHKADDNSIYITKLIPGGAASADGRLQVEDIILKVNDVDLVEVPHSVAVEGLKKAGNRVHLLVKRRKEPQY------------------FHHSPQQPPLTSQVLNIELLK-GNKGLGFSI-AGGIGNQHVPGDNGIYVTKIMENGAAHLDGRLDVGDKLIAVNGKNLDNVTHEEAVATLKATSDRVLLTV 471          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A504YZ91 (Disks large 1 OS=Fasciola gigantica OX=46835 GN=FGIG_09486 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.011e-18
Identity = 79/257 (30.74%), Postives = 130/257 (50.58%), Query Frame = 1
Query:  217 TASSQRKDYQRDSEGH-EWIFIKVHLKKGR---KGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRR-LKEYCYESDENDDMNP------------PNAYEISDSFESDDQPEFQQLEVNLVK-RAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQDA 927
            TASS R+     +    EW +++V LK+      GFGF+     D  I   D  I +T+I   GVA  DGRL++ D I++VN +  + V   +A+ TLR  G +L + VRR L      +  +    P            P     S+ +  +D   F   EV L K  A  GLG +I GG + +++   ++ I I+++  +G+A  DGR+  GD ++QV+      L+H EAV++L+N G+ V + + R+ +  ++
Sbjct:   90 TASSDRRSSDEPTLVQPEWEYLEVILKRDADTLGGFGFSIAGGIDVPISDMDSGIYVTRINANGVADLDGRLRVDDQILAVNGISLEHVTNAEAVQTLRRGGNSLHLVVRRYLGNPTGVASSHSATTPKSTRPTSSTVRTPEVLSESEDYRGEDPVWF---EVELRKPNATSGLGFSISGGRSEDDDQIPESGIYITRVNPDGLAFQDGRIMPGDQLMQVNGIDMSQLSHAEAVQVLRNAGQVVHLLLARYPQSTES 343          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg2 (discs, large homolog 2 (Drosophila) [Source:NCBI gene;Acc:497638])

HSP 1 Score: 91.2781 bits (225), Expect = 1.173e-19
Identity = 72/217 (33.18%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + +A+  L+  G  + + VRR +                             P  +  +E+ LVK    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  + + +TH EAV ILKN    V + VG+
Sbjct:  203 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSRAVEALKVAGSIVRLYVRRRR-----------------------------PMLETVVEIKLVK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYTLEEVTHEEAVAILKNTADVVYLKVGK 388          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg2 (discs, large homolog 2 (Drosophila) [Source:NCBI gene;Acc:497638])

HSP 1 Score: 90.8929 bits (224), Expect = 1.563e-19
Identity = 72/217 (33.18%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + +A+  L+  G  + + VRR +                             P  +  +E+ LVK    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  + + +TH EAV ILKN    V + VG+
Sbjct:  195 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSRAVEALKVAGSIVRLYVRRRR-----------------------------PMLETVVEIKLVK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYTLEEVTHEEAVAILKNTADVVYLKVGK 380          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg2 (discs, large homolog 2 (Drosophila) [Source:NCBI gene;Acc:497638])

HSP 1 Score: 90.5077 bits (223), Expect = 2.277e-19
Identity = 72/217 (33.18%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + +A+  L+  G  + + VRR +                             P  +  +E+ LVK    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  + + +TH EAV ILKN    V + VG+
Sbjct:  120 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSRAVEALKVAGSIVRLYVRRRR-----------------------------PMLETVVEIKLVK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYTLEEVTHEEAVAILKNTADVVYLKVGK 305          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: ENSAMXT00000052301.1 (discs large homolog 1-like protein [Source:NCBI gene;Acc:103032064])

HSP 1 Score: 90.5077 bits (223), Expect = 2.333e-19
Identity = 76/246 (30.89%), Postives = 117/246 (47.56%), Query Frame = 1
Query:  178 PPESRNNEK-ISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            PP S+ N   +  NT S     Y   +E  ++ + ++ L++G  G GF+     D     ED +I ITK++  G A QDGRL++ D+I+ VN+VD  +V + KA+  L+  G  + + VRR K                   +S+            +E+ LVK    GLG +I  G         DN I ++K+   G A  DGRLQ+GD ++ V+    + +TH  AV  LKN    V + V +
Sbjct:  182 PPTSQANPPPVVVNTESLDSAPYVNGTEA-DYEYEEITLERGNSGLGFSIAGGTDNPHIGEDPSIFITKVIPGGAAAQDGRLQVNDVILRVNEVDVRDVTHSKAVEALKEAGSLVRLYVRRRK------------------SVSEKV----------VEIKLVK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLMAVNSACLEEVTHEHAVTALKNTTDVVYLKVAK 396          

HSP 2 Score: 77.7962 bits (190), Expect = 2.787e-15
Identity = 65/234 (27.78%), Postives = 107/234 (45.73%), Query Frame = 1
Query:  277 IKVHLKKGRKGFGFAF---INDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEY-------------CYESDENDDMNPPN------AYEISDSFESDDQPEFQQLEVN------LVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTI 894
            +++ L KG KG GF+    + ++ I   D++I +TKI+  G A +DGRL+IGD +++VN    +EV +E A++ L+N    + + V +                  Y     + ++PPN          S  F    +P   + +++      ++ R   GLG NI          E+   I IS +   G A   G L+ GD ++ V+       TH +A   LKN G+ VTI
Sbjct:  310 VEIKLVKGPKGLGFSIAGGVGNQHI-PGDNSIYVTKIIEGGAAHKDGRLQIGDKLMAVNSACLEEVTHEHAVTALKNTTDVVYLKVAKPNSVFMNDSFAPPDITNSYSQHMENHISPPNFLSQPLPPAPSGRFSPTPKPSHGEEDLSREPRKVVLHRGATGLGFNI-------VGGEDGEGIFISFILAGGPADLSGELRKGDRLVSVNGVDLRSATHEQAAAALKNAGQTVTI 535          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg2 (discs, large homolog 2 (Drosophila) [Source:NCBI gene;Acc:497638])

HSP 1 Score: 90.1225 bits (222), Expect = 2.589e-19
Identity = 72/217 (33.18%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQ-LEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            E+ F ++ L++G  G GF+     D     +D  I ITKI+  G A +DGRL++ D I+ VN+VD  EV + +A+  L+  G  + + VRR +                             P  +  +E+ LVK    GLG +I  G         DN I ++K+   G A  DGRLQVGD +L V+  + + +TH EAV ILKN    V + VG+
Sbjct:  128 EYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSRAVEALKVAGSIVRLYVRRRR-----------------------------PMLETVVEIKLVK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYTLEEVTHEEAVAILKNTADVVYLKVGK 313          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002205.1 (pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 gene:ENSPMAG00000001988.1 transcript:ENSPMAT00000002205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 4.206e-15
Identity = 57/208 (27.40%), Postives = 99/208 (47.60%), Query Frame = 1
Query:  277 IKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGP--NLTMTVRR----LKEYCYESDENDDMNPPNAYEISDSF--ESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNC 876
             +V L+KG +G GF+  +  +       + I  I+  G A  DGRL  GD ++ VN VD   +  ++ +S LR + P  ++ + V R    L     E+     M+P    E S      +    E   LE+ L +    GLG++++G  + +   +    I +  +   G AA DGRL++GD ++ V+ +   G ++  A+E L+ C
Sbjct:  386 FRVQLQKGPEGLGFSLTSRDTPVSGLGHVYIKHILPRGAAIADGRLHAGDRLIMVNGVDVSSMSQDQVVSILRGVHPGSSVDLLVSRHDALLTPPAQEARLVKQMHPDQQAERSGGMIVTASGPCECLNLEIALSECGPAGLGVSVKGNRSRDGAHDLG--IYVKSIIAGGAAAKDGRLRIGDQLVAVNREPLLGRSNAAAMETLRRC 591          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006056.1 (pep scaffold:Pmarinus_7.0:GL477535:225:55869:1 gene:ENSPMAG00000005437.1 transcript:ENSPMAT00000006056.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 2.680e-14
Identity = 61/205 (29.76%), Postives = 96/205 (46.83%), Query Frame = 1
Query:  277 IKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRN--IGPNLTMTVRRLKEYCYESDENDDMNPP----NAYEISDSFES-DDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILK 870
            I +HLKKG  G GF      +       I +  I+ +G A  DGRLK GD ++ VN +D      E+ ++ LR+  +G ++ + V R  +     D+   +N      +A E  D   S D   EF  L + L       LG+++      +     D  I I  +   G AA DGRL+V D ++ V+ +S  G ++ EA+E L+
Sbjct:  413 IPIHLKKGLDGLGFTIATRDTPVGGRTPIYVKSIMSKGAALSDGRLKSGDRLLEVNGLDVTSRTQEEVVAILRSTKLGGSVDLLVSRHHDVPLSPDDPAGLNSRVWRCSAAEEEDRLLSPDGSREFLTLHIPLHDMGAASLGVSV--KGTKDRRTNADLGIFIKTIIAGGAAAKDGRLRVDDQLIAVNRESLLGRSNLEAMESLR 615          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004677.1 (pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 gene:ENSPMAG00000004260.1 transcript:ENSPMAT00000004677.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 2.636e-13
Identity = 56/184 (30.43%), Postives = 79/184 (42.93%), Query Frame = 1
Query:  358 AISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRF 909
            AI I ++  EG A +DGRL  GD I+ VN  D     +E AI+ LR   P L      ++ Y Y  +                +  DD+       V L+K+A  GLG++I G  +          + +S++   G A  DGRL  GD IL VD +     +      ILK     V + VGR 
Sbjct:    3 AIMIHEVYEEGAAAKDGRLWAGDQILKVNGTDLRSATHEDAINALRA-SPQL------VRLYVYRDEAR--------------YRGDDESALHVFTVELLKKAGRGLGLSIVGKKSGNG-------VFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILKCAQGVVKMEVGRM 158          

HSP 2 Score: 50.0618 bits (118), Expect = 1.155e-7
Identity = 30/99 (30.30%), Postives = 49/99 (49.49%), Query Frame = 1
Query:  241 YQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLK 537
            Y+ D E    +F    LKK  +G G + +  +S     + + ++++VH G A+ DGRL  GD I+SV+  D      E   + L+     + M V R+K
Sbjct:   65 YRGDDESALHVFTVELLKKAGRGLGLSIVGKKS----GNGVFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILKCAQGVVKMEVGRMK 159          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 59.3066 bits (142), Expect = 5.774e-10
Identity = 61/219 (27.85%), Postives = 105/219 (47.95%), Query Frame = 1
Query:  271 IFIKVHLKKGRKGFGFAFINDRSIHR-EDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDE---NDDMNPPNAYEISD-SFESDDQPEF--QQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            I I V+ K G  G   A     + ++ ED+ I I+++  EG A   G +++GD ++ VN V   +  +++A+S L+N G  + + V  L+E   E +         PP     S  +F  + +P    +QL V L+ R   GLG +I GG  +       + I IS++A  G A  +G + V D +L ++        H +AV +L +    +T+ + R
Sbjct:  541 IKIVVYRKTGGLGISIAGGKGSTPYKGEDEGIFISRVSDEGPAGIAG-VRVGDKLLQVNGVVLVDAEHQEAVSALKNSGSVMELLV--LRERMVEPEHAVLTTPAQPPLRERRSAVTFAPEPEPTVMREQLSVRLL-RNERGLGFSIAGGKGSTPFKGSHSGIFISRIAEGGTADLEGTMAVADRVLAINGVDMTEARHDQAVALLTSSATSITMLLQR 755          

HSP 2 Score: 47.7506 bits (112), Expect = 2.669e-6
Identity = 56/226 (24.78%), Postives = 101/226 (44.69%), Query Frame = 1
Query:  277 IKVHLKKGRKGFGFAFINDR---SIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSF-------------ESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXX--XXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFV 900
            + V L +  +G GF+    +           I I++I   G A  +G + + D ++++N VD  E  +++A++ L +   ++TM ++R +   ++         P  Y +S                E ++ P +   E+ L+K   G LG++I GG +  +     +   I ISK+  +G AA    ++VGD IL V+       TH EAV  L      + +FV
Sbjct:  668 LSVRLLRNERGLGFSIAGGKGSTPFKGSHSGIFISRIAEGGTADLEGTMAVADRVLAINGVDMTEARHDQAVALLTSSATSITMLLQREQAQGHKPPGRPSSP-PPGYPLSPDEEDGDEEDGSNHVSEQEEHP-YPVEEIVLLKTD-GPLGLSIVGGSDHSSHPFGIDKPGIFISKIIADGQAAKT-NMRVGDRILSVNGLDVRHCTHQEAVCALLGGKPAIHMFV 889          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005746.1 (pep scaffold:Pmarinus_7.0:GL479493:17594:33348:1 gene:ENSPMAG00000005206.1 transcript:ENSPMAT00000005746.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 5.450e-8
Identity = 51/210 (24.29%), Postives = 88/210 (41.90%), Query Frame = 1
Query:  280 KVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSF-----ESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTI 894
             + L     G GF  + +R+       I +  I+  GVA +DGRL  GD I+S+ D+D      E+ IS LR  G  + + V        E  E     P  A   +  +     + +   +  ++    + +   GLGIN+           ++  I +  +    +A  DGR+ V D I+ VD      L+  +A+ +L + G+ V +
Sbjct:  197 SIELVTTGSGMGFGIVGNRA-----TGIIVKTILPGGVADRDGRLCTGDRILSIGDMDVRGKGSEEVISILRQCGSRVHLLVAH-----GEPGEQLPATPSPALAQTPPYLPPVVDEEGVDDDVEVYDVELTKGGHGLGINL-------TSTGDNTGIVVRSMVPGSLAERDGRIGVDDQIVAVDGIFIGALSSTDALSLLCSTGRTVCL 389          

HSP 2 Score: 50.8322 bits (120), Expect = 2.190e-7
Identity = 58/226 (25.66%), Postives = 87/226 (38.50%), Query Frame = 1
Query:  265 EWIFIKVHLKKGRK------------GFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDE-VPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVG-GLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFV 900
            ++  +  HL +GR             G GF+ +  RS     + I I  I  + +  +  RL+ GD I+++N +  DE V  E+A+  L+     + + V R          +D   PP   E+    E       Q   + LV    G G GI                 I +  +   GVA  DGRL  GD IL +      G    E + IL+ CG  V + V
Sbjct:   76 DFTLVVKHLAQGRLVHFVDLDKPEGVGLGFSVMGVRS-KNGHNGIFIKAIHADSIVGRWARLQEGDQILAINGMPLDERVSQEQAVRLLQTTTGPVQLVVARFS--------HDTETPPT--EVGGGLE-------QTESIELVTTGSGMGFGI----------VGNRATGIIVKTILPGGVADRDGRLCTGDRILSIGDMDVRGKGSEEVISILRQCGSRVHLLV 273          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO46059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR65])

HSP 1 Score: 87.4261 bits (215), Expect = 2.452e-20
Identity = 69/213 (32.39%), Postives = 109/213 (51.17%), Query Frame = 1
Query:  277 IKVHLKKGRKGFGFAFINDR-SIHREDD-AISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRF 909
            +++ L++G  G GF+      + H +DD  I ITK++  G A QDGRL++ D I+SVN  +  ++ +++A+  L+  G  +T+ VR  K            N P   EI                  ++ +   GLG +I  G +       DN I I+K+   G A  DGRLQVGD I+ V+LQ+ + ++H +AV++LK   + VTI V R 
Sbjct:    5 LEITLERGGSGLGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALKAAGSQVTL-VREKKR----------GNAPTREEI------------------VLIKGSKGLGFSI-AGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSRL 187          

HSP 2 Score: 68.1662 bits (165), Expect = 1.649e-13
Identity = 43/124 (34.68%), Postives = 63/124 (50.81%), Query Frame = 1
Query:  217 TASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHR--EDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPP 582
             A SQ    +    G+     ++ L KG KG GF+            D+ I ITKI+  G AQQDGRL++GD I+SVN  + ++V +E A+  L+     +T+ V RL    Y S++ D    P
Sbjct:   80 AAGSQVTLVREKKRGNAPTREEIVLIKGSKGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSRLT--AYYSEQTDSAPSP 201          

HSP 3 Score: 45.4394 bits (106), Expect = 7.985e-6
Identity = 35/89 (39.33%), Postives = 53/89 (59.55%), Query Frame = 1
Query:  631 FQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIF 897
            ++ LE+ L +R   GLG +I GG +  + D++   I I+K+   G AA DGRLQV D IL V+  +   + H +AV+ LK  G +VT+ 
Sbjct:    2 YETLEITL-ERGGSGLGFSIAGGTDNPHVDDDFG-IYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALKAAGSQVTLV 88          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO33432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS78])

HSP 1 Score: 71.2478 bits (173), Expect = 1.571e-13
Identity = 60/199 (30.15%), Postives = 95/199 (47.74%), Query Frame = 1
Query:  352 DDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYE-------SDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVG-------GLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            D+ I I++I   G A +DG L +GD I+ VN VD     + +A+  L++ G ++T+ V R K+   +        DE+    P              +PE + +E    K  +        GLG +I GG  +    + D  I ISK+A +G A  DGRL+VGD +L ++ +      H +AV +L +    VT+ V R
Sbjct:  595 DEGIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKSTGKDITLYVVREKQEIEKRTVPKTAKDESVKEEPKKT-----GVRFAPEPEMEDIETRPEKETITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIVYR 788          

HSP 2 Score: 65.0846 bits (157), Expect = 1.873e-11
Identity = 78/269 (29.00%), Postives = 112/269 (41.64%), Query Frame = 1
Query:  118 IQRGAQRNNKSDDKRGILREPPESRNNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFI--NDRSIH---REDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINI---XXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFV 900
            + R  ++ N S  + G    P  +R  ++ S + A        R    HE I     LKKG    GF+ +  +D + H    ++  I I+KIV  GVA     LKIGD ++ VN  D     ++ A++ L      + + VR                              D P     +VN  K     LGI+I     G+     D+ D  I ISK++    A  DGRL VG  IL+V+  S  G TH EAV  L++ G  VT+ V
Sbjct:  799 LTRAGKQYNPSPSRAGKQYNPSPARAGKQYSPSPA--------RAEINHEII-----LKKGNNPLGFSIVGGSDHASHPFGMDEPGIFISKIVPTGVAATT-NLKIGDRVLMVNGKDMRNATHQDAVAALIANVSLIKLLVRH-----------------------------DPPPKGLNDVNFHKSPGEKLGISIRGGAKGHPGNPLDKTDEGIFISKVSEGAAAHKDGRLMVGQRILEVNGVSLLGATHLEAVRALRSMGDRVTLLV 1024          

HSP 3 Score: 61.2326 bits (147), Expect = 2.966e-10
Identity = 40/90 (44.44%), Postives = 57/90 (63.33%), Query Frame = 1
Query:  655 VKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQD 924
            + R   GLGINI GG  +    E D  I IS+++ NG A  DG L VGD IL+V+       TH++AV++LK+ GK++T++V R  EKQ+
Sbjct:  571 IHRDTKGLGINIAGGKGSTPYKENDEGIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKSTGKDITLYVVR--EKQE 658          

HSP 4 Score: 58.5362 bits (140), Expect = 1.844e-9
Identity = 58/214 (27.10%), Postives = 98/214 (45.79%), Query Frame = 1
Query:  292 KKGRKGFGFAFINDR--SIHRE-DDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTL--------------RNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVN---LVKRAVGGLGINIXXXXXXXXXX--XXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEIL 867
            + G KG GF+    +  + +++ D  I I+KI  +G A++DGRLK+GD ++S+N  D     ++ A++ L              R I   +T   R  K+Y            P+       +     P   + E+N   ++K+    LG +I GG +  +     ++  I ISK+   GVAA    L++GD +L V+ +     TH +AV  L
Sbjct:  706 RGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIVYRDRVINKKMTPLTRAGKQYNPSPSRAGKQYNPSPARAGKQY----SPSPARAEINHEIILKKGNNPLGFSIVGGSDHASHPFGMDEPGIFISKIVPTGVAATT-NLKIGDRVLMVNGKDMRNATHQDAVAAL 914          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO33706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG3])

HSP 1 Score: 70.0922 bits (170), Expect = 5.005e-13
Identity = 58/221 (26.24%), Postives = 100/221 (45.25%), Query Frame = 1
Query:  292 KKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDE-VPYEKAISTLRNIGPNLTMTVRR-------LKEYCYESDENDDMNPPNAYEISD---SFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQ 921
            K G+ G GF+ +  +S +R +  I I +I  EGVA +DGRL+  D I+S++    D  + +E+AI  L+     + + V R              +       P N   +SD   +  +DD   ++Q+E   +     GLG  I             + + I  +   GVA  DGRLQ  D I+Q+   +  G+   +  ++L++ G  V + + R +E +
Sbjct:  169 KPGQGGLGFSVVGLKSENRGELGIFIQEIQEEGVAGRDGRLRESDQILSIDGQQLDSGISHEEAIVLLQKTRGEVELIVARGGIPRTGTSRTTSGASSVISRTPSNVSLVSDASTTIPADDGTHWRQIETIDLHNDGTGLGFGI--------IGGRSSGVSIKTILPGGVADKDGRLQEHDQIMQIGDVNVGGMGSEQVAQVLRDAGSHVRLVISRLVENE 381          

HSP 2 Score: 53.9138 bits (128), Expect = 6.847e-8
Identity = 38/117 (32.48%), Postives = 58/117 (49.57%), Query Frame = 1
Query:  151 DDKRGILREPPESRNNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLR 495
            D   G    P  SR  + +S  +  S + +Y             V L+K  KG GF+ ++  D S + E   I I  +VH GVA+QDG L  GD ++SVN+V+ +    + A+ TL+
Sbjct:  906 DAPVGTGPSPSSSRRQKSVSDQSMWSNKIEY-------------VELEKADKGLGFSILDYQDPS-NPEKTVIVIRSLVHGGVAEQDGSLHPGDRLMSVNEVNLEHASLDFAVQTLK 1008          

HSP 3 Score: 51.9878 bits (123), Expect = 3.150e-7
Identity = 33/119 (27.73%), Postives = 54/119 (45.38%), Query Frame = 1
Query:  178 PPESRNNEKISKNTASSQRKDYQRDSEGHEWIFIK---VHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTV 525
            P E   N++ +      Q    Q D E      ++   + L++G +G GF+ +        D  I +  +   G A +DGRLK GD I++VN      V +E A+S L+     + +TV
Sbjct: 1713 PSEPEANQRATPPLPVQQDSPSQSDDEEESESPLQTKIIELERGPEGLGFSIVGGHGSPHGDLPIYVKTVFPTGAASRDGRLKRGDQIIAVNGQSLVGVSHESAVSQLKKTRGKIILTV 1831          

HSP 4 Score: 48.9062 bits (115), Expect = 2.614e-6
Identity = 42/95 (44.21%), Postives = 51/95 (53.68%), Query Frame = 1
Query:  646 VNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQDAR 930
            V+LVK    GLGI I G     N DE    I I  +A    AA DGRL+V D I+QV   S  G  + EAVEILK  G  V++ V R I  + +R
Sbjct:  616 VDLVK-GTRGLGITIAGYIGEANSDELAG-IFIKSIAHGSTAALDGRLRVNDQIIQVGSVSLHGKNNGEAVEILKQTGPVVSLKVARHIPGKHSR 708          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO34828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNC4])

HSP 1 Score: 60.4622 bits (145), Expect = 3.235e-11
Identity = 41/98 (41.84%), Postives = 57/98 (58.16%), Query Frame = 1
Query:  613 SDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            +D   E Q  EV+L+K    GLG+++ GG +          I I +L   G AA  G+LQV D+ILQV+ +S D LT+ EA+ IL+NC  EV + V R
Sbjct:   33 TDYSAEEQPFEVHLIK-GPQGLGMSLTGGESGGP-------IYIKRLVPGGSAALCGQLQVNDVILQVNGKSLDRLTYREALSILRNCPPEVRLLVKR 122          

HSP 2 Score: 57.7658 bits (138), Expect = 2.514e-10
Identity = 35/109 (32.11%), Postives = 54/109 (49.54%), Query Frame = 1
Query:  223 SSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCY 549
            S+Q  DY  + +  E     VHL KG +G G +     S       I I ++V  G A   G+L++ D+I+ VN    D + Y +A+S LRN  P + + V+R +   Y
Sbjct:   29 STQYTDYSAEEQPFE-----VHLIKGPQGLGMSLTGGES----GGPIYIKRLVPGGSAALCGQLQVNDVILQVNGKSLDRLTYREALSILRNCPPEVRLLVKRSRGSSY 128          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO45624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE9])

HSP 1 Score: 59.3066 bits (142), Expect = 3.723e-10
Identity = 55/170 (32.35%), Postives = 81/170 (47.65%), Query Frame = 1
Query:  394 AQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVG 903
            A++ G L+ GD ++ VND     V +  A+  L+N  P + +TV R K      D + D         SD F            V L K + G LGI++ GG  T         I +  +   GVAA DGR++ GD +L V+ +S  GLTH E + +L+N  + V +F G
Sbjct:   35 AEKCGHLRTGDQLLQVNDECLVGVTHAYALEVLKNTPPLVKLTVARKK------DPDRD---------SDVFT-----------VELKKDSKGSLGIHVSGGVGTNC-------IDVRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNLPRRVRLFSG 171          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 87.8113 bits (216), Expect = 1.727e-18
Identity = 81/246 (32.93%), Postives = 108/246 (43.90%), Query Frame = 1
Query:  289 LKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQDARHLRDR*SEINGENLLTLPRIYSLIVLHKYM 1020
            L++G  G GF+     D     +D  I ITKI+  G A  DGRL + D ++ VNDVD  EV + +A+  L+  GP + + VRR +             PP                   LEVNL+K    GLG +I  G         DN I I+K+   G A  DGRLQ GD +L V+      + H EAV  LKN    V + V     K    HL D  +  +  +  T P +    V H YM
Sbjct:  155 LERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSRAVEALKEAGPVVRLLVRRRQA------------PPETI----------------LEVNLLK-GPKGLGFSI-AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVA----KPGPVHLNDMYAPPDYSS--TFPTMVDNHVSHNYM 364          

HSP 2 Score: 69.707 bits (169), Expect = 1.576e-12
Identity = 65/243 (26.75%), Postives = 105/243 (43.21%), Query Frame = 1
Query:  274 FIKVHLKKGRKGFGFAF---INDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIG---------------------PNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVN----------LVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFV 900
             ++V+L KG KG GF+    I ++ I   D++I ITKI+  G AQ+DGRL+ GD +++VN++   +V +E+A++ L+N                       P+ + T   + +     +    M P   Y       S   P  + +             ++ +   GLG NI          E+   I +S +   G A   G L+ GD IL V+  +    TH +A   LK  G+ VTI  
Sbjct:  245 ILEVNLLKGPKGLGFSIAGGIGNQHI-PGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSTFPTMVDNHVSHNYMGAMEPKPVYPPPQVTPSRYSPVPRHMMGEEDFTREPRKVVLHKGSTGLGFNI-------VGGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIA 479          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 87.4261 bits (215), Expect = 2.118e-18
Identity = 89/292 (30.48%), Postives = 122/292 (41.78%), Query Frame = 1
Query:  184 ESRNNEKISKNTASSQRKDY-QRDSEGHEWIFIKVHLK----------KGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQDARHLRDR*SEINGENLLTLPRIYSLIVLHKYM 1020
            +S++  K++ N +S Q   + +      EW     HL            G  G GF+     D     +D  I ITKI+  G A  DGRL + D ++ VNDVD  EV + +A+  L+  GP + + VRR +             PP                   LEVNL+K    GLG +I  G         DN I I+K+   G A  DGRLQ GD +L V+      + H EAV  LKN    V + V     K    HL D  +  +  +  T P +    V H YM
Sbjct:   90 QSKSGPKVNGNNSSGQGGWWPECTCTNREWYDQVTHLPDFFNQLKLLGPGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSRAVEALKEAGPVVRLLVRRRQA------------PPETI----------------LEVNLLK-GPKGLGFSI-AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVA----KPGPVHLNDMYAPPDYSS--TFPTMVDNHVSHNYM 345          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 87.0409 bits (214), Expect = 2.910e-18
Identity = 81/246 (32.93%), Postives = 108/246 (43.90%), Query Frame = 1
Query:  289 LKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQDARHLRDR*SEINGENLLTLPRIYSLIVLHKYM 1020
            L++G  G GF+     D     +D  I ITKI+  G A  DGRL + D ++ VNDVD  EV + +A+  L+  GP + + VRR +             PP                   LEVNL+K    GLG +I  G         DN I I+K+   G A  DGRLQ GD +L V+      + H EAV  LKN    V + V     K    HL D  +  +  +  T P +    V H YM
Sbjct:  151 LERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSRAVEALKEAGPVVRLLVRRRQA------------PPETI----------------LEVNLLK-GPKGLGFSI-AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVA----KPGPVHLNDMYAPPDYSS--TFPTMVDNHVSHNYM 360          

HSP 2 Score: 68.5514 bits (166), Expect = 2.952e-12
Identity = 67/243 (27.57%), Postives = 106/243 (43.62%), Query Frame = 1
Query:  274 FIKVHLKKGRKGFGFAF---INDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIG---------------------PNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQP---------EFQQLEVNLV-KRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFV 900
             ++V+L KG KG GF+    I ++ I   D++I ITKI+  G AQ+DGRL+ GD +++VN++   +V +E+A++ L+N                       P+ + T   + +     +    M P   Y       S   P         +F +    +V  +   GLG NI          E+   I +S +   G A   G L+ GD IL V+  +    TH +A   LK  G+ VTI  
Sbjct:  241 ILEVNLLKGPKGLGFSIAGGIGNQHIP-GDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSTFPTMVDNHVSHNYMGAMEPKPVYPPPQVTPSRYSPVPRHMMGEEDFTREPRKVVLHKGSTGLGFNI-------VGGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIA 475          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 87.0409 bits (214), Expect = 3.215e-18
Identity = 81/246 (32.93%), Postives = 108/246 (43.90%), Query Frame = 1
Query:  289 LKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQDARHLRDR*SEINGENLLTLPRIYSLIVLHKYM 1020
            L++G  G GF+     D     +D  I ITKI+  G A  DGRL + D ++ VNDVD  EV + +A+  L+  GP + + VRR +             PP                   LEVNL+K    GLG +I  G         DN I I+K+   G A  DGRLQ GD +L V+      + H EAV  LKN    V + V     K    HL D  +  +  +  T P +    V H YM
Sbjct:  148 LERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSRAVEALKEAGPVVRLLVRRRQA------------PPETI----------------LEVNLLK-GPKGLGFSI-AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVA----KPGPVHLNDMYAPPDYSS--TFPTMVDNHVSHNYM 357          

HSP 2 Score: 68.5514 bits (166), Expect = 2.975e-12
Identity = 65/243 (26.75%), Postives = 105/243 (43.21%), Query Frame = 1
Query:  274 FIKVHLKKGRKGFGFAF---INDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIG---------------------PNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVN----------LVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFV 900
             ++V+L KG KG GF+    I ++ I   D++I ITKI+  G AQ+DGRL+ GD +++VN++   +V +E+A++ L+N                       P+ + T   + +     +    M P   Y       S   P  + +             ++ +   GLG NI          E+   I +S +   G A   G L+ GD IL V+  +    TH +A   LK  G+ VTI  
Sbjct:  238 ILEVNLLKGPKGLGFSIAGGIGNQHIP-GDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSTFPTMVDNHVSHNYMGAMEPKPVYPPPQVTPSRYSPVPRHMMGEEDFTREPRKVVLHKGSTGLGFNI-------VGGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIA 472          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg4a (disks large homolog 4 [Source:NCBI gene;Acc:101159214])

HSP 1 Score: 85.1149 bits (209), Expect = 1.074e-17
Identity = 76/244 (31.15%), Postives = 113/244 (46.31%), Query Frame = 1
Query:  181 PESRNNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFI--NDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            P   N   +  NT +     Y   +EG E  + ++ L++G  G GF+     D     +D +I ITKI+  G A QDGRL + D I+ VNDVD  EV + +A+  L+  G  + + V R K              P A +++              E+ L+K    GLG +I  G         DN I ++K+   G A  DGRLQ+GD IL V+    + + H +AV  LKN  + V + V +
Sbjct:   86 PVKGNTPPVVVNTDTLDGSPYVNGTEG-EIEYEEITLERGNSGLGFSIAGGTDNPHVGDDPSIFITKIIPGGAAAQDGRLSVNDCILFVNDVDVREVTHSQAVEALKEAGAIVRLYVLRRK--------------PAAEKVT--------------EIKLIK-GPKGLGFSI-AGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNNVCLEDVMHEDAVGALKNTAEVVYLRVAK 298          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000020500.1 (SMESG000020500.1)

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 277/277 (100.00%), Postives = 277/277 (100.00%), Query Frame = 1
Query:  115 MIQRGAQRNNKSDDKRGILREPPESRNNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQDARHLRDR 945
            MIQRGAQRNNKSDDKRGILREPPESRNNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIEGGYNTENEDEEDNYIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQDARHLRDR
Sbjct:    1 MIQRGAQRNNKSDDKRGILREPPESRNNEKISKNTASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIEGGYNTENEDEEDNYIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQDARHLRDR 277          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000020502.1 (SMESG000020502.1)

HSP 1 Score: 179.104 bits (453), Expect = 2.616e-52
Identity = 108/235 (45.96%), Postives = 150/235 (63.83%), Query Frame = 1
Query:  250 DSEGHEWIFIKVHLKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMN-----PPNAYEISDSFESDDQPE-------FQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFI 912
            + E + W++ ++ L KGRKG+GFA     ++  +  D+ I +TKI+ EG A+ DGRLKI D+IVSVNDV+ + V +E A+ TL+N G ++ + +RRLK+  Y ++E  +++      PN    S   E +   E       FQQ EV L+KR+ GGLGI+I  G      +EED+YI ISKL   GVA  DGRLQVGD+IL VD +S +G+TH EAV  LKN GK VT+F+ RFI
Sbjct:  154 EDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKIDDVIVSVNDVNLEYVTHETAVDTLKNAGQSMILIIRRLKD-EYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISI-QGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARFI 386          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000030959.1 (SMESG000030959.1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.357e-16
Identity = 66/213 (30.99%), Postives = 107/213 (50.23%), Query Frame = 1
Query:  304 KGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKE----------YCYES-DENDDMNPPNA-YEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            +GFGF  +   +         I K++    AQ+ G L++GD I+SVN      + +EK + T++N G N+T+ +  + E            YES D+   +   NA Y+ SD+  S D       +V L  R   G G +I GG +          + + ++A +G A  DGRL+VGD ILQ++ +S  G+TH +A+ I++  GK + + V R
Sbjct: 1162 EGFGFVIVTSMTRSGSHVGEYIGKLIENSPAQKCGLLRVGDRILSVNGNSVSRMRHEKIVQTIKNCGRNVTLRISPVPEEGGHSGPTSINSYESSDQGSSIRSSNASYQKSDTNSSGDV----DFDVTL-NRGSKGFGFSIRGGQDFNKMP-----LFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVRR 1364          

HSP 2 Score: 51.6026 bits (122), Expect = 7.712e-7
Identity = 36/120 (30.00%), Postives = 64/120 (53.33%), Query Frame = 1
Query:  181 PESRNNEKISKNTAS--SQRKDYQR-DSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRR 531
            P S N+ + S   +S  S    YQ+ D+     +   V L +G KGFGF+    +  ++    + + +I  +G A+QDGRLK+GD I+ +N      + + +AI+ ++  G ++ + VRR
Sbjct: 1247 PTSINSYESSDQGSSIRSSNASYQKSDTNSSGDVDFDVTLNRGSKGFGFSIRGGQDFNKM--PLFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVRR 1364          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000030959.1 (SMESG000030959.1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.610e-16
Identity = 66/213 (30.99%), Postives = 107/213 (50.23%), Query Frame = 1
Query:  304 KGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKE----------YCYES-DENDDMNPPNA-YEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGR 906
            +GFGF  +   +         I K++    AQ+ G L++GD I+SVN      + +EK + T++N G N+T+ +  + E            YES D+   +   NA Y+ SD+  S D       +V L  R   G G +I GG +          + + ++A +G A  DGRL+VGD ILQ++ +S  G+TH +A+ I++  GK + + V R
Sbjct: 1162 EGFGFVIVTSMTRSGSHVGEYIGKLIENSPAQKCGLLRVGDRILSVNGNSVSRMRHEKIVQTIKNCGRNVTLRISPVPEEGGHSGPTSINSYESSDQGSSIRSSNASYQKSDTNSSGDV----DFDVTL-NRGSKGFGFSIRGGQDFNKMP-----LFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVRR 1364          

HSP 2 Score: 51.6026 bits (122), Expect = 7.839e-7
Identity = 36/120 (30.00%), Postives = 64/120 (53.33%), Query Frame = 1
Query:  181 PESRNNEKISKNTAS--SQRKDYQR-DSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRR 531
            P S N+ + S   +S  S    YQ+ D+     +   V L +G KGFGF+    +  ++    + + +I  +G A+QDGRLK+GD I+ +N      + + +AI+ ++  G ++ + VRR
Sbjct: 1247 PTSINSYESSDQGSSIRSSNASYQKSDTNSSGDVDFDVTLNRGSKGFGFSIRGGQDFNKM--PLFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVRR 1364          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000053393.1 (SMESG000053393.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.866e-13
Identity = 75/289 (25.95%), Postives = 121/289 (41.87%), Query Frame = 1
Query:  121 QRGAQRNNKSDDKRGILREPPESR---------NNEKISKN-------------TASSQRKDYQRDSEGHEWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHE----GVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRF 909
            +  A R + S DK  I    P  R         NN+ I+K              T +  +K++   ++    +   + L K R G G + I         D I  T ++HE      A  DGRL  GD I++VN  D     +++AI TLR++G  + + + R K+   E                DS        + +L+V+L+K++  GLGI I    +          + IS L    +A  DGRL+ GD++L+++  +    T  +   +LK C   V + VGR 
Sbjct: 1772 KMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGG------SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCE----------------DSL-------YFKLKVDLLKKSRKGLGITIVSKSDVG--------VCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRL 2022          

HSP 2 Score: 55.4546 bits (132), Expect = 5.069e-8
Identity = 32/106 (30.19%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  235 KDYQRDSEGHEWIFIKVHL-KKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCY 549
            +D Q   E   +  +KV L KK RKG G   ++     + D  + I+ +V   +A+QDGRLK GD+++ +ND +      ++  + L+    N+ + V RL+   Y
Sbjct: 1927 RDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 2027          

HSP 3 Score: 50.8322 bits (120), Expect = 1.312e-6
Identity = 55/228 (24.12%), Postives = 99/228 (43.42%), Query Frame = 1
Query:  292 KKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNI---GPNLTMTVRR-----LKEYCYESDENDDMNP----PNAYEISD-----SFESDDQPEFQQLEVNLVKRAVGGLGINIXXXXXXXXXXXXXXXIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRFIEKQD 924
            K+G+KG G   + ++     +  I   K     VA  DG+L IGD ++ +N +D   + +      ++        + +T++R     +K  C  +  N  + P     NA E S      S  ++ Q       V+L +++V G G  I      +        I + K+ V+G+AAN+G L+ GD IL ++ +      +   ++ L+ C   + + VGR    QD
Sbjct: 1507 KQGKKGMGLLLVGNKDCSSMNCYICGFK--DNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHL-EKSVQGFGFFIMDCNANDEAG-----IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQD 1726          
The following BLAST results are available for this feature:
BLAST of Disks large homolog 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DLG25.458e-2033.64discs large MAGUK scaffold protein 2 [Source:HGNC ... [more]
DLG21.389e-1933.80discs large MAGUK scaffold protein 2 [Source:HGNC ... [more]
DLG21.436e-1933.64discs large MAGUK scaffold protein 2 [Source:HGNC ... [more]
DLG21.622e-1933.64discs large MAGUK scaffold protein 2 [Source:HGNC ... [more]
DLG21.989e-1933.64discs large MAGUK scaffold protein 2 [Source:HGNC ... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpz-11.617e-1326.34Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-12.190e-1326.34Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-12.268e-1326.34Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-12.312e-1326.34Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-12.372e-1326.34Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg14.501e-1432.27gene:FBgn0001624 transcript:FBtr0301288[more]
dlg14.807e-1432.27gene:FBgn0001624 transcript:FBtr0073484[more]
dlg15.258e-1432.27gene:FBgn0001624 transcript:FBtr0073489[more]
dlg15.258e-1432.27gene:FBgn0001624 transcript:FBtr0308089[more]
dlg15.430e-1432.27gene:FBgn0001624 transcript:FBtr0112812[more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg32.285e-1931.87discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
patj2.927e-1931.80PATJ crumbs cell polarity complex component [Sourc... [more]
patj2.927e-1931.80PATJ crumbs cell polarity complex component [Sourc... [more]
dlg23.408e-1932.72discs, large homolog 2 (Drosophila) [Source:NCBI g... [more]
dlg34.276e-1933.20discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmmr8.868e-1934.13hyaluronan-mediated motility receptor (RHAMM) [Sou... [more]
hmmr9.084e-1934.13hyaluronan-mediated motility receptor (RHAMM) [Sou... [more]
hjv1.011e-1833.18hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB... [more]
hmmr1.351e-1833.02hyaluronan-mediated motility receptor (RHAMM) [Sou... [more]
hmmr1.546e-1833.02hyaluronan-mediated motility receptor (RHAMM) [Sou... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dlg21.874e-1933.64discs large MAGUK scaffold protein 2 [Source:MGI S... [more]
Dlg21.927e-1933.64discs large MAGUK scaffold protein 2 [Source:MGI S... [more]
Dlg22.414e-1933.64discs large MAGUK scaffold protein 2 [Source:MGI S... [more]
Dlg22.462e-1933.64discs large MAGUK scaffold protein 2 [Source:MGI S... [more]
Dlg22.752e-1933.64discs large MAGUK scaffold protein 2 [Source:MGI S... [more]
back to top
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15700|DLG2_HUMAN9.551e-1933.64Disks large homolog 2 OS=Homo sapiens OX=9606 GN=D... [more]
sp|Q91XM9|DLG2_MOUSE1.925e-1833.64Disks large homolog 2 OS=Mus musculus OX=10090 GN=... [more]
sp|Q63622|DLG2_RAT2.357e-1833.64Disks large homolog 2 OS=Rattus norvegicus OX=1011... [more]
sp|Q5PYH7|DLG2_DANRE3.238e-1832.72Disks large homolog 2 OS=Danio rerio OX=7955 GN=dl... [more]
sp|Q5PYH6|DLG1_DANRE5.759e-1831.60Disks large homolog 1 OS=Danio rerio OX=7955 GN=dl... [more]
back to top
BLAST of Disks large homolog 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3F3U29.672e-2230.24Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3F1091.775e-2130.24Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A3P6H7384.635e-2031.00Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A3S3PPP96.785e-1934.55Uncharacterized protein OS=Dinothrombium tinctoriu... [more]
A0A504YZ911.011e-1830.74Disks large 1 OS=Fasciola gigantica OX=46835 GN=FG... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg21.173e-1933.18discs, large homolog 2 (Drosophila) [Source:NCBI g... [more]
dlg21.563e-1933.18discs, large homolog 2 (Drosophila) [Source:NCBI g... [more]
dlg22.277e-1933.18discs, large homolog 2 (Drosophila) [Source:NCBI g... [more]
ENSAMXT00000052301.12.333e-1930.89discs large homolog 1-like protein [Source:NCBI ge... [more]
dlg22.589e-1933.18discs, large homolog 2 (Drosophila) [Source:NCBI g... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002205.14.206e-1527.40pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 g... [more]
ENSPMAT00000006056.12.680e-1429.76pep scaffold:Pmarinus_7.0:GL477535:225:55869:1 gen... [more]
ENSPMAT00000004677.12.636e-1330.43pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 ... [more]
scrib5.774e-1027.85scribble planar cell polarity protein [Source:NCBI... [more]
ENSPMAT00000005746.15.450e-824.29pep scaffold:Pmarinus_7.0:GL479493:17594:33348:1 g... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO460592.452e-2032.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334321.571e-1330.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337065.005e-1326.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348283.235e-1141.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456243.723e-1032.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg31.727e-1832.93discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg32.118e-1830.48discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg32.910e-1832.93discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg33.215e-1832.93discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg4a1.074e-1731.15disks large homolog 4 [Source:NCBI gene;Acc:101159... [more]
back to top
BLAST of Disks large homolog 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020500.10.000e+0100.00SMESG000020500.1[more]
SMESG000020502.12.616e-5245.96SMESG000020502.1[more]
SMESG000030959.11.357e-1630.99SMESG000030959.1[more]
SMESG000030959.11.610e-1630.99SMESG000030959.1[more]
SMESG000053393.11.866e-1325.95SMESG000053393.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001292 ID=SMED30001292|Name=Disks large homolog 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1067bp
CTGCATTAATTACAACAAAATTTAAATCAATTTGTTTGAATATATTTTCC
TATTTTAATATAGTTTGATTACTACTGATAATTTTATAAGTATTTACGTG
TTAAAATAGAAATTATGATACAGCGAGGTGCACAAAGGAATAATAAATCA
GATGACAAAAGGGGTATTTTGAGAGAGCCACCAGAGTCCAGAAATAATGA
GAAAATATCAAAAAATACTGCCAGTTCTCAGAGAAAAGATTATCAACGTG
ATTCTGAAGGTCATGAGTGGATTTTCATAAAAGTTCATTTAAAGAAAGGA
AGGAAAGGTTTTGGATTTGCTTTTATTAACGACAGATCAATTCACCGAGA
AGATGATGCAATTTCCATCACAAAGATAGTTCACGAAGGGGTAGCTCAAC
AAGATGGACGATTAAAGATTGGAGATATAATTGTTTCAGTAAATGATGTC
GATTTTGATGAAGTTCCATACGAAAAAGCAATTTCTACTTTAAGAAATAT
TGGGCCAAATTTGACAATGACAGTTCGTAGATTAAAGGAGTATTGTTATG
AATCAGATGAAAATGATGATATGAATCCTCCTAATGCATATGAAATTAGC
GATTCTTTTGAATCTGACGATCAACCAGAGTTTCAGCAGCTGGAAGTAAA
CCTAGTAAAGAGAGCAGTAGGAGGATTGGGAATAAACATTGAAGGTGGAT
ATAATACTGAAAATGAAGATGAAGAAGATAATTATATAAGAATCTCAAAA
TTGGCTGTAAATGGTGTCGCAGCAAATGACGGCCGACTTCAAGTTGGTGA
CATAATTTTACAAGTTGACTTACAATCGTTTGACGGGTTAACTCATTACG
AAGCAGTTGAAATTTTAAAAAACTGTGGAAAAGAAGTCACAATTTTTGTT
GGCCGTTTCATTGAAAAACAGGACGCAAGACATTTAAGGGACCGCTAAAG
TGAAATAAATGGAGAAAATTTACTAACTTTACCGAGAATTTACTCACTGA
TTGTACTACATAAATATATGACATTTTTTAAAAAAATTTTTATCTTTAAT
ATATTATTCAAGGTTAA
back to top

protein sequence of SMED30001292-orf-1

>SMED30001292-orf-1 ID=SMED30001292-orf-1|Name=SMED30001292-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MIQRGAQRNNKSDDKRGILREPPESRNNEKISKNTASSQRKDYQRDSEGH
EWIFIKVHLKKGRKGFGFAFINDRSIHREDDAISITKIVHEGVAQQDGRL
KIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDEN
DDMNPPNAYEISDSFESDDQPEFQQLEVNLVKRAVGGLGINIEGGYNTEN
EDEEDNYIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEI
LKNCGKEVTIFVGRFIEKQDARHLRDR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016324apical plasma membrane
GO:0005829cytosol
GO:0005886plasma membrane
GO:0014069postsynaptic density
GO:0016020membrane
GO:0030054cell junction
GO:0030424axon
GO:0042995cell projection
GO:0044224juxtaparanode region of axon
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001478PDZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004385guanylate kinase activity
GO:0019900kinase binding
GO:0035255ionotropic glutamate receptor binding
Vocabulary: biological process
TermDefinition
GO:0007268chemical synaptic transmission
GO:0007399nervous system development
GO:0010923negative regulation of phosphatase activity
GO:0019233sensory perception of pain
GO:0043113receptor clustering
GO:0046037GMP metabolic process
GO:0046710GDP metabolic process
GO:0097120receptor localization to synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 64..141
e-value: 4.4E-14
score: 62.8
coord: 186..266
e-value: 5.3E-17
score: 72.5
IPR001478PDZ domainPFAMPF00595PDZcoord: 57..138
e-value: 1.2E-13
score: 51.1
coord: 178..260
e-value: 1.6E-14
score: 54.0
IPR001478PDZ domainPROSITEPS50106PDZcoord: 56..141
score: 17.993
IPR001478PDZ domainPROSITEPS50106PDZcoord: 177..266
score: 18.878
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 37..162
e-value: 9.6E-23
score: 82.1
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 163..273
e-value: 6.6E-25
score: 89.3
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 47..139
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 152..264
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..44
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 8..28
NoneNo IPR availablePANTHERPTHR23119:SF51DISKS LARGE 1 TUMOR SUPPRESSOR PROTEINcoord: 25..146
NoneNo IPR availablePANTHERPTHR23119:SF51DISKS LARGE 1 TUMOR SUPPRESSOR PROTEINcoord: 172..267
NoneNo IPR availablePANTHERPTHR23119DISCS LARGEcoord: 25..146
coord: 172..267
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 177..262
e-value: 2.26642E-18
score: 75.681
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 55..138
e-value: 2.76109E-13
score: 61.8138