semaphorin 5-3

Overview
Namesemaphorin 5-3 (AJA72718.1)
Smed IDSMED30001290
Length (bp)3320
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of semaphorin 5-3 (SMED30001290) t-SNE clustered cells

Violin plots show distribution of expression levels for semaphorin 5-3 (SMED30001290) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of semaphorin 5-3 (SMED30001290) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for semaphorin 5-3 (SMED30001290) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001290

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30001290SMESG000033853.1 dd_Smed_v4_9914_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001290SMESG000033853.1 dd_Smed_v4_9914_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001290SMESG000033853.1 dd_Smed_v4_9914_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of semaphorin 5-3 vs. Ensembl Human
Match: SEMA5A (semaphorin 5A [Source:HGNC Symbol;Acc:HGNC:10736])

HSP 1 Score: 194.126 bits (492), Expect = 8.635e-50
Identity = 234/998 (23.45%), Postives = 397/998 (39.78%), Query Frame = 1
Query:  247 LHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQCTS-----EQCEKIIIDVVQFAKD-------SKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSL-LEISLQPKICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASS--LKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIK----------LTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNL-PLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTR--------------RTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR-MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPL--------IQNKPCL--------------RQIKDKP-AEFSFIYMIVSGLVGFVCGLLMGSILCYIW 2934
            L ++   +  +F  L++ P    + VV   N + RL+L +L+      ++     KK C S     E+C+  I  V+    D       +    +C N  L SN  ++ DQ+    +       +  Q      +++  E   +++AT+   + G     Y+ L I   PL     N   +N+ N            ++S+      YF + E      C + V  +R  R+C+ND G   L  + ++ F K  + C    S     PF Y    +  +L     +   FT+N     +SA+CV+ + +I  AF+   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  +  VT+     E  ++F  +A +          +++++T    +  + + ++     C+L +  L      E I  L+ ++   +  LFVG    +VKIPL  C    T + C     P+C WD + KKC  +           S + C +     +    V + W  C       D S +G C C   R+ D    +          + I+  C  +G WT ++SWS CS TCG G +VR R C NP P++GG+ C G N E      + C+E         ++ W  W  C+  CG   ++R R C     C     E +SCN  P  E K  + W+ W+  N++      + R R+ C    +    + +L ++ R  +     ++D     +   ++G+F     +S+ + +   S WT               R R C  P        C G S++Y+ C I  C                    G   MR R C   +       C G  TE + C  + C  ++S+W++WS CE +  + R RQC+     LFP+         +++PC+                +++K   EF+  +MI  GL   + G L+ ++L Y +
Sbjct:   47 LREFRAKNAVDFSQLTFDPGQKEL-VVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYI-RVLLVGGDRLFTCGTNAFTPVCTNRSL-SNLTEIHDQISGMAR-----CPYSPQHNSTALLTAGGE---LYAATA-MDFPGRDPAIYRSLGILP-PLRTAQYNSKWLNEPNF-----------VSSYDIGNFTYFFFRENAVEHDCGKTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNC----SRPGEVPFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQ-ENSRSAWLPYPNPNPHFQCGTVDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHIIYLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILH--SQSVLFVGLREHVVKIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVDGHFGVWSPWTPC----THTDGSAVGSCLCRT-RSCDSPAPQCGGWQCEGPGMEIA-NCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNRE-----ERYCNEHLLCPPHMFWTGWGPWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNPCPELKKTTPWTPWTPVNISDNGGHYEQRFRYTC----KARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPVDGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECEASGVQVRARQCIL----LFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEEKRCGEFNMFHMIAVGLSSSILGCLL-TLLVYTY 992          
BLAST of semaphorin 5-3 vs. Ensembl Human
Match: SEMA5A (semaphorin 5A [Source:HGNC Symbol;Acc:HGNC:10736])

HSP 1 Score: 194.126 bits (492), Expect = 8.635e-50
Identity = 234/998 (23.45%), Postives = 397/998 (39.78%), Query Frame = 1
Query:  247 LHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQCTS-----EQCEKIIIDVVQFAKD-------SKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSL-LEISLQPKICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASS--LKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIK----------LTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNL-PLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTR--------------RTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR-MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPL--------IQNKPCL--------------RQIKDKP-AEFSFIYMIVSGLVGFVCGLLMGSILCYIW 2934
            L ++   +  +F  L++ P    + VV   N + RL+L +L+      ++     KK C S     E+C+  I  V+    D       +    +C N  L SN  ++ DQ+    +       +  Q      +++  E   +++AT+   + G     Y+ L I   PL     N   +N+ N            ++S+      YF + E      C + V  +R  R+C+ND G   L  + ++ F K  + C    S     PF Y    +  +L     +   FT+N     +SA+CV+ + +I  AF+   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  +  VT+     E  ++F  +A +          +++++T    +  + + ++     C+L +  L      E I  L+ ++   +  LFVG    +VKIPL  C    T + C     P+C WD + KKC  +           S + C +     +    V + W  C       D S +G C C   R+ D    +          + I+  C  +G WT ++SWS CS TCG G +VR R C NP P++GG+ C G N E      + C+E         ++ W  W  C+  CG   ++R R C     C     E +SCN  P  E K  + W+ W+  N++      + R R+ C    +    + +L ++ R  +     ++D     +   ++G+F     +S+ + +   S WT               R R C  P        C G S++Y+ C I  C                    G   MR R C   +       C G  TE + C  + C  ++S+W++WS CE +  + R RQC+     LFP+         +++PC+                +++K   EF+  +MI  GL   + G L+ ++L Y +
Sbjct:   47 LREFRAKNAVDFSQLTFDPGQKEL-VVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYI-RVLLVGGDRLFTCGTNAFTPVCTNRSL-SNLTEIHDQISGMAR-----CPYSPQHNSTALLTAGGE---LYAATA-MDFPGRDPAIYRSLGILP-PLRTAQYNSKWLNEPNF-----------VSSYDIGNFTYFFFRENAVEHDCGKTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNC----SRPGEVPFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQ-ENSRSAWLPYPNPNPHFQCGTVDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHIIYLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILH--SQSVLFVGLREHVVKIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVDGHFGVWSPWTPC----THTDGSAVGSCLCRT-RSCDSPAPQCGGWQCEGPGMEIA-NCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNRE-----ERYCNEHLLCPPHMFWTGWGPWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNPCPELKKTTPWTPWTPVNISDNGGHYEQRFRYTC----KARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPVDGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECEASGVQVRARQCIL----LFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEEKRCGEFNMFHMIAVGLSSSILGCLL-TLLVYTY 992          
BLAST of semaphorin 5-3 vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 170.244 bits (430), Expect = 2.639e-42
Identity = 205/932 (22.00%), Postives = 364/932 (39.06%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQC-----TSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRT--VHSATSDYTYAGLYMKSYKELMIFKN-----PLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKF---NEYKNI--CQLFTTGNQDSNFLINLQTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQP-KICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCK---CNIER----NTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQYESFNLSLN-DITRYIVYPSCSTADCQFKNNKQII--NGNFXXXXXXXXXXXXXXXXXXTR--------RTRNCITP-------ICFGESIDY-----KMCPIYLXXXXXXXXXXXXXXXXPCETR---GMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC----LYNNNCLFPLIQNKPC 2820
            +F  L+  P+ + + +V   N + RL L N++      + S    ++ C     T E+C+  +          ++L +    +    TN     MC + +  NL S  I +  G      D  H +  V S+  +   A +   S ++  I+++     PL     N   +N+ N            + ++      YF   E      C   V  +R+ R+C+ND G   L  + ++ F K  + C +        PF Y    +   L     +   FT+N     +SA+C + + +I  AFN   +      +      N   N     L  TG  ++    +LQ   + + +   +  VT +  + +   +F  +  +     +    VL++ T++  +   L  + +    C L +  +      E +  L+ ++      LFVG    ++++PL+ C    +   C     P+C WD   ++C  +   +   L + + T C   +  ++      + W  C  + +  D S   +C+   C+  R      D     + I+  C  +G WT +SSW+ CS +CG G +VR R C NP P++GG+ C G + E + C  N  C    F      ++ W +WS CS  CG   +SR R C +        E K+CN   C E +  + W+ W   NVT      + R RF C +    +   L      T     P+  +  C      +++  +G+ S  +     +     S  +R        R R C  P        C G++ +Y     + CP+           +  T ++PC      G   R R C   +       C G  TE + C  + C   +S W+EWS C ++  ++R R C      ++ C     Q++PC
Sbjct:   67 DFSQLALDPSGNQL-IVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYV----------RVLIVAGRKVFMCGTNAFSP-MCTSRQVGNL-SRTIEKINGVARCPYDPRHNSTAVISSQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNF-----------VAAYDIGLFAYFFLRENAVEHDCGRTVY-SRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEV----PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARA--LFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNVTRDGGFGPWSPWQPC--EHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIA-NCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF------WASWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTC-RAPLADPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPV-------RGAWSCWTSWSPCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCATQACPEGWSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPC 950          
BLAST of semaphorin 5-3 vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 168.703 bits (426), Expect = 7.337e-42
Identity = 206/933 (22.08%), Postives = 364/933 (39.01%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQC-----TSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRT--VHSATSDYTYAGLYMKSYKELMIFKN-----PLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKF---NEYKNI--CQLFTTGNQDSNFLINLQTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQP-KICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCK---CNIER----NTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQYESFNLSLN-DITRYIVYPSCSTADCQFKNNKQII--NGNFXXXXXXXXXXXXXXXXXXTR--------RTRNCITP-------ICFGESIDY-----KMCPIYLXXXXXXXXXXXXXXXXPCETR---GMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC----LYNNNCLFPLIQNKPC 2820
            +F  L+  P+ + + +V   N + RL L N++      + S    ++ C     T E+C+  +          ++L +    +    TN     MC + +  NL S  I +  G      D  H +  V S+  +   A +   S ++  I+++     PL     N   +N+ N            + ++      YF   E      C   V  +R+ R+C+ND G   L  + ++ F K  + C +        PF Y    +   L     +   FT+N     +SA+C + + +I  AFN   +      +      N   N     L  TG  ++    +LQ   + + +   +  VT +  + +   +F  +  +     +    VL++ T++  +   L  + +    C L +  +      E +  L+ ++      LFVG    ++++PL+ C    +   C     P+C WD   ++C  +   +   L + + T C   +  ++      + W  C  + +  D S   +C+   C+  R      D     + I+  C  +G WT +SSW+ CS +CG G +VR R C NP P++GG+ C G + E + C  N  C    F      ++ W +WS CS  CG   +SR R C     C     E K+CN   C E +  + W+ W   NVT      + R RF C +    +   L      T     P+  +  C      +++  +G+ S  +     +     S  +R        R R C  P        C G++ +Y     + CP+           +  T ++PC      G   R R C   +       C G  TE + C  + C   +S W+EWS C ++  ++R R C      ++ C     Q++PC
Sbjct:  125 DFSQLALDPSGNQL-IVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYV----------RVLIVAGRKVFMCGTNAFSP-MCTSRQVGNL-SRTIEKINGVARCPYDPRHNSTAVISSQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNF-----------VAAYDIGLFAYFFLRENAVEHDCGRTVY-SRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEV----PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARA--LFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNVTRDGGFGPWSPWQPC--EHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIA-NCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF------WASWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTC-RAPLADPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPV-------RGAWSCWTSWSPCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCATQACPEGWSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPC 1009          
BLAST of semaphorin 5-3 vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 169.088 bits (427), Expect = 7.655e-42
Identity = 206/933 (22.08%), Postives = 364/933 (39.01%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQC-----TSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRT--VHSATSDYTYAGLYMKSYKELMIFKN-----PLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKF---NEYKNI--CQLFTTGNQDSNFLINLQTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQP-KICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCK---CNIER----NTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQYESFNLSLN-DITRYIVYPSCSTADCQFKNNKQII--NGNFXXXXXXXXXXXXXXXXXXTR--------RTRNCITP-------ICFGESIDY-----KMCPIYLXXXXXXXXXXXXXXXXPCETR---GMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC----LYNNNCLFPLIQNKPC 2820
            +F  L+  P+ + + +V   N + RL L N++      + S    ++ C     T E+C+  +          ++L +    +    TN     MC + +  NL S  I +  G      D  H +  V S+  +   A +   S ++  I+++     PL     N   +N+ N            + ++      YF   E      C   V  +R+ R+C+ND G   L  + ++ F K  + C +        PF Y    +   L     +   FT+N     +SA+C + + +I  AFN   +      +      N   N     L  TG  ++    +LQ   + + +   +  VT +  + +   +F  +  +     +    VL++ T++  +   L  + +    C L +  +      E +  L+ ++      LFVG    ++++PL+ C    +   C     P+C WD   ++C  +   +   L + + T C   +  ++      + W  C  + +  D S   +C+   C+  R      D     + I+  C  +G WT +SSW+ CS +CG G +VR R C NP P++GG+ C G + E + C  N  C    F      ++ W +WS CS  CG   +SR R C     C     E K+CN   C E +  + W+ W   NVT      + R RF C +    +   L      T     P+  +  C      +++  +G+ S  +     +     S  +R        R R C  P        C G++ +Y     + CP+           +  T ++PC      G   R R C   +       C G  TE + C  + C   +S W+EWS C ++  ++R R C      ++ C     Q++PC
Sbjct:  179 DFSQLALDPSGNQL-IVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYV----------RVLIVAGRKVFMCGTNAFSP-MCTSRQVGNL-SRTIEKINGVARCPYDPRHNSTAVISSQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNF-----------VAAYDIGLFAYFFLRENAVEHDCGRTVY-SRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEV----PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARA--LFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNVTRDGGFGPWSPWQPC--EHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIA-NCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF------WASWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTC-RAPLADPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPV-------RGAWSCWTSWSPCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCATQACPEGWSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPC 1063          
BLAST of semaphorin 5-3 vs. Ensembl Celegans
Match: adt-1 (A disintegrin and metalloproteinase with thrombospondin motifs adt-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECS8])

HSP 1 Score: 108.997 bits (271), Expect = 1.233e-23
Identity = 54/149 (36.24%), Postives = 83/149 (55.70%), Query Frame = 1
Query: 1852 KVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS------EKCTESLNEIKSCNLPLCEFKIYSQWSSWSKF-----NVTTFTKIRLR 2265
            KVDG WT +++WS+C+  C NG R R+RFC NPKP  GG +CTG++ E   C     D        G +S W+ W+ CS +CGF  ++R R C S      + C+   ++   C+LP C+ +   +WS+W+++     N    T+ R+R
Sbjct: 1263 KVDGGWTDWTAWSECTDYCRNGHRSRTRFCANPKPSQGGAQCTGSDFELNPCF----DPARCHLRDGGWSTWSDWTPCSASCGFGVQTRDRSCSSPEPKGGQSCSGLAHQTSLCDLPACDHESDGEWSAWNEWSGCMGNCGIGTRTRVR 1407          

HSP 2 Score: 80.1073 bits (196), Expect = 7.617e-15
Identity = 36/99 (36.36%), Postives = 55/99 (55.56%), Query Frame = 1
Query: 1858 DGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTES 2154
            DG W+ +S W+ CSA+CG G + R R C +P+P+ GG+ C+G   +  +C    CD      + G +S W  WS C   CG  T++R R C+S   ++ 
Sbjct: 1324 DGGWSTWSDWTPCSASCGFGVQTRDRSCSSPEPK-GGQSCSGLAHQTSLCDLPACDH----ESDGEWSAWNEWSGCMGNCGIGTRTRVRACVSPPVSDG 1417          

HSP 3 Score: 73.1738 bits (178), Expect = 1.147e-12
Identity = 47/147 (31.97%), Postives = 74/147 (50.34%), Query Frame = 1
Query: 1861 GDWTVYSSWSDCSATCGN-GTRVRSRFCDNPKPQNGGKECTGNNTEYQICV-NKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEK-------CTESLNEIKSCNLPL-CEFK--IYSQWSSWSKFNVTTFTKIRLR 2265
            G W+++S WS CS  CG+ G ++R+R C  P P N G  C+G + + + CV +  C +   E   G ++ WT WS C+  C    +SR+R C + K       CT S  E+  C  P  C  +   +S WS W+  + +    ++ R
Sbjct: 1204 GGWSLWSEWSSCSKDCGDTGHQIRNRMCSEPIPSNRGAYCSGYSFDQRPCVMDNVCSD---EKVDGGWTDWTAWSECTDYCRNGHRSRTRFCANPKPSQGGAQCTGSDFELNPCFDPARCHLRDGGWSTWSDWTPCSASCGFGVQTR 1347          

HSP 4 Score: 66.2402 bits (160), Expect = 1.405e-10
Identity = 43/144 (29.86%), Postives = 64/144 (44.44%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQ-WTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLC----EFKIYSQWSSWSKFNVTTFTKIRLR 2265
            C  +G WT +  WS CS +CG G R R R C + K       C G++ E + C  +KC            SQ W  W  CS +CG   + R R C  E C  +  + ++CN   C       ++S+W  W+  + T    ++ R
Sbjct:  801 CDNEGCWTNWDEWSSCSQSCGGGRRYRIRKCLDDK-------CDGDDLEKESCNTQKC-----------ISQSWGDWLPCSVSCGIGFQIRERLCDGELCATANKQARTCNQQQCPSAFSLSVWSEWGEWTTCSATCGEGLQSR 926          

HSP 5 Score: 60.4622 bits (145), Expect = 8.511e-9
Identity = 44/167 (26.35%), Postives = 69/167 (41.32%), Query Frame = 1
Query: 1867 WTVYSSWSDCSATCGNGTR-VRSRFCDNPKPQNGGKE----------------------------CTGNNTEYQICVNKKCDELNFENTR-----GRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLR 2265
            W  +SSWS+CS +CG G R VR R C + +   G  E                              G    ++ C+  +C   + +  R     G ++ W  WS+CS++CG   + R R+C+ +KC     E +SCN   C   I   W  W   +V+     ++R
Sbjct:  710 WEEWSSWSECSVSCGLGGREVRERKCSSGRKCQGVSEESRPCEGVLRDCEEFGEWKEWGSCSEKCALGVQKRFRPCLTDQCSSKHLQEERPCDNEGCWTNWDEWSSCSQSCGGGRRYRIRKCLDDKCDGDDLEKESCNTQKC---ISQSWGDWLPCSVSCGIGFQIR 873          

HSP 6 Score: 58.9214 bits (141), Expect = 2.644e-8
Identity = 37/118 (31.36%), Postives = 55/118 (46.61%), Query Frame = 1
Query: 1876 YSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTE-SLNEIKSCNLPLCEFKIYSQWSSWS 2226
            +  W  CS +CG G ++R R CD       G+ C   N + + C  ++C      +    +S+W  W+ CS TCG   +SR R C    CTE   ++ + C    CE   Y  WS W+
Sbjct:  856 WGDWLPCSVSCGIGFQIRERLCD-------GELCATANKQARTCNQQQCPSAFSLSV---WSEWGEWTTCSATCGEGLQSRERSCRRGSCTEDDASQTRRCVNGPCEHS-YLTWSEWT 962          

HSP 7 Score: 54.6842 bits (130), Expect = 5.148e-7
Identity = 42/148 (28.38%), Postives = 65/148 (43.92%), Query Frame = 1
Query: 1876 YSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCG-FSTKSRSRQCI--SEKCTESLNEIKSCNLPLC--------------EFKIYSQWSSWSKFNVTTFTKIRLRF 2268
            +S W  CS TCG+G RVR+R C           C   + + + C    C EL           W+ WS+CSK+CG    ++R + C+  + +C+      +  +LP C              +   +S+WSSWS  +  + T  R RF
Sbjct: 1041 WSEWGPCSVTCGSGRRVRTRGCQE-------ASCPEQHIQTEECNLNSCLELFI---------WSDWSSCSKSCGQDGIQTRQKLCLFNNAECSSYAESRRCKDLPSCSSISSGRTISENGFDAPRWSEWSSWSACSCFSLTSTRRRF 1172          

HSP 8 Score: 51.9878 bits (123), Expect = 3.225e-6
Identity = 30/93 (32.26%), Postives = 46/93 (49.46%), Query Frame = 1
Query: 1735 VQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPEC--KVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC 2007
            VQ R +S  +   + G     +   T L ++     P C  + DG+W+ ++ WS C   CG GTR R R C +P   +GG+ C G ++E   C
Sbjct: 1344 VQTRDRSCSSPEPKGGQSCSGLAHQTSLCDL-----PACDHESDGEWSAWNEWSGCMGNCGIGTRTRVRACVSPPVSDGGQPCFGRSSEITEC 1431          
BLAST of semaphorin 5-3 vs. Ensembl Celegans
Match: adt-2 (A disintegrin and metalloproteinase with thrombospondin motifs adt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q19204])

HSP 1 Score: 90.5077 bits (223), Expect = 4.003e-18
Identity = 89/327 (27.22%), Postives = 139/327 (42.51%), Query Frame = 1
Query: 1861 GDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDE-LNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEK------CTESLNEIKSC-NLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITPICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCET---RGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQC---SAAYSKWTEWSNCEE---NSFKTRKRQCLYNNNC 2790
            G W  +S W+ C+ATCG G R R+R C          +C GN  E ++C ++ C   L   N    +S WT W+ CS +CG  +++R R+C+S        C E   E++SC N P     ++  W  WS  + +      +R    +T   E  + S ++        SC+ A CQ        N          S  +   G     R+R+C    C G S + + C    C SS        + ++ C      G++ R R C    +  +C GN  E + C  + C   +AA+  W  WS+C E   +  + R R+C  + NC
Sbjct:  703 GQWGTWSLWTSCTATCGGGYRKRNRACSIT------GQCEGNEDETEVCSSESCPSVLRVGN---EWSTWTEWNHCSVSCGRGSQARYRKCLSPHRTLAFDCPEKNIEVRSCDNGPCNAIGVWGTWGGWSTCSTSCGPGTLVR---QRTCNREPCDGSAHERR------SCNVATCQ--------NDGIWSLWNEWSDCSRVCGKGLRSRSRSCFGSGCMGASSEQQFCNEQACASSSANDWGTWSGWSQCSVSCGAGVKRRTRTC----RTGNCPGNYKESAICNDRDCENKNAAWGGWGYWSSCSETCGDGVRKRVRKCYGSGNC 999          

HSP 2 Score: 79.337 bits (194), Expect = 1.367e-14
Identity = 45/141 (31.91%), Postives = 71/141 (50.35%), Query Frame = 1
Query: 1852 KVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCE-FKIYSQWSSWSKFNVTTFTKIRLRFK 2271
            +V  +W+ ++ W+ CS +CG G++ R R C +P  +    +C   N E + C N  C+ +      G +  W  WS CS +CG  T  R R C  E C  S +E +SCN+  C+   I+S W+ WS  +      +R R +
Sbjct:  755 RVGNEWSTWTEWNHCSVSCGRGSQARYRKCLSPH-RTLAFDCPEKNIEVRSCDNGPCNAI------GVWGTWGGWSTCSTSCGPGTLVRQRTCNREPCDGSAHERRSCNVATCQNDGIWSLWNEWSDCSRVCGKGLRSRSR 888          

HSP 3 Score: 77.411 bits (189), Expect = 5.193e-14
Identity = 49/157 (31.21%), Postives = 71/157 (45.22%), Query Frame = 1
Query: 1822 EIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCE---FKIYSQWSSWSKFNVTTFTKIRLRFKCIKT 2283
            E++   +  C   G W  +  WS CS +CG GT VR R C N +P      C G+  E + C    C         G +S W  WS CS+ CG   +SRSR C    C  + +E + CN   C       +  WS WS+ +V+    ++ R +  +T
Sbjct:  801 EVRSCDNGPCNAIGVWGTWGGWSTCSTSCGPGTLVRQRTC-NREP------CDGSAHERRSCNVATC------QNDGIWSLWNEWSDCSRVCGKGLRSRSRSCFGSGCMGASSEQQFCNEQACASSSANDWGTWSGWSQCSVSCGAGVKRRTRTCRT 944          

HSP 4 Score: 73.9442 bits (180), Expect = 5.756e-13
Identity = 41/113 (36.28%), Postives = 56/113 (49.56%), Query Frame = 1
Query: 1864 DWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLCEFK 2199
            DW  +S WS CS +CG G + R+R C           C GN  E  IC ++ C     EN    +  W  WS+CS+TCG   + R R+C  S  C     E + CNL +C+F+
Sbjct:  917 DWGTWSGWSQCSVSCGAGVKRRTRTCRT-------GNCPGNYKESAICNDRDC-----ENKNAAWGGWGYWSSCSETCGDGVRKRVRKCYGSGNCDGQQYEKQYCNLRVCDFR 1017          
BLAST of semaphorin 5-3 vs. Ensembl Celegans
Match: adt-2 (A disintegrin and metalloproteinase with thrombospondin motifs adt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q19204])

HSP 1 Score: 90.5077 bits (223), Expect = 4.003e-18
Identity = 89/327 (27.22%), Postives = 139/327 (42.51%), Query Frame = 1
Query: 1861 GDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDE-LNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEK------CTESLNEIKSC-NLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITPICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCET---RGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQC---SAAYSKWTEWSNCEE---NSFKTRKRQCLYNNNC 2790
            G W  +S W+ C+ATCG G R R+R C          +C GN  E ++C ++ C   L   N    +S WT W+ CS +CG  +++R R+C+S        C E   E++SC N P     ++  W  WS  + +      +R    +T   E  + S ++        SC+ A CQ        N          S  +   G     R+R+C    C G S + + C    C SS        + ++ C      G++ R R C    +  +C GN  E + C  + C   +AA+  W  WS+C E   +  + R R+C  + NC
Sbjct:  703 GQWGTWSLWTSCTATCGGGYRKRNRACSIT------GQCEGNEDETEVCSSESCPSVLRVGN---EWSTWTEWNHCSVSCGRGSQARYRKCLSPHRTLAFDCPEKNIEVRSCDNGPCNAIGVWGTWGGWSTCSTSCGPGTLVR---QRTCNREPCDGSAHERR------SCNVATCQ--------NDGIWSLWNEWSDCSRVCGKGLRSRSRSCFGSGCMGASSEQQFCNEQACASSSANDWGTWSGWSQCSVSCGAGVKRRTRTC----RTGNCPGNYKESAICNDRDCENKNAAWGGWGYWSSCSETCGDGVRKRVRKCYGSGNC 999          

HSP 2 Score: 79.337 bits (194), Expect = 1.367e-14
Identity = 45/141 (31.91%), Postives = 71/141 (50.35%), Query Frame = 1
Query: 1852 KVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCE-FKIYSQWSSWSKFNVTTFTKIRLRFK 2271
            +V  +W+ ++ W+ CS +CG G++ R R C +P  +    +C   N E + C N  C+ +      G +  W  WS CS +CG  T  R R C  E C  S +E +SCN+  C+   I+S W+ WS  +      +R R +
Sbjct:  755 RVGNEWSTWTEWNHCSVSCGRGSQARYRKCLSPH-RTLAFDCPEKNIEVRSCDNGPCNAI------GVWGTWGGWSTCSTSCGPGTLVRQRTCNREPCDGSAHERRSCNVATCQNDGIWSLWNEWSDCSRVCGKGLRSRSR 888          

HSP 3 Score: 77.411 bits (189), Expect = 5.193e-14
Identity = 49/157 (31.21%), Postives = 71/157 (45.22%), Query Frame = 1
Query: 1822 EIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCE---FKIYSQWSSWSKFNVTTFTKIRLRFKCIKT 2283
            E++   +  C   G W  +  WS CS +CG GT VR R C N +P      C G+  E + C    C         G +S W  WS CS+ CG   +SRSR C    C  + +E + CN   C       +  WS WS+ +V+    ++ R +  +T
Sbjct:  801 EVRSCDNGPCNAIGVWGTWGGWSTCSTSCGPGTLVRQRTC-NREP------CDGSAHERRSCNVATC------QNDGIWSLWNEWSDCSRVCGKGLRSRSRSCFGSGCMGASSEQQFCNEQACASSSANDWGTWSGWSQCSVSCGAGVKRRTRTCRT 944          

HSP 4 Score: 73.9442 bits (180), Expect = 5.756e-13
Identity = 41/113 (36.28%), Postives = 56/113 (49.56%), Query Frame = 1
Query: 1864 DWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLCEFK 2199
            DW  +S WS CS +CG G + R+R C           C GN  E  IC ++ C     EN    +  W  WS+CS+TCG   + R R+C  S  C     E + CNL +C+F+
Sbjct:  917 DWGTWSGWSQCSVSCGAGVKRRTRTCRT-------GNCPGNYKESAICNDRDC-----ENKNAAWGGWGYWSSCSETCGDGVRKRVRKCYGSGNCDGQQYEKQYCNLRVCDFR 1017          
BLAST of semaphorin 5-3 vs. Ensembl Celegans
Match: T21B6.3 (pep chromosome:WBcel235:X:10945160:10948970:-1 gene:WBGene00011880.1 transcript:T21B6.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T21B6.3)

HSP 1 Score: 79.337 bits (194), Expect = 9.266e-15
Identity = 81/335 (24.18%), Postives = 131/335 (39.10%), Query Frame = 1
Query: 1867 WTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS-----EKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCS--TADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETR---GMRMRNRKCIYDSKRTS----CRGNETEISDCPLKQCSA--AYSKWTEWSNCE-----ENSFKTRKRQCLYNNNC 2790
            W+ +  WS CSA+CG+G R R+RFC       G   C G + E + C    C E         +SQW  W  CS TCG     R R C+        C     E ++C+   C   ++S W  WS  + +  + ++ R    +  Q+ +     N+ +++   P C+  T  C++                               RTR C+ P       C G SI+  +C     +    C  +    ++ C+     G  +R R C+  +        C G + E  +C  + C+   A++ W EWS C      E   ++R RQC+  + C
Sbjct:  505 WSEWCEWSTCSASCGSGQRERTRFC-----HLGTNRCEGKDYESEQCSAGPCPE---------WSQWEDWGQCSVTCGQGVAVRQRTCLGGVFGDHLCQGPKTEQRACDGGPC--SLWSPWQEWSTCSASCGSGMKRR---QRVCQFGTDCQGPNEESQFCYGPPCAEWTEWCEWSGCSSKCGPG------------------QRTRTRGCLGPNGQEATTCQGPSIETTLC-----EGQSCCNWSEWCHWSMCDKECGGGQSIRTRTCLNSAGSPDSSCHCDGPDREEKECNSQSCAPQCAWNTWCEWSPCSTQLACEVGVQSRSRQCVGESGC 797          

HSP 2 Score: 63.1586 bits (152), Expect = 1.077e-9
Identity = 42/139 (30.22%), Postives = 61/139 (43.88%), Query Frame = 1
Query: 1855 VDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC--ISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLR 2265
            V G W  +S WS CS TCG+G + R R C           C G + E + C    C           +S+W  WS CS +CG   + R+R C   + +C     E + C+   C    +SQW  W + +VT    + +R
Sbjct:  454 VSGVWHDWSDWSTCSCTCGDGAKSRRRECST-------NNCQGADYETEPCNLGPCQ---------TWSEWCEWSTCSASCGSGQRERTRFCHLGTNRCEGKDYESEQCSAGPC--PEWSQWEDWGQCSVTCGQGVAVR 574          

HSP 3 Score: 62.003 bits (149), Expect = 2.378e-9
Identity = 43/144 (29.86%), Postives = 59/144 (40.97%), Query Frame = 1
Query: 1822 EIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISE--------KCTESLNEIKSCN----LPLCEFKIYSQWS 2217
            E +    P C    +WT +  WS CS+ CG G R R+R C  P  Q     C G + E  +C  + C           +S+W  WS C K CG     R+R C++          C     E K CN     P C +  + +WS
Sbjct:  642 ESQFCYGPPCA---EWTEWCEWSGCSSKCGPGQRTRTRGCLGPNGQE-ATTCQGPSIETTLCEGQSC---------CNWSEWCHWSMCDKECGGGQSIRTRTCLNSAGSPDSSCHCDGPDREEKECNSQSCAPQCAWNTWCEWS 772          
BLAST of semaphorin 5-3 vs. Ensembl Celegans
Match: adt-2 (A disintegrin and metalloproteinase with thrombospondin motifs adt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q19204])

HSP 1 Score: 79.337 bits (194), Expect = 1.118e-14
Identity = 45/141 (31.91%), Postives = 71/141 (50.35%), Query Frame = 1
Query: 1852 KVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCE-FKIYSQWSSWSKFNVTTFTKIRLRFK 2271
            +V  +W+ ++ W+ CS +CG G++ R R C +P  +    +C   N E + C N  C+ +      G +  W  WS CS +CG  T  R R C  E C  S +E +SCN+  C+   I+S W+ WS  +      +R R +
Sbjct:  755 RVGNEWSTWTEWNHCSVSCGRGSQARYRKCLSPH-RTLAFDCPEKNIEVRSCDNGPCNAI------GVWGTWGGWSTCSTSCGPGTLVRQRTCNREPCDGSAHERRSCNVATCQNDGIWSLWNEWSDCSRVCGKGLRSRSR 888          

HSP 2 Score: 77.411 bits (189), Expect = 5.039e-14
Identity = 49/157 (31.21%), Postives = 71/157 (45.22%), Query Frame = 1
Query: 1822 EIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLC---EFKIYSQWSSWSKFNVTTFTKIRLRFKCIKT 2283
            E++   +  C   G W  +  WS CS +CG GT VR R C N +P      C G+  E + C    C         G +S W  WS CS+ CG   +SRSR C    C  + +E + CN   C       +  WS WS+ +V+    ++ R +  +T
Sbjct:  801 EVRSCDNGPCNAIGVWGTWGGWSTCSTSCGPGTLVRQRTC-NREP------CDGSAHERRSCNVATC------QNDGIWSLWNEWSDCSRVCGKGLRSRSRSCFGSGCMGASSEQQFCNEQACASSSANDWGTWSGWSQCSVSCGAGVKRRTRTCRT 944          

HSP 3 Score: 75.0998 bits (183), Expect = 2.370e-13
Identity = 44/130 (33.85%), Postives = 65/130 (50.00%), Query Frame = 1
Query: 1861 GDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDE-LNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEK------CTESLNEIKSC-NLPLCEFKIYSQWSSWS 2226
            G W  +S W+ C+ATCG G R R+R C          +C GN  E ++C ++ C   L   N    +S WT W+ CS +CG  +++R R+C+S        C E   E++SC N P     ++  W  WS
Sbjct:  703 GQWGTWSLWTSCTATCGGGYRKRNRACSIT------GQCEGNEDETEVCSSESCPSVLRVGN---EWSTWTEWNHCSVSCGRGSQARYRKCLSPHRTLAFDCPEKNIEVRSCDNGPCNAIGVWGTWGGWS 823          
BLAST of semaphorin 5-3 vs. Ensembl Fly
Match: Sema5c (gene:FBgn0284221 transcript:FBtr0300339)

HSP 1 Score: 126.331 bits (316), Expect = 5.678e-29
Identity = 128/556 (23.02%), Postives = 211/556 (37.95%), Query Frame = 1
Query:  781 IITSFQHNKSVYFLYTET---DFLCGCKENVLVTRLIRLCENDKG----LTSEQFSVFNKVNVECQQVNSNRAIP---PFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINLQTLCKTYPLHRDIVTSQAI-------LYETR-TKFFEIASEESSWSNNRRVVLFVSTQTKHVT--SLLEISLQPKICILRKFLLSENIT--LLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQC---SAPFCYWDNITKKCKYVSTKNQFLL-ISNSKTYCASSLKENQNAVLNQW---------------VQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVN-KKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTESLNEIKSCNLPLC-EFKIYSQWSSW-----SKFNVTTFTKIRLRFKCIKT 2283
             + SF+    VYFL  E+      CG    V+ +R+ R+C+ND G    L  + ++ F K  + C       ++P   P+ +       +      L  TF ++      SA+C Y + SI  AF+   K+          E+ +        NQ S F     ++       R  +  +A+       LY ++  +F  +A +  +    +  VLFV++   H+   S+       + C++  +   +  T  LL          L++GT   + +IP   C    + + C     P+C W+ + ++C      +  L     +       L    +   + W                QCR +S  N   Q G   C         E   T    C   G WT +S+WS CS TCG   ++R R C NP+P  GG+ C G+      C +   C     ++  G +  W  WS CS  CG   + R R+C          +C     + + CN+  C E +  S W+ W     S  +     + R RF C  T
Sbjct:  233 FVGSFEAGHFVYFLLRESAAEHMSCG---KVIYSRVARVCKNDVGGGGQLLRDNWTSFLKARLNC-------SLPGEYPYYFDEIQGMTYAESESILYATFRTSGSSIFGSAVCAYNLSSINAAFDGPFKQ---------QEHSDAAWKTVNTNQRSQFQCGTSSIGHWLESSRYQLMDEAVQPIGAEPLYHSKLEQFGRLALDIINTKTEQVHVLFVASSGNHIKKLSVKYDGDGVQTCLVELWQADDTGTSSLLNMAYLKVSDSLYLGTDLALTRIPAQHCSRHVSQSSCLNSMDPYCGWNELVERCMPQPQDSSVLQHWHQAPQITCPVLNAPIDGGWSTWSPWAVCQQHEQPDSNCQCRQRSCNNPQPQHGGATC---------EGISTQVTNCTQHGGWTEWSAWSPCSQTCGIAVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVAKPQSVDGGWGPWGEWSECSAQCGGGFRMRRRECNDPAPLNGGMECPGCRLDYEECNMQSCQEVRKLSAWTPWLTVTGSGNSSEPHMERRFRFVCRAT 760          

HSP 2 Score: 57.3806 bits (137), Expect = 8.180e-8
Identity = 40/142 (28.17%), Postives = 65/142 (45.77%), Query Frame = 1
Query: 1879 SSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC--------DELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEK---CTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFK 2271
            + WS CS +CG G + R R               G  ++ ++C    C        + L+ E   G +  W+ WSACS TCG   + R+R+C++     C     E + C +  CE   +  WS+WS+++  +   IRLR +
Sbjct:  799 ADWSPCSVSCGGGVQQRHR---------------GRGSQSRVCNIHACPAEEQLSSNSLDNELEHGEWGCWSEWSACSVTCGLGLRRRTRRCLAGHDRLCQGRALEEQKCEMVPCE--DFLGWSAWSEWSSCSSDGIRLRHR 923          
BLAST of semaphorin 5-3 vs. Ensembl Fly
Match: Sema5c (gene:FBgn0284221 transcript:FBtr0076052)

HSP 1 Score: 126.331 bits (316), Expect = 5.937e-29
Identity = 128/556 (23.02%), Postives = 211/556 (37.95%), Query Frame = 1
Query:  781 IITSFQHNKSVYFLYTET---DFLCGCKENVLVTRLIRLCENDKG----LTSEQFSVFNKVNVECQQVNSNRAIP---PFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINLQTLCKTYPLHRDIVTSQAI-------LYETR-TKFFEIASEESSWSNNRRVVLFVSTQTKHVT--SLLEISLQPKICILRKFLLSENIT--LLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQC---SAPFCYWDNITKKCKYVSTKNQFLL-ISNSKTYCASSLKENQNAVLNQW---------------VQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVN-KKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTESLNEIKSCNLPLC-EFKIYSQWSSW-----SKFNVTTFTKIRLRFKCIKT 2283
             + SF+    VYFL  E+      CG    V+ +R+ R+C+ND G    L  + ++ F K  + C       ++P   P+ +       +      L  TF ++      SA+C Y + SI  AF+   K+          E+ +        NQ S F     ++       R  +  +A+       LY ++  +F  +A +  +    +  VLFV++   H+   S+       + C++  +   +  T  LL          L++GT   + +IP   C    + + C     P+C W+ + ++C      +  L     +       L    +   + W                QCR +S  N   Q G   C         E   T    C   G WT +S+WS CS TCG   ++R R C NP+P  GG+ C G+      C +   C     ++  G +  W  WS CS  CG   + R R+C          +C     + + CN+  C E +  S W+ W     S  +     + R RF C  T
Sbjct:  235 FVGSFEAGHFVYFLLRESAAEHMSCG---KVIYSRVARVCKNDVGGGGQLLRDNWTSFLKARLNC-------SLPGEYPYYFDEIQGMTYAESESILYATFRTSGSSIFGSAVCAYNLSSINAAFDGPFKQ---------QEHSDAAWKTVNTNQRSQFQCGTSSIGHWLESSRYQLMDEAVQPIGAEPLYHSKLEQFGRLALDIINTKTEQVHVLFVASSGNHIKKLSVKYDGDGVQTCLVELWQADDTGTSSLLNMAYLKVSDSLYLGTDLALTRIPAQHCSRHVSQSSCLNSMDPYCGWNELVERCMPQPQDSSVLQHWHQAPQITCPVLNAPIDGGWSTWSPWAVCQQHEQPDSNCQCRQRSCNNPQPQHGGATC---------EGISTQVTNCTQHGGWTEWSAWSPCSQTCGIAVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVAKPQSVDGGWGPWGEWSECSAQCGGGFRMRRRECNDPAPLNGGMECPGCRLDYEECNMQSCQEVRKLSAWTPWLTVTGSGNSSEPHMERRFRFVCRAT 762          

HSP 2 Score: 57.3806 bits (137), Expect = 8.538e-8
Identity = 40/142 (28.17%), Postives = 65/142 (45.77%), Query Frame = 1
Query: 1879 SSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC--------DELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEK---CTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFK 2271
            + WS CS +CG G + R R               G  ++ ++C    C        + L+ E   G +  W+ WSACS TCG   + R+R+C++     C     E + C +  CE   +  WS+WS+++  +   IRLR +
Sbjct:  801 ADWSPCSVSCGGGVQQRHR---------------GRGSQSRVCNIHACPAEEQLSSNSLDNELEHGEWGCWSEWSACSVTCGLGLRRRTRRCLAGHDRLCQGRALEEQKCEMVPCE--DFLGWSAWSEWSSCSSDGIRLRHR 925          
BLAST of semaphorin 5-3 vs. Ensembl Fly
Match: AdamTS-B (gene:FBgn0029791 transcript:FBtr0301084)

HSP 1 Score: 63.5438 bits (153), Expect = 8.804e-10
Identity = 26/56 (46.43%), Postives = 33/56 (58.93%), Query Frame = 1
Query: 1855 VDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC 2022
            V+G W  +S WS+CS +CG G   + R CDNP P NGG  C G    Y+IC  + C
Sbjct:  610 VNGGWGDWSEWSECSRSCGGGVSTQQRECDNPVPANGGVFCIGERKRYKICRKRPC 665          
BLAST of semaphorin 5-3 vs. Ensembl Fly
Match: AdamTS-B (gene:FBgn0029791 transcript:FBtr0301083)

HSP 1 Score: 63.1586 bits (152), Expect = 1.391e-9
Identity = 26/56 (46.43%), Postives = 33/56 (58.93%), Query Frame = 1
Query: 1855 VDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC 2022
            V+G W  +S WS+CS +CG G   + R CDNP P NGG  C G    Y+IC  + C
Sbjct:  610 VNGGWGDWSEWSECSRSCGGGVSTQQRECDNPVPANGGVFCIGERKRYKICRKRPC 665          
BLAST of semaphorin 5-3 vs. Ensembl Fly
Match: Sema2a (gene:FBgn0011260 transcript:FBtr0087090)

HSP 1 Score: 61.6178 bits (148), Expect = 3.702e-9
Identity = 73/308 (23.70%), Postives = 137/308 (44.48%), Query Frame = 1
Query:  778 DIITSFQHNKSVYFLYTET--DFL-CGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSK-QLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSY---KFNEYKNICQLFTTGNQDSNFLINLQTLCKTYPLHRDIVTSQ---AILYETRTKFFEIASEESSWS--NNRRVVLFVSTQTKHVTSLLEI-----SLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDT-QC-SAPFCYWDNITKKCK 1635
            + + SF   + VYF + ET  +++ CG     + +R+ R+C+ D G   L +  ++ + K  + C    S     PF +    + + L   K +   TFT++      SA+C + I  I+ AFN + K+ S   S      N      +  T  N  SN    +    +++PL    V  +    + Y+    F ++  ++      N   +V +V T    +  +++      SL  K+  + +   +E I +++ +++T K  L++GT HRI +I L MC  +  +  +C   P+C WD     C+
Sbjct:  254 NFVGSFDIGEYVYFFFRETAVEYINCG---KAVYSRIARVCKKDVGGKNLLAHNWATYLKARLNC----SISGEFPFYFNEIQSVYQLPSDKSRFFATFTTSTNGLIGSAVCSFHINEIQAAFNGKFKEQSSSNSAWLPVLNSRVPEPRPGTCVNDTSNLPDTVLNFIRSHPLMDKAVNHEHNNPVYYKRDLVFTKLVVDKIRIDILNQEYIVYYVGTNLGRIYKIVQYYRNGESLS-KLLDIFEVAPNEAIQVME-ISQTRKS-LYIGTDHRIKQIDLAMCNRRYDNCFRCVRDPYCGWDKEANTCR 551          
BLAST of semaphorin 5-3 vs. Ensembl Zebrafish
Match: sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:ZFIN;Acc:ZDB-GENE-030131-8969])

HSP 1 Score: 172.94 bits (437), Expect = 2.231e-43
Identity = 217/942 (23.04%), Postives = 368/942 (39.07%), Query Frame = 1
Query:  205 YPVLNMTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN-----------FDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDIVTSQAILY--ETRTKFFEIASEESSWSNNRRVVLFVST-------------QTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISP---------ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCN-LPLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPS------CSTADCQFKNNK---QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMC---PIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFP 2799
            +P+++ T    +  +H++      ++  L++ P  + + +V   N + RL L +L+           F       +  + E+C+  I          ++L +  + +    TN     +C      NL   H  Q +G     +   +  +H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C   V  +R  R+C+ND G   L  + ++ F K  + C +        PF Y       +L   + L   FT+N     +SA+C + + +I   F+   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  +     + Y  E   +F  +A +     +    +++++T             QT     L EI L P    L+K     ++ +L + +E     LFVG   +++KIPL  C    +   C     P+C WD + KKC  +           S T C   +   +      + W  C      +D   +G C+C   R  D    +    P          C  +G WT +++W+ CS +CG G +VR R C NP P++GG+ C G N E + C  +  C    +      +S W+ W  C+  CG   +SR R C    +C     E +SCN LP  + K  + W+ W+  N++      + R R+ C K    E   L +      + Y S      CST     ++ +     +NG +S W  WS CS  C      R+ R C  P        C G + +++ C   P  +  S            T C   G  MR R C           C G  TE + C ++ C  ++S W+EWS C+ +  + R R C    + LFP
Sbjct:   43 HPLISHTDIEPW--IHRFRAEGTVDYSQLTFDPGQNEL-IVGARNHLFRLHLEDLSLIQEAEWHCDEFTKGACFSRGKSEEECQNYI----------RVLLVNGDRLFTCGTNAFTP-ICTNRTLTNLTEVH-DQISGM----ARCPYNPLHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGRTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEI----PFNYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFKYQ-ENSRSAWLPYPNPNPDFQCGTIDFGSYVNLTERNLQDAQKFILMHEVVQPVVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELFP----LKKRQPIRSLLILHSHSE-----LFVGVREQVIKIPLMRCNFHKSREACVGARDPYCGWDLVLKKCTTLEESVSMSQWEQSITRCPVRNVTVDGHYGAWSGWKTCSH----SDGGSVGSCQCRT-RACDSPSPQCGGQPCQGISVEVANCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLPCPPHVY------WSAWSPWERCTVPCGGGIQSRRRTCENGNECPGCSTEFQSCNTLPCPDLKKTTPWTPWTPVNISDNGGHYEQRFRYTC-KARVPEPGLLEVGRQRIEMRYCSSDGSTGCSTDGDLLRSGRITGLTVNGGWSVWGPWSQCSRDCSSGVRNRK-RTCSNPKPKYGGITCLGPAQEFQECNTTPCPVDGSWSCWSPWSKCSVT-CGG-GHYMRTRSCNNPPPAYGGDICLGLHTEEALCNIQPCPESWSDWSEWSPCDSSGSQVRLRHC----DVLFP 930          

HSP 2 Score: 80.4925 bits (197), Expect = 9.650e-15
Identity = 43/121 (35.54%), Postives = 63/121 (52.07%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-----ISEKCTESLNEIKSCNLPLCEF 2196
            C VDG W+ +S WS CS TCG G  +R+R C+NP P  GG  C G +TE  +C  + C E         +S W+ WS C  +    ++ R R C        +C+ + +E ++C LP+  F
Sbjct:  843 CPVDGSWSCWSPWSKCSVTCGGGHYMRTRSCNNPPPAYGGDICLGLHTEEALCNIQPCPE--------SWSDWSEWSPCDSS---GSQVRLRHCDVLFPTGNQCSGNSSETRAC-LPISNF 951          
BLAST of semaphorin 5-3 vs. Ensembl Zebrafish
Match: sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:ZFIN;Acc:ZDB-GENE-030131-8969])

HSP 1 Score: 172.17 bits (435), Expect = 4.532e-43
Identity = 217/942 (23.04%), Postives = 368/942 (39.07%), Query Frame = 1
Query:  205 YPVLNMTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN-----------FDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDIVTSQAILY--ETRTKFFEIASEESSWSNNRRVVLFVST-------------QTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISP---------ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCN-LPLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPS------CSTADCQFKNNK---QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMC---PIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFP 2799
            +P+++ T    +  +H++      ++  L++ P  + + +V   N + RL L +L+           F       +  + E+C+  I          ++L +  + +    TN     +C      NL   H  Q +G     +   +  +H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C   V  +R  R+C+ND G   L  + ++ F K  + C +        PF Y       +L   + L   FT+N     +SA+C + + +I   F+   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  +     + Y  E   +F  +A +     +    +++++T             QT     L EI L P    L+K     ++ +L + +E     LFVG   +++KIPL  C    +   C     P+C WD + KKC  +           S T C   +   +      + W  C      +D   +G C+C   R  D    +    P          C  +G WT +++W+ CS +CG G +VR R C NP P++GG+ C G N E + C  +  C    +      +S W+ W  C+  CG   +SR R C    +C     E +SCN LP  + K  + W+ W+  N++      + R R+ C K    E   L +      + Y S      CST     ++ +     +NG +S W  WS CS  C      R+ R C  P        C G + +++ C   P  +  S            T C   G  MR R C           C G  TE + C ++ C  ++S W+EWS C+ +  + R R C    + LFP
Sbjct:   43 HPLISHTDIEPW--IHRFRAEGTVDYSQLTFDPGQNEL-IVGARNHLFRLHLEDLSLIQEAEWHCDEFTKGACFSRGKSEEECQNYI----------RVLLVNGDRLFTCGTNAFT-PICTNRTLTNLTEVH-DQISGM----ARCPYNPLHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGRTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEI----PFNYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFKYQ-ENSRSAWLPYPNPNPDFQCGTIDFGSYVNLTERNLQDAQKFILMHEVVQPVVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELFP----LKKRQPIRSLLILHSHSE-----LFVGVREQVIKIPLMRCNFHKSREACVGARDPYCGWDLVLKKCTTLEESVSMSQWEQSITRCPVRNVTVDGHYGAWSGWKTCSH----SDGGSVGSCQCRT-RACDSPSPQCGGQPCQGISVEVANCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLPCPPHVY------WSAWSPWERCTVPCGGGIQSRRRTCENGNECPGCSTEFQSCNTLPCPDLKKTTPWTPWTPVNISDNGGHYEQRFRYTC-KARVPEPGLLEVGRQRIEMRYCSSDGSTGCSTDGDLLRSGRITGLTVNGGWSVWGPWSQCSRDCSSGVRNRK-RTCSNPKPKYGGITCLGPAQEFQECNTTPCPVDGSWSCWSPWSKCSVT-CGG-GHYMRTRSCNNPPPAYGGDICLGLHTEEALCNIQPCPESWSDWSEWSPCDSSGSQVRLRHC----DVLFP 930          

HSP 2 Score: 80.4925 bits (197), Expect = 1.019e-14
Identity = 53/175 (30.29%), Postives = 79/175 (45.14%), Query Frame = 1
Query: 1717 AVLNQWVQC----------RLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-----ISEKCTESLNEIKSCNLPLCEF 2196
            +V   W QC          R ++  N   + G   C +    +  E   T    C VDG W+ +S WS CS TCG G  +R+R C+NP P  GG  C G +TE  +C  + C E         +S W+ WS C  +    ++ R R C        +C+ + +E ++C LP+  F
Sbjct:  793 SVWGPWSQCSRDCSSGVRNRKRTCSNPKPKYGGITC-LGPAQEFQECNTT---PCPVDGSWSCWSPWSKCSVTCGGGHYMRTRSCNNPPPAYGGDICLGLHTEEALCNIQPCPE--------SWSDWSEWSPCDSS---GSQVRLRHCDVLFPTGNQCSGNSSETRAC-LPISNF 951          
BLAST of semaphorin 5-3 vs. Ensembl Zebrafish
Match: sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:ZFIN;Acc:ZDB-GENE-030131-8969])

HSP 1 Score: 172.17 bits (435), Expect = 4.532e-43
Identity = 217/942 (23.04%), Postives = 368/942 (39.07%), Query Frame = 1
Query:  205 YPVLNMTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN-----------FDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDIVTSQAILY--ETRTKFFEIASEESSWSNNRRVVLFVST-------------QTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISP---------ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCN-LPLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPS------CSTADCQFKNNK---QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMC---PIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFP 2799
            +P+++ T    +  +H++      ++  L++ P  + + +V   N + RL L +L+           F       +  + E+C+  I          ++L +  + +    TN     +C      NL   H  Q +G     +   +  +H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C   V  +R  R+C+ND G   L  + ++ F K  + C +        PF Y       +L   + L   FT+N     +SA+C + + +I   F+   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  +     + Y  E   +F  +A +     +    +++++T             QT     L EI L P    L+K     ++ +L + +E     LFVG   +++KIPL  C    +   C     P+C WD + KKC  +           S T C   +   +      + W  C      +D   +G C+C   R  D    +    P          C  +G WT +++W+ CS +CG G +VR R C NP P++GG+ C G N E + C  +  C    +      +S W+ W  C+  CG   +SR R C    +C     E +SCN LP  + K  + W+ W+  N++      + R R+ C K    E   L +      + Y S      CST     ++ +     +NG +S W  WS CS  C      R+ R C  P        C G + +++ C   P  +  S            T C   G  MR R C           C G  TE + C ++ C  ++S W+EWS C+ +  + R R C    + LFP
Sbjct:   43 HPLISHTDIEPW--IHRFRAEGTVDYSQLTFDPGQNEL-IVGARNHLFRLHLEDLSLIQEAEWHCDEFTKGACFSRGKSEEECQNYI----------RVLLVNGDRLFTCGTNAFT-PICTNRTLTNLTEVH-DQISGM----ARCPYNPLHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGRTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEI----PFNYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFKYQ-ENSRSAWLPYPNPNPDFQCGTIDFGSYVNLTERNLQDAQKFILMHEVVQPVVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELFP----LKKRQPIRSLLILHSHSE-----LFVGVREQVIKIPLMRCNFHKSREACVGARDPYCGWDLVLKKCTTLEESVSMSQWEQSITRCPVRNVTVDGHYGAWSGWKTCSH----SDGGSVGSCQCRT-RACDSPSPQCGGQPCQGISVEVANCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLPCPPHVY------WSAWSPWERCTVPCGGGIQSRRRTCENGNECPGCSTEFQSCNTLPCPDLKKTTPWTPWTPVNISDNGGHYEQRFRYTC-KARVPEPGLLEVGRQRIEMRYCSSDGSTGCSTDGDLLRSGRITGLTVNGGWSVWGPWSQCSRDCSSGVRNRK-RTCSNPKPKYGGITCLGPAQEFQECNTTPCPVDGSWSCWSPWSKCSVT-CGG-GHYMRTRSCNNPPPAYGGDICLGLHTEEALCNIQPCPESWSDWSEWSPCDSSGSQVRLRHC----DVLFP 930          

HSP 2 Score: 80.4925 bits (197), Expect = 1.019e-14
Identity = 53/175 (30.29%), Postives = 79/175 (45.14%), Query Frame = 1
Query: 1717 AVLNQWVQC----------RLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-----ISEKCTESLNEIKSCNLPLCEF 2196
            +V   W QC          R ++  N   + G   C +    +  E   T    C VDG W+ +S WS CS TCG G  +R+R C+NP P  GG  C G +TE  +C  + C E         +S W+ WS C  +    ++ R R C        +C+ + +E ++C LP+  F
Sbjct:  793 SVWGPWSQCSRDCSSGVRNRKRTCSNPKPKYGGITC-LGPAQEFQECNTT---PCPVDGSWSCWSPWSKCSVTCGGGHYMRTRSCNNPPPAYGGDICLGLHTEEALCNIQPCPE--------SWSDWSEWSPCDSS---GSQVRLRHCDVLFPTGNQCSGNSSETRAC-LPISNF 951          
BLAST of semaphorin 5-3 vs. Ensembl Zebrafish
Match: sema5bb (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Bb [Source:ZFIN;Acc:ZDB-GENE-130530-778])

HSP 1 Score: 171.785 bits (434), Expect = 6.273e-43
Identity = 219/989 (22.14%), Postives = 399/989 (40.34%), Query Frame = 1
Query:  121 MIYYAKYLEFV--TILNIFIIPVLSLINLH-----------------YPVLNMTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQC-----TSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLAS--DHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGD--IITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELK-KSSEKTSY--KFNEYKNI-CQLFTTGNQDSNFL-INLQTLCKTYPLHRDIV---TSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQP-KICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQW-----------------VQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTAD----CQ--------FKNNKQI--INGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDY-----KMCPIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC 2772
            M+++A  L FV   I ++  +PV++                      +PV + T+   +  L  +++    ++  L+   +   + +V   N + RL L+N++      +    T ++ C     T ++C+  +          ++L +  + +    TN     +C      +++S  D I+         +   +   H++T+  T +G    +       ++P+++   +L N+  +   +   K   D   I++++ ++  Y    E      C + V  +R+ R+C+ND G   L  + ++ F K  + C    S     PF Y    +  +L     +   FT+N     +SA+C + + +I  AFN   + + + +TS+    N   N  C         +N    +LQ   + + L  D+V   ++  ++ +   +F ++A +     +    V+++ T+   +   L  + +  + C L +  +      E I  L+ ++ +D+  LFVG   R++KIPL+ C    T+  C     P+C WD   K+C  +   +     S   T C       Q+   + W                  QCR ++  +   Q G  KC +  N ++          C  +G WT +SSW++CS +CG G  VR R C+NP P++GG+ C G   E ++     C+E N       +  W+ WS CS  CG   +SR R C     C     E ++CNL  C E +  + W+ W   NVT      + R+R+ C +    +  +L L    R I    C T D    C+         +  + +  + G      E  S  +      +  R R+C  P        C G  ++Y     + CP+    S W+ WS  ST        G   R+R C   +   S   C G  TE + C   +C   +  W+EW+ C     + R R C
Sbjct:    4 MVFWAGSLSFVGLVIFHLLFLPVVTSQTPSSPPDTPDPQPEECRRKMHPVTSYTALSPW--LFSFSVPGVNDYSPLTLDLSRSQL-IVGARNHLFRLSLSNISLLQATEWGVDETTRRSCQSKGKTEDECQNYV----------RVLLLNGSRLFTCGTNAFM-PVCVTRPVTDISSVLDSISG-------VARCPYDPRHNSTAMITESGEVYAATVTDFSSRDPIIYR--SLGNMPPLRTAQYNSKWLNDPHFISAYEVSRFTYVFLRENAVEQDCGKTVF-SRVARVCQNDIGGRFLLEDTWTTFMKARLNC----SRSGDVPFYYHELQSTFYLPEQDLIYGVFTTNVNSIAASAVCAFNLSAITQAFNGPFRYQENPRTSWLSTPNPVPNFQCGTVNDSGPGANLTERSLQDAQRLF-LMSDVVQPISTDPLVMQDNIRFSKLAVDIVQGRDTLYHVMYIGTEYGTIIKALSTNNKSLRGCYLEEMNILPGNKQEPILNLQILH-SDR-SLFVGLPSRVLKIPLERCSNYITEQDCLGARDPYCGWDRKEKRCTTIEDSSNMSQWSQDITKCPER-NLTQDGGFSDWSTWQACNHDDGGEGISTCQCRTRACDHPRPQCGGLKC-VGANIEVAN--------CSRNGGWTPWSSWAECSTSCGIGFEVRQRSCNNPSPRHGGRVCVGQAREERL-----CNEKNPCPVPMSWVSWSAWSKCSVACGGGVQSRVRTCENGNTCPGCPLEYRACNLDSCAEVRRTTPWTPWYPVNVTQLGARQEQRVRYTC-RALLADPHDLQLGK--RKIETRLCPTTDGAAACETDGLVEDLLRMGRPVTRVQGAAWALWETWSTCSKECSKGFRTRKRSCAAPDGKSTPFACSGAPVEYQDCNTQPCPVKGAWSCWSSWSQCSTSC----GGGHHQRSRSCSNPAPAYSGDICIGLHTEEALCNTHECEGGWGAWSEWAECNGEGLQLRARTC 939          
BLAST of semaphorin 5-3 vs. Ensembl Zebrafish
Match: sema5bb (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Bb [Source:ZFIN;Acc:ZDB-GENE-130530-778])

HSP 1 Score: 171.4 bits (433), Expect = 8.421e-43
Identity = 219/989 (22.14%), Postives = 399/989 (40.34%), Query Frame = 1
Query:  121 MIYYAKYLEFV--TILNIFIIPVLSLINLH-----------------YPVLNMTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQC-----TSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLAS--DHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGD--IITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELK-KSSEKTSY--KFNEYKNI-CQLFTTGNQDSNFL-INLQTLCKTYPLHRDIV---TSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQP-KICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQW-----------------VQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTAD----CQ--------FKNNKQI--INGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDY-----KMCPIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC 2772
            M+++A  L FV   I ++  +PV++                      +PV + T+   +  L  +++    ++  L+   +   + +V   N + RL L+N++      +    T ++ C     T ++C+  +          ++L +  + +    TN     +C      +++S  D I+         +   +   H++T+  T +G    +       ++P+++   +L N+  +   +   K   D   I++++ ++  Y    E      C + V  +R+ R+C+ND G   L  + ++ F K  + C    S     PF Y    +  +L     +   FT+N     +SA+C + + +I  AFN   + + + +TS+    N   N  C         +N    +LQ   + + L  D+V   ++  ++ +   +F ++A +     +    V+++ T+   +   L  + +  + C L +  +      E I  L+ ++ +D+  LFVG   R++KIPL+ C    T+  C     P+C WD   K+C  +   +     S   T C       Q+   + W                  QCR ++  +   Q G  KC +  N ++          C  +G WT +SSW++CS +CG G  VR R C+NP P++GG+ C G   E ++     C+E N       +  W+ WS CS  CG   +SR R C     C     E ++CNL  C E +  + W+ W   NVT      + R+R+ C +    +  +L L    R I    C T D    C+         +  + +  + G      E  S  +      +  R R+C  P        C G  ++Y     + CP+    S W+ WS  ST        G   R+R C   +   S   C G  TE + C   +C   +  W+EW+ C     + R R C
Sbjct:    4 MVFWAGSLSFVGLVIFHLLFLPVVTSQTPSSPPDTPDPQPEECRRKMHPVTSYTALSPW--LFSFSVPGVNDYSPLTLDLSRSQL-IVGARNHLFRLSLSNISLLQATEWGVDETTRRSCQSKGKTEDECQNYV----------RVLLLNGSRLFTCGTNAFM-PVCVTRPVTDISSVLDSISG-------VARCPYDPRHNSTAMITESGEVYAATVTDFSSRDPIIYR--SLGNMPPLRTAQYNSKWLNDPHFISAYEVSRFTYVFLRENAVEQDCGKTVF-SRVARVCQNDIGGRFLLEDTWTTFMKARLNC----SRSGDVPFYYHELQSTFYLPEQDLIYGVFTTNVNSIAASAVCAFNLSAITQAFNGPFRYQENPRTSWLSTPNPVPNFQCGTVNDSGPGANLTERSLQDAQRLF-LMSDVVQPISTDPLVMQDNIRFSKLAVDIVQGRDTLYHVMYIGTEYGTIIKALSTNNKSLRGCYLEEMNILPGNKQEPILNLQILH-SDR-SLFVGLPSRVLKIPLERCSNYITEQDCLGARDPYCGWDRKEKRCTTIEDSSNMSQWSQDITKCPER-NLTQDGGFSDWSTWQACNHDDGGEGISTCQCRTRACDHPRPQCGGLKC-VGANIEVAN--------CSRNGGWTPWSSWAECSTSCGIGFEVRQRSCNNPSPRHGGRVCVGQAREERL-----CNEKNPCPVPMSWVSWSAWSKCSVACGGGVQSRVRTCENGNTCPGCPLEYRACNLDSCAEVRRTTPWTPWYPVNVTQLGARQEQRVRYTC-RALLADPHDLQLGK--RKIETRLCPTTDGAAACETDGLVEDLLRMGRPVTRVQGAAWALWETWSTCSKECSKGFRTRKRSCAAPDGKSTPFACSGAPVEYQDCNTQPCPVKGAWSCWSSWSQCSTSC----GGGHHQRSRSCSNPAPAYSGDICIGLHTEEALCNTHECEGGWGAWSEWAECNGEGLQLRARTC 939          
BLAST of semaphorin 5-3 vs. Ensembl Xenopus
Match: SEMA5B (semaphorin 5B [Source:NCBI gene;Acc:100493363])

HSP 1 Score: 107.457 bits (267), Expect = 4.910e-23
Identity = 120/437 (27.46%), Postives = 181/437 (41.42%), Query Frame = 1
Query: 1603 CYWDNITKKCKYVSTKNQ----------FLLISNSKTYCA----SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQYESFNLSLN-DITRYIVYPSCSTADCQ--------FKNNK---QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMC-PIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNN 2784
            C+W  + K  K+     Q           L I N   +      SS +  Q++  +    CR +   N L + G       R+ D   I++     C  +G WT +SSW+ CS +CG G +VR R C NP P+ GG+ C G + E + C  N  C    F      ++ W +W+ CS  CG  T SR R C     C     E + CN   C E +  + W+ W+  N+T      + R R+ C +    +  NL      T     P+  +A C+         +N+K   + ++G +S WS WSSCS  C+    TR+ R C  P        C G +++Y+ C P            +  T  +     G   R R C           C G  TE + C    C   +++W+EWS C E+  + R R C  +N
Sbjct:  177 CWWGPLPKGPKWPIPVRQPDPGPDPITLLLQIRNLTVHGGLGPWSSWQPCQHSDGDSSCLCRSRVCDNPLPRCG------GRDCDGTRIEIA---NCSRNGGWTPWSSWAQCSTSCGIGFQVRQRTCSNPAPRFGGRVCVGQSREERFCNENSPCPVPIF------WTSWGSWTKCSSDCGGGTHSRQRSCENGNTCPGCAMEFRPCNSEPCPEVRRNTPWTPWTPVNITQGGARQEQRFRYTC-RAQLADPHNLQFGRKKTETRFCPNDGSAACETDTLVDDLMRNSKTPGRTVSGGWSPWSGWSSCSRECELGFRTRK-RTCSNPEPRNGGLPCAGSAMEYQDCNPQPCPVKGSWSCWSPWTQCSATCGGGHYQRTRTCTNPPPSNGGDICIGLHTEEALCNTYPCEGGWAEWSEWSMCHEDGSQYRNRYCEIHN 596          
BLAST of semaphorin 5-3 vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 101.679 bits (252), Expect = 5.832e-21
Identity = 51/140 (36.43%), Postives = 69/140 (49.29%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTESLNEIKSCNLPLCEFKI-YSQWSSWSKFNVT 2241
            +C VDG W+ + SW+ CS +CG G R R+R C NP PQ GG +C GN  E ++C    C         G +  W+ W +CS+TC      R R C           CT +  E   CN  LC     + QW +WSK +V+
Sbjct: 4577 QCPVDGKWSAWGSWTSCSLSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADLCP------VHGNWGPWSHWGSCSRTCNGGQMRRYRACDNPAPSHSGRACTGTDTETNKCNTDLCPAHGNWGQWEAWSKCSVS 4710          

HSP 2 Score: 98.5969 bits (244), Expect = 6.100e-20
Identity = 55/173 (31.79%), Postives = 81/173 (46.82%), Query Frame = 1
Query: 1786 CKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTT-----FTKIRLRF 2268
            CK      TD+ ++  T+    +V G ++ +  W  CS TCG G + R R CDNP P NGG  C G  TE + C NK C         G +S+W+TW  CS++CG   ++R R C         + C     ++  CN+  C   ++  W  W  +   T      TK+R+R 
Sbjct: 4390 CKATNIMGTDVVKVTFTV----QVHGGFSEWLPWQSCSVTCGQGIQRRIRLCDNPLPANGGNYCQGAETETRSCQNKLCP------VDGNWSEWSTWEECSRSCGSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKPC--PVHGMWGPWQSWGACTKTCWKGTKMRVRL 4550          

HSP 3 Score: 90.1225 bits (222), Expect = 2.284e-17
Identity = 48/150 (32.00%), Postives = 72/150 (48.00%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISE-------KCTESLNEIKSCNLPLCEFKI-YSQWSSWSKFNVTTFTKIRLRFKC 2274
            C VDG+W+ +S+W +CS +CG+G R R R C +P  Q GGK C G   +  +C  K C         G +  W +W AC+KTC   TK R R C +         C     +++ C    C     +S W SW+  +++    +R R + 
Sbjct: 4464 CPVDGNWSEWSTWEECSRSCGSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKPCP------VHGMWGPWQSWGACTKTCWKGTKMRVRLCNNPTPSPDGLPCEGQDTQMQICGDRQCPVDGKWSAWGSWTSCSLSCGGGLRQRTRA 4607          

HSP 4 Score: 83.9593 bits (206), Expect = 1.402e-15
Identity = 52/156 (33.33%), Postives = 68/156 (43.59%), Query Frame = 1
Query: 1744 RLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTESLNEIKSCNLPLC 2190
            R ++  N   Q G  KC  E N   NE  +  +  C V G+W  +S W  CS TC  G   R R CDNP P + G+ CTG +TE   C    C         G + QW  WS CS +CG   + R+R C           C     ++  CN+  C
Sbjct: 4604 RTRACSNPAPQYGGHKC--EGNEHENE--MCNADLCPVHGNWGPWSHWGSCSRTCNGGQMRRYRACDNPAPSHSGRACTGTDTETNKCNTDLCP------AHGNWGQWEAWSKCSVSCGGGEQIRTRVCHHPARSYTGRPCPGDSTQLLRCNVQAC 4749          
BLAST of semaphorin 5-3 vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 101.679 bits (252), Expect = 6.083e-21
Identity = 51/140 (36.43%), Postives = 69/140 (49.29%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTESLNEIKSCNLPLCEFKI-YSQWSSWSKFNVT 2241
            +C VDG W+ + SW+ CS +CG G R R+R C NP PQ GG +C GN  E ++C    C         G +  W+ W +CS+TC      R R C           CT +  E   CN  LC     + QW +WSK +V+
Sbjct: 4578 QCPVDGKWSAWGSWTSCSLSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADLCP------VHGNWGPWSHWGSCSRTCNGGQMRRYRACDNPAPSHSGRACTGTDTETNKCNTDLCPAHGNWGQWEAWSKCSVS 4711          

HSP 2 Score: 98.2117 bits (243), Expect = 6.526e-20
Identity = 55/173 (31.79%), Postives = 81/173 (46.82%), Query Frame = 1
Query: 1786 CKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTT-----FTKIRLRF 2268
            CK      TD+ ++  T+    +V G ++ +  W  CS TCG G + R R CDNP P NGG  C G  TE + C NK C         G +S+W+TW  CS++CG   ++R R C         + C     ++  CN+  C   ++  W  W  +   T      TK+R+R 
Sbjct: 4391 CKATNIMGTDVVKVTFTV----QVHGGFSEWLPWQSCSVTCGQGIQRRIRLCDNPLPANGGNYCQGAETETRSCQNKLCP------VDGNWSEWSTWEECSRSCGSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKPC--PVHGMWGPWQSWGACTKTCWKGTKMRVRL 4551          

HSP 3 Score: 90.1225 bits (222), Expect = 2.323e-17
Identity = 48/150 (32.00%), Postives = 72/150 (48.00%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISE-------KCTESLNEIKSCNLPLCEFKI-YSQWSSWSKFNVTTFTKIRLRFKC 2274
            C VDG+W+ +S+W +CS +CG+G R R R C +P  Q GGK C G   +  +C  K C         G +  W +W AC+KTC   TK R R C +         C     +++ C    C     +S W SW+  +++    +R R + 
Sbjct: 4465 CPVDGNWSEWSTWEECSRSCGSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKPCP------VHGMWGPWQSWGACTKTCWKGTKMRVRLCNNPTPSPDGLPCEGQDTQMQICGDRQCPVDGKWSAWGSWTSCSLSCGGGLRQRTRA 4608          

HSP 4 Score: 83.9593 bits (206), Expect = 1.475e-15
Identity = 52/156 (33.33%), Postives = 68/156 (43.59%), Query Frame = 1
Query: 1744 RLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTESLNEIKSCNLPLC 2190
            R ++  N   Q G  KC  E N   NE  +  +  C V G+W  +S W  CS TC  G   R R CDNP P + G+ CTG +TE   C    C         G + QW  WS CS +CG   + R+R C           C     ++  CN+  C
Sbjct: 4605 RTRACSNPAPQYGGHKC--EGNEHENE--MCNADLCPVHGNWGPWSHWGSCSRTCNGGQMRRYRACDNPAPSHSGRACTGTDTETNKCNTDLCP------AHGNWGQWEAWSKCSVSCGGGEQIRTRVCHHPARSYTGRPCPGDSTQLLRCNVQAC 4750          
BLAST of semaphorin 5-3 vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 101.679 bits (252), Expect = 6.240e-21
Identity = 51/140 (36.43%), Postives = 69/140 (49.29%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTESLNEIKSCNLPLCEFKI-YSQWSSWSKFNVT 2241
            +C VDG W+ + SW+ CS +CG G R R+R C NP PQ GG +C GN  E ++C    C         G +  W+ W +CS+TC      R R C           CT +  E   CN  LC     + QW +WSK +V+
Sbjct: 4617 QCPVDGKWSAWGSWTSCSLSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADLCP------VHGNWGPWSHWGSCSRTCNGGQMRRYRACDNPAPSHSGRACTGTDTETNKCNTDLCPAHGNWGQWEAWSKCSVS 4750          

HSP 2 Score: 98.2117 bits (243), Expect = 6.582e-20
Identity = 55/173 (31.79%), Postives = 81/173 (46.82%), Query Frame = 1
Query: 1786 CKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTT-----FTKIRLRF 2268
            CK      TD+ ++  T+    +V G ++ +  W  CS TCG G + R R CDNP P NGG  C G  TE + C NK C         G +S+W+TW  CS++CG   ++R R C         + C     ++  CN+  C   ++  W  W  +   T      TK+R+R 
Sbjct: 4430 CKATNIMGTDVVKVTFTV----QVHGGFSEWLPWQSCSVTCGQGIQRRIRLCDNPLPANGGNYCQGAETETRSCQNKLCP------VDGNWSEWSTWEECSRSCGSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKPC--PVHGMWGPWQSWGACTKTCWKGTKMRVRL 4590          

HSP 3 Score: 90.1225 bits (222), Expect = 2.284e-17
Identity = 48/150 (32.00%), Postives = 72/150 (48.00%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISE-------KCTESLNEIKSCNLPLCEFKI-YSQWSSWSKFNVTTFTKIRLRFKC 2274
            C VDG+W+ +S+W +CS +CG+G R R R C +P  Q GGK C G   +  +C  K C         G +  W +W AC+KTC   TK R R C +         C     +++ C    C     +S W SW+  +++    +R R + 
Sbjct: 4504 CPVDGNWSEWSTWEECSRSCGSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKPCP------VHGMWGPWQSWGACTKTCWKGTKMRVRLCNNPTPSPDGLPCEGQDTQMQICGDRQCPVDGKWSAWGSWTSCSLSCGGGLRQRTRA 4647          

HSP 4 Score: 83.9593 bits (206), Expect = 1.591e-15
Identity = 52/156 (33.33%), Postives = 68/156 (43.59%), Query Frame = 1
Query: 1744 RLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTESLNEIKSCNLPLC 2190
            R ++  N   Q G  KC  E N   NE  +  +  C V G+W  +S W  CS TC  G   R R CDNP P + G+ CTG +TE   C    C         G + QW  WS CS +CG   + R+R C           C     ++  CN+  C
Sbjct: 4644 RTRACSNPAPQYGGHKC--EGNEHENE--MCNADLCPVHGNWGPWSHWGSCSRTCNGGQMRRYRACDNPAPSHSGRACTGTDTETNKCNTDLCP------AHGNWGQWEAWSKCSVSCGGGEQIRTRVCHHPARSYTGRPCPGDSTQLLRCNVQAC 4789          
BLAST of semaphorin 5-3 vs. Ensembl Xenopus
Match: ENSXETT00000006505.1 (SCO-spondin [Source:NCBI gene;Acc:100497129])

HSP 1 Score: 101.293 bits (251), Expect = 8.316e-21
Identity = 48/119 (40.34%), Postives = 70/119 (58.82%), Query Frame = 1
Query: 1834 TISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLC 2190
            T  P C++DG W  +SSWS CS  CG GT+ R R CD+P PQNGG+EC G+  +++ C + +C E         +  W++WS CS +CG   + R R+C  ++C     + KSCN  +C
Sbjct: 3393 TPDPSCRLDGKWGPWSSWSPCSQRCGKGTQTRVRQCDSPAPQNGGRECLGDGQQHRDCQSLECQEQE------SWGPWSSWSPCSVSCGGGEQIRVRECQQDECEGKAIQSKSCNGQVC 3505          

HSP 2 Score: 80.8777 bits (198), Expect = 1.503e-14
Identity = 54/153 (35.29%), Postives = 76/153 (49.67%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGF-----STKSRSRQC-------ISEKCTESLNEIKSCNLPLCEF-KIYSQWSSWSKFNVTTFTKIRLR 2265
            +C V+  W+ +S W+ C  TCG+G + R R   NP   NGG  C G+  E + C +  CD      T   + +WT WSACSKTC +       + R R C        S    ES+ E ++C+ PLC     +SQWS WS+   T  + I+ R
Sbjct: 2549 DCPVNCGWSAWSHWTPCDRTCGSGVQERFRSPTNPPSANGGAPCDGDTREVRECFS-SCD----NETDRMWGEWTPWSACSKTCVYDVEHLGVRRRFRHCNNSLASSTSPCVGESVQE-EACDTPLCPVTGGWSQWSPWSECTATCDSGIQTR 2695          

HSP 3 Score: 71.2478 bits (173), Expect = 1.026e-11
Identity = 36/92 (39.13%), Postives = 49/92 (53.26%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSR 2124
            C VD  W+ +++WS CS TC  GTR R R   NP P NGG+ C G+N + + C  + C             +W+ WS CS  CG   ++RSR
Sbjct: 2826 CPVDCGWSTWTTWSSCSRTCNVGTRRRYRSGTNPPPANGGRGCEGSNVDIEFCSLQSCSA----------GEWSPWSECSVPCGGGYRNRSR 2907          

HSP 4 Score: 67.0106 bits (162), Expect = 2.046e-10
Identity = 37/112 (33.04%), Postives = 56/112 (50.00%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGN-GTRVRSRFCDNPKPQNGGKECTGNNTEYQICVN---------KKCDELNFENTRGRYSQWTTWSACSKTCG----FSTKSRSRQCISEK 2142
            C V G +T +S WS CS +CG  G   R+R C NP P NGG+ C G + + + C           +   ++      G Y  W++W+ CSK+C      + K+RSR C+  +
Sbjct: 3625 CPVHGAFTPWSPWSPCSVSCGGLGNMTRTRHCTNPAPANGGRNCEGPSMDIKYCQTPEYITSPTVEPFPDITGSPEEGGYGPWSSWTPCSKSCSDNEYPAMKTRSRFCLGGR 3736          

HSP 5 Score: 62.003 bits (149), Expect = 7.537e-9
Identity = 26/56 (46.43%), Postives = 36/56 (64.29%), Query Frame = 1
Query: 1855 VDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC 2022
            VDG+W+ ++ WS+CS+TCG G + R RFCD+P P   G  C G + E Q C  + C
Sbjct: 3020 VDGNWSDWTPWSECSSTCGGGFQTRYRFCDDPPPSGTGLPCQGPDREEQPCSVEPC 3075          

HSP 6 Score: 61.6178 bits (148), Expect = 9.226e-9
Identity = 38/99 (38.38%), Postives = 48/99 (48.48%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTG-----NNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC 2130
            C V G W  +SSW+ CS TCG     R R C  PKP+ GG +C G      +T  Q+   K+C    F    G +  W+ WS C    G S   R+RQC
Sbjct: 3173 CVVAGGWCDWSSWTPCSKTCGTEMVTRYRSCACPKPKQGGDQCQGVQQYYGDTGVQL-ERKECPSSTFCPVNGNWGSWSPWSYCDGCTGESI--RTRQC 3268          

HSP 7 Score: 61.2326 bits (147), Expect = 1.348e-8
Identity = 28/68 (41.18%), Postives = 39/68 (57.35%), Query Frame = 1
Query: 1840 SPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFEN 2043
            +P C V G W+ +S WS+C+ATC +G + R+R C  P P  GG +C G   + + C    C EL  EN
Sbjct: 2666 TPLCPVTGGWSQWSPWSECTATCDSGIQTRNRTCSKPHPSYGGSDCRGPQIQTRECNTHPCQELCPEN 2733          

HSP 8 Score: 59.6918 bits (143), Expect = 3.522e-8
Identity = 33/60 (55.00%), Postives = 39/60 (65.00%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDE 2028
            CKVDG W+ +S WS C  TCG G  +RSR C +P P+NGGKEC G     +IC  K CDE
Sbjct: 3831 CKVDGSWSKWSPWSWCDRTCGGGRSIRSRTCTSPPPKNGGKECPGEKYHVRICNPKPCDE 3890          

HSP 9 Score: 53.9138 bits (128), Expect = 2.222e-6
Identity = 48/179 (26.82%), Postives = 74/179 (41.34%), Query Frame = 1
Query: 1852 KVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDEL---NFENTR------------------GRYSQ-----------WTTWSACSKTCGFSTKSRSRQC---ISEKC-----TESLNEIKSCNLPLCEFK-IYSQWSSWSKFNVTTFTKIRLR 2265
            ++D  W+ +S WS CS TCG+GT+ R R   +  P+   +EC     + + C    C EL   N  N R                  G Y Q           W+ WS CSK CG   +SR+ +C   + E       T  + E  +C +  C+   ++  WS W+  +  +  + R R
Sbjct: 3986 RLDCQWSQWSKWSQCSVTCGSGTQSRFRSSTSGSPK---RECQVPEKQSRPCYPGMCPELCPHNGTNRRIGDAWLAGECQQCICTPEGNYCQDVECRGSGLCDWSDWSPCSKPCGTGLRSRTWRCDCPVPESPDVPCNTTEIVETAACYIQPCQGSCLWGPWSEWTNCSCHSLLQHRFR 4161          

HSP 10 Score: 52.373 bits (124), Expect = 5.611e-6
Identity = 31/95 (32.63%), Postives = 47/95 (49.47%), Query Frame = 1
Query: 1813 DLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTC 2097
            D +E    ++ + K  G W+ + SWS+CS +CG G + R R C NP   +  ++C G   E Q C    C         G ++ W TWS C++ C
Sbjct: 1672 DGDEASGWVASDEKDCGFWSPWGSWSECSHSCGTGMQSRRRTCTNPS-TDVLRQCRGEEHETQQCFTVSCP------VDGSWTPWATWSNCTQDC 1759          
BLAST of semaphorin 5-3 vs. Ensembl Mouse
Match: Sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:MGI Symbol;Acc:MGI:107556])

HSP 1 Score: 190.66 bits (483), Expect = 6.190e-49
Identity = 225/992 (22.68%), Postives = 390/992 (39.31%), Query Frame = 1
Query:  247 LHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQCTS-----EQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLI-----NLQTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSL-LEISLQPKICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASS--LKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTD----------LNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXT--------------RRTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR-MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPL--------IQNKPCL--------------RQIKDKP-AEFSFIYMIVSGLVGFVCGLLMGSILCYIW 2934
            L ++   +  +F  L++ P    + VV   N + RL+L +L+      ++     KK C S     E+C+  I          ++L +  + +    TN     +C      NL   H  Q +G     +   +   H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C + V  +R  R+C+ND G   L  + ++ F K  + C    S     PF Y       +L     +   FT+N     +SA+CV+ + +I  AFN   K   E +   +  Y N    F  G  D    +     NLQ   K   +H  +  VT+     E  ++F  +A +          +++++T    +  +   +S     C+L +  L     SE I  L+ ++   +  LFVG    + KIPL  C+   T + C     P+C WD + KKC  +           S   C +     +      + W  C       D + +G C C   R+ D              ++ I+  C  +G WT ++SWS CS TCG G +VR R C NP P++GG+ C G N E      + C+E         ++ W  W  C+  CG   ++R R C     C     E + CN   C E K  + W+ W+  N++      + R R+ C         + +L ++ R  +     ++D     +   ++G+F     +S+ + +   S WT               R R C  P        C G S++++ C I  C          S         G   MR R C   +       C G  TE + C  + C  ++S+W++WS C+ +  + R RQC+     LFP+         +++PC+                +++K   EF+  +M+  GL   + G L+ ++L Y +
Sbjct:   47 LREFRAENAVDFSRLTFDPGQKEL-VVGARNYLFRLELEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYI----------RVLLVGGDRLFTCGTNAFTP-VCTIRSLSNLTEIH-DQISGM----ARCPYSPQHNSTALLTASGELYAATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGKTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNC----SRPGEVPFYYNELQGTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFKY-QENSRSAWLPYPNPNPNFQCGTMDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHLAVDVVQGRETLVHIIYLATDYGTIKKVRAPLSQSSGSCLLEEIELFPERRSEPIRSLQILH--SQSVLFVGLQEHVAKIPLKRCHFHQTRSACIGAQDPYCGWDAVMKKCTSLEESLSMTQWDQSIPTCPTRNLTVDGSFGPWSPWTPC----THTDGTAVGSCLCR-SRSCDSPAPQCGGWQCEGPRMEIT-NCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNRE-----ERYCNEHLLCPPHVFWTGWGPWERCTAQCGGGIQARRRTCENGPDCAGCNVEYQPCNTNACPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLP----DPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKFGGMPCLGPSLEFQECNILPCPVDGVWSCWSSWSKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQTCPESWSEWSDWSVCDASGTQVRARQCIL----LFPVGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEEKRCGEFNMFHMMAVGLSSSILGCLL-TLLVYTY 992          
BLAST of semaphorin 5-3 vs. Ensembl Mouse
Match: Sema5b (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B [Source:MGI Symbol;Acc:MGI:107555])

HSP 1 Score: 169.088 bits (427), Expect = 4.583e-42
Identity = 214/924 (23.16%), Postives = 363/924 (39.29%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQC-----TSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRT--VHSATSDYTYAGLYMKSYKELMIFKN-----PLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKF---NEYKNI--CQLFTTGNQDSNFLINLQTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQP-KICILRKF--LLSENITLLKTVNETDKI-YLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYV-STKNQFLLISNSKTYCASSL-KENQNAVLNQWVQCRLKSIVNDLSQIGMCK---CNIERN--TDLNEIKLTIS-PECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQYESFNLSLND-ITRYIVYPSCSTADCQ-----------FKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMC-PIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC----LYNNNCLFPLIQNKPC 2820
            +F  L+  P+ + + +V   N + RL L N++      + S    ++ C     T E+C+  +          ++L +    +    TN     +C + +  NL S  I +  G      D  H +  V S+  +   A +   S ++  I+++     PL     N   +N+ N            + +F      YF   E      C   V  +R+ R+C+ND G   L  + ++ F K  + C +        PF Y    +   L     +   FT+N     +SA+C + + +I  AFN   +      +      N   N     L  TG  ++    +LQ   + + +   +  VT +  + +   +F  +  +     +    VL++ T++  +   L  + +  + C L +   L    +  L+++        LFVG S R++++PL+ C    +   C     P+C WD   + C  +  + N  L I N  T    ++ ++      + W  C  + +  D S   +C+   C+  R     L  +  +I    C  +G WT +SSW+ CS +CG G +VR R C NP P++GG+ C G + E + C  N  C    F      ++ W +WS CS  CG   +SR R C     C     E K+CN   C E +  + W+ W   NVT      + R RF C +    +   L      T     P+  T  C               +   +NG ++ W  WSSCS  C+     R+ R C  P        C G++ +Y+ C P            T  +  +     G   R R C   +       C G  TE + C  + C   +S W+EW  C E+  ++R R C         C+    Q++PC
Sbjct:   67 DFSQLALDPSRNQL-IVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYV----------RVLIVSGRKVFMCGTNAF-SPVCSSRQVGNL-SRTIEKINGVARCPYDPRHNSTAVISSQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNF-----------VAAFDIGLFAYFFLRENAVEHDCGRTVY-SRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEV----PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISKAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLRGCYLEELHVLPPGRLEPLRSLRILHSARALFVGLSDRVLRVPLERCSAYHSQGACLGARDPYCGWDGKRQLCSTLEDSSNMSLWIQNITTCPVRNVTRDGGFGPWSPWKPC--EHLDGDNSGSCLCRARSCDSPRPRCGGLECLGPSIHIANCSRNGAWTAWSSWAQCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF------WASWGSWSKCSNNCGGGVQSRRRSCENGNSCPGCGVEFKTCNPEACPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTC-RAPLPDPHGLQFGKRRTETRTCPADGTGACDTDALVEDLLRSGSTSPHTLNGGWATWGPWSSCSRDCELGFRVRK-RTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTAWSQCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCSTQACPEGWSLWSEWGVCTEDGAQSRSRSCEELLPGPGACVGNSSQSRPC 951          
BLAST of semaphorin 5-3 vs. Ensembl Mouse
Match: Sema5b (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B [Source:MGI Symbol;Acc:MGI:107555])

HSP 1 Score: 158.688 bits (400), Expect = 7.987e-39
Identity = 214/953 (22.46%), Postives = 365/953 (38.30%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQC-----TSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRT--VHSATSDYTYAGLYMKSYKELMIFKN-----PLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKF---NEYKNI--CQLFTTGNQDSNFLINLQTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQP-KICILRKF--LLSENITLLKTVNETDKI-YLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYV-STKNQFLLISNSKTYCASSL-KENQNAVLNQWVQCRLKSIVNDLSQIGMCK---CNIERN--TDLNEIKLTIS-PECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC------------------------------ISEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQYESFNLSLND-ITRYIVYPSCSTADCQ-----------FKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMC-PIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC----LYNNNCLFPLIQNKPC 2820
            +F  L+  P+ + + +V   N + RL L N++      + S    ++ C     T E+C+  +          ++L +    +    TN     +C + +  NL S  I +  G      D  H +  V S+  +   A +   S ++  I+++     PL     N   +N+ N            + +F      YF   E      C   V  +R+ R+C+ND G   L  + ++ F K  + C +        PF Y    +   L     +   FT+N     +SA+C + + +I  AFN   +      +      N   N     L  TG  ++    +LQ   + + +   +  VT +  + +   +F  +  +     +    VL++ T++  +   L  + +  + C L +   L    +  L+++        LFVG S R++++PL+ C    +   C     P+C WD   + C  +  + N  L I N  T    ++ ++      + W  C  + +  D S   +C+   C+  R     L  +  +I    C  +G WT +SSW+ CS +CG G +VR R C NP P++GG+ C G + E + C  N  C    F      ++ W +WS CS  CG   +SR R C                                 + T +  E K+CN   C E +  + W+ W   NVT      + R RF C +    +   L      T     P+  T  C               +   +NG ++ W  WSSCS  C+     R+ R C  P        C G++ +Y+ C P            T  +  +     G   R R C   +       C G  TE + C  + C   +S W+EW  C E+  ++R R C         C+    Q++PC
Sbjct:   67 DFSQLALDPSRNQL-IVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYV----------RVLIVSGRKVFMCGTNAF-SPVCSSRQVGNL-SRTIEKINGVARCPYDPRHNSTAVISSQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNF-----------VAAFDIGLFAYFFLRENAVEHDCGRTVY-SRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEV----PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISKAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLRGCYLEELHVLPPGRLEPLRSLRILHSARALFVGLSDRVLRVPLERCSAYHSQGACLGARDPYCGWDGKRQLCSTLEDSSNMSLWIQNITTCPVRNVTRDGGFGPWSPWKPC--EHLDGDNSGSCLCRARSCDSPRPRCGGLECLGPSIHIANCSRNGAWTAWSSWAQCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF------WASWGSWSKCSNNCGGGVQSRRRSCENGNSCPGCGVVRSRGWGAGSGETYSPGGVGGSEATLTPKEFKTCNPEACPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTC-RAPLPDPHGLQFGKRRTETRTCPADGTGACDTDALVEDLLRSGSTSPHTLNGGWATWGPWSSCSRDCELGFRVRK-RTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTAWSQCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCSTQACPEGWSLWSEWGVCTEDGAQSRSRSCEELLPGPGACVGNSSQSRPC 980          
BLAST of semaphorin 5-3 vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 113.62 bits (283), Expect = 1.082e-24
Identity = 102/430 (23.72%), Postives = 164/430 (38.14%), Query Frame = 1
Query: 1621 TKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS-------EKCTESLNEIKSCNLPLCEFK-IYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFK--NNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITPI-------CFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRG-------------------MRMRNRKCIYDSKRTS-----CRGNETEISDCPLKQC--SAAYSKWTEWSNCEEN---SFKTRKRQC 2772
            +++ + +S  N+  ++ NS  Y A++ KE+ +       +C                  + RN  +  + + +    +V G ++++S+W  CS TCG G + RSR CDNP P NGG+ C G ++E + C NK C         G +S+W+ W  CS++CG   ++R+R C +         C     E   CN+  C    +++ W  WS  + +     + R +              N+         CS A+ Q +  N +              S      G    +RTR+C  P+       C G  +    C                    PC T G                   MR R R C  D+ R S     C G +T+I  C    C    ++  W  WS+C  +     +TRKR C
Sbjct: 4473 SRQGQPISWDNRLSMLPNSSLYIAAARKEDTSEY-----EC------------------VARNL-MGSVLVRVPVIVQVHGGFSLWSAWRPCSVTCGKGIQKRSRLCDNPPPANGGRPCQGADSEARHCHNKLCP------VDGHWSEWSFWEDCSRSCGHGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRPCPVHGVWNAWQPWSACSKSCGKGSQTRMRLC------------NNPPPSFGGAHCSGAETQMQVCNERHCPVDGRWATWSSWSACTVSCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFC-----------------NSDPCPTHGNWSPWSGWGTCSRTCNGGQMR-RYRTC--DNPRPSNGGRACGGPDTQIQRCNTDMCPVDGSWGTWHSWSHCSVSCGGGERTRKRLC 4840          

HSP 2 Score: 94.3597 bits (233), Expect = 9.257e-19
Identity = 42/124 (33.87%), Postives = 58/124 (46.77%), Query Frame = 1
Query: 1840 SPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS-------EKCTESLNEIKSCNLPLC 2190
            S  C   G+W+ +S W  CS TC  G   R R CDNP+P NGG+ C G +T+ Q C    C         G +  W +WS CS +CG   ++R R C +         C     ++  CN+  C
Sbjct: 4750 SDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPRPSNGGRACGGPDTQIQRCNTDMCP------VDGSWGTWHSWSHCSVSCGGGERTRKRLCDNPVPTKGGRSCPGDATQVSRCNMQAC 4867          
BLAST of semaphorin 5-3 vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 112.849 bits (281), Expect = 1.895e-24
Identity = 102/430 (23.72%), Postives = 164/430 (38.14%), Query Frame = 1
Query: 1621 TKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS-------EKCTESLNEIKSCNLPLCEFK-IYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFK--NNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITPI-------CFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRG-------------------MRMRNRKCIYDSKRTS-----CRGNETEISDCPLKQC--SAAYSKWTEWSNCEEN---SFKTRKRQC 2772
            +++ + +S  N+  ++ NS  Y A++ KE+ +       +C                  + RN  +  + + +    +V G ++++S+W  CS TCG G + RSR CDNP P NGG+ C G ++E + C NK C         G +S+W+ W  CS++CG   ++R+R C +         C     E   CN+  C    +++ W  WS  + +     + R +              N+         CS A+ Q +  N +              S      G    +RTR+C  P+       C G  +    C                    PC T G                   MR R R C  D+ R S     C G +T+I  C    C    ++  W  WS+C  +     +TRKR C
Sbjct: 4473 SRQGQPISWDNRLSMLPNSSLYIAAARKEDTSEY-----EC------------------VARNL-MGSVLVRVPVIVQVHGGFSLWSAWRPCSVTCGKGIQKRSRLCDNPPPANGGRPCQGADSEARHCHNKLCP------VDGHWSEWSFWEDCSRSCGHGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRPCPVHGVWNAWQPWSACSKSCGKGSQTRMRLC------------NNPPPSFGGAHCSGAETQMQVCNERHCPVDGRWATWSSWSACTVSCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFC-----------------NSDPCPTHGNWSPWSGWGTCSRTCNGGQMR-RYRTC--DNPRPSNGGRACGGPDTQIQRCNTDMCPVDGSWGTWHSWSHCSVSCGGGERTRKRLC 4840          

HSP 2 Score: 93.5893 bits (231), Expect = 1.235e-18
Identity = 42/124 (33.87%), Postives = 58/124 (46.77%), Query Frame = 1
Query: 1840 SPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS-------EKCTESLNEIKSCNLPLC 2190
            S  C   G+W+ +S W  CS TC  G   R R CDNP+P NGG+ C G +T+ Q C    C         G +  W +WS CS +CG   ++R R C +         C     ++  CN+  C
Sbjct: 4750 SDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPRPSNGGRACGGPDTQIQRCNTDMCP------VDGSWGTWHSWSHCSVSCGGGERTRKRLCDNPVPTKGGRSCPGDATQVSRCNMQAC 4867          
BLAST of semaphorin 5-3 vs. UniProt/SwissProt
Match: sp|Q13591|SEM5A_HUMAN (Semaphorin-5A OS=Homo sapiens OX=9606 GN=SEMA5A PE=1 SV=3)

HSP 1 Score: 194.126 bits (492), Expect = 4.147e-49
Identity = 234/998 (23.45%), Postives = 397/998 (39.78%), Query Frame = 1
Query:  247 LHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQCTS-----EQCEKIIIDVVQFAKD-------SKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSL-LEISLQPKICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASS--LKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIK----------LTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNL-PLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTR--------------RTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR-MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPL--------IQNKPCL--------------RQIKDKP-AEFSFIYMIVSGLVGFVCGLLMGSILCYIW 2934
            L ++   +  +F  L++ P    + VV   N + RL+L +L+      ++     KK C S     E+C+  I  V+    D       +    +C N  L SN  ++ DQ+    +       +  Q      +++  E   +++AT+   + G     Y+ L I   PL     N   +N+ N            ++S+      YF + E      C + V  +R  R+C+ND G   L  + ++ F K  + C    S     PF Y    +  +L     +   FT+N     +SA+CV+ + +I  AF+   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  +  VT+     E  ++F  +A +          +++++T    +  + + ++     C+L +  L      E I  L+ ++   +  LFVG    +VKIPL  C    T + C     P+C WD + KKC  +           S + C +     +    V + W  C       D S +G C C   R+ D    +          + I+  C  +G WT ++SWS CS TCG G +VR R C NP P++GG+ C G N E      + C+E         ++ W  W  C+  CG   ++R R C     C     E +SCN  P  E K  + W+ W+  N++      + R R+ C    +    + +L ++ R  +     ++D     +   ++G+F     +S+ + +   S WT               R R C  P        C G S++Y+ C I  C                    G   MR R C   +       C G  TE + C  + C  ++S+W++WS CE +  + R RQC+     LFP+         +++PC+                +++K   EF+  +MI  GL   + G L+ ++L Y +
Sbjct:   47 LREFRAKNAVDFSQLTFDPGQKEL-VVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYI-RVLLVGGDRLFTCGTNAFTPVCTNRSL-SNLTEIHDQISGMAR-----CPYSPQHNSTALLTAGGE---LYAATA-MDFPGRDPAIYRSLGILP-PLRTAQYNSKWLNEPNF-----------VSSYDIGNFTYFFFRENAVEHDCGKTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNC----SRPGEVPFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQ-ENSRSAWLPYPNPNPHFQCGTVDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHIIYLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILH--SQSVLFVGLREHVVKIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVDGHFGVWSPWTPC----THTDGSAVGSCLCRT-RSCDSPAPQCGGWQCEGPGMEIA-NCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNRE-----ERYCNEHLLCPPHMFWTGWGPWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNPCPELKKTTPWTPWTPVNISDNGGHYEQRFRYTC----KARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPVDGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECEASGVQVRARQCIL----LFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEEKRCGEFNMFHMIAVGLSSSILGCLL-TLLVYTY 992          
BLAST of semaphorin 5-3 vs. UniProt/SwissProt
Match: sp|D3ZTD8|SEM5A_RAT (Semaphorin-5A OS=Rattus norvegicus OX=10116 GN=Sema5a PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 3.831e-48
Identity = 218/940 (23.19%), Postives = 370/940 (39.36%), Query Frame = 1
Query:  247 LHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQCTS-----EQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSL-LEISLQPKICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASS--LKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTD----------LNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTR--------------RTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR-MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPL--------IQNKPCL 2823
            L ++   +  +F  L++ P    + VV   N + RL+L +L+      ++     KK C S     E+C+  I          ++L +  + +    TN     +C      NL   H  Q +G     +   +   H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C + V  +R  R+C+ND G   L  + ++ F K  + C    S     PF Y    +  +L     +   FT+N     +SA+CV+ + +I  AFN   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  +  VT+     E  ++F  +A +     +    +++++T    +  +   +S     C+L +  L     SE I  LK ++   +  LFVG    +VKIPL  C+   T   C     P+C WD + KKC  +           S   C +     +      + W  C       D + +G C C   R+ D              ++ I+  C  +G WT ++SWS CS TCG G +VR R C NP P++GG+ C G N E      + C+E         ++ W  W  C+  CG   ++R R C     C     E + CN   C E K  + W+ W+  N++      + R R+ C         + +L ++ R  +     ++D     +   ++G+F     +S+ + +   S WT               R R C  P        C G S++++ C I  C          S         G   MR R C   +       C G  TE + C  + C   +S+W+EWS C+ +  + R RQC+     LFP+         +++PC+
Sbjct:   47 LREFRAENAVDFSRLTFDPGQKEL-VVGARNYLFRLQLEDLSLIQAVQWECDEATKKACYSKGKSKEECQNYI----------RVLLVGGDRLFTCGTNAFTP-VCTIRSLSNLTEIH-DQISGM----ARCPYSPQHNSTALLTASGELYAATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGKTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNC----SRPGEVPFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFKYQ-ENSRSAWLPYPNPNPNFQCGTMDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGRDTLVHIIYLATDYGTIKKVRAPLSQSSGSCLLEEIELFPERKSEPIRSLKILH--SQSVLFVGLQEHVVKIPLKRCHFHQTRGACIGAQDPYCGWDAVMKKCTSLEESLSMTQWDQSVPTCPTRNLTVDGSFGPWSPWTPC----THTDGTAVGSCLCR-SRSCDSPAPQCGGWQCEGPRMEIT-NCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNRE-----ERYCNEHLLCPPHVFWTGWGPWERCTAQCGGGIQARRRTCENGPDCAGCNVEYQPCNTNACPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLP----DPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEFQECNILPCPVDGVWSCWSSWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQTCPENWSEWSEWSVCDASGTQVRTRQCIL----LFPVGSQCSGNTTESRPCV 941          
BLAST of semaphorin 5-3 vs. UniProt/SwissProt
Match: sp|Q62217|SEM5A_MOUSE (Semaphorin-5A OS=Mus musculus OX=10090 GN=Sema5a PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.384e-47
Identity = 216/940 (22.98%), Postives = 368/940 (39.15%), Query Frame = 1
Query:  247 LHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQCTS-----EQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSL-LEISLQPKICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASS--LKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTD----------LNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTR--------------RTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR-MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPL--------IQNKPCL 2823
            L ++   +  +F  L++ P    + VV   N + RL+L +L+      ++     KK C S     E+C+  I          ++L +  + +    TN     +C      NL   H  Q +G     +   +   H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C + V  +R  R+C+ND G   L  + ++ F K  + C +        PF Y       +L     +   FT+N     SSA+CV+ + +I  AFN   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  +  VT+     E  ++F  +A +          ++++ T    +  +   +S     C+L +  L     SE I  L+ ++   +  LFVG    + KIPL  C+   T + C     P+C WD + KKC  +           S   C +     +      + W  C       D + +G C C   R+ D              ++ I+  C  +G WT ++SWS CS TCG G +VR R C NP P++GG+ C G N E      + C+E         ++ W  W  C+  CG   ++R R C     C  S  E   CN   C E K  + W+ W+  N++      + R R+ C         + +L ++ R  +     ++D     +   ++G+F     +S+ + +   S WT               R R C  P        C G S++++ C I  C          S         G   MR R C   +       C G  TE + C  + C  ++S+W++WS C+ +  + R RQC+     LFP+         +++PC+
Sbjct:   47 LREFRAENAVDFSRLTFDPGQKEL-VVGARNYLFRLELEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYI----------RVLLVGGDRLFTCGTNAFTP-VCTIRSLSNLTEIH-DQISGM----ARCPYSPQHNSTALLTASGELYAATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGKTVF-SRPARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEV----PFYYNELQGTFFLPELDLIYGIFTTNVNSIASSAVCVFNLSAISQAFNGPFKYQ-ENSRSAWLPYPNPNPNFQCGTMDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHLAVDVVQGRETLVHIIYLGTDYGTIKKVRAPLSQSSGSCLLEEIELFPERRSEPIRSLQILH--SQSVLFVGLQEHVAKIPLKRCHFHQTRSACIGAQDPYCGWDAVMKKCTSLEESLSMTQWDQSIPTCPTRNLTVDGSFGPWSPWTPC----THTDGTAVGSCLCR-SRSCDRPAPQCGGWQCEGPRMEIT-NCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNRE-----ERYCNEHLLCPPHVFWTGWGPWERCTAQCGGGIQARRRTCENGPDCAGSNVEYHPCNTNACPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLP----DPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKFGGMPCLGPSLEFQECNILPCPVDGVWSCWSSWSKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQTCPESWSEWSDWSVCDASGTQVRARQCIL----LFPVGSQCSGNTTESRPCV 941          
BLAST of semaphorin 5-3 vs. UniProt/SwissProt
Match: sp|Q60519|SEM5B_MOUSE (Semaphorin-5B OS=Mus musculus OX=10090 GN=Sema5b PE=2 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 3.206e-41
Identity = 214/924 (23.16%), Postives = 363/924 (39.29%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQC-----TSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRT--VHSATSDYTYAGLYMKSYKELMIFKN-----PLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKF---NEYKNI--CQLFTTGNQDSNFLINLQTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQP-KICILRKF--LLSENITLLKTVNETDKI-YLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYV-STKNQFLLISNSKTYCASSL-KENQNAVLNQWVQCRLKSIVNDLSQIGMCK---CNIERN--TDLNEIKLTIS-PECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQYESFNLSLND-ITRYIVYPSCSTADCQ-----------FKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMC-PIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC----LYNNNCLFPLIQNKPC 2820
            +F  L+  P+ + + +V   N + RL L N++      + S    ++ C     T E+C+  +          ++L +    +    TN     +C + +  NL S  I +  G      D  H +  V S+  +   A +   S ++  I+++     PL     N   +N+ N            + +F      YF   E      C   V  +R+ R+C+ND G   L  + ++ F K  + C +        PF Y    +   L     +   FT+N     +SA+C + + +I  AFN   +      +      N   N     L  TG  ++    +LQ   + + +   +  VT +  + +   +F  +  +     +    VL++ T++  +   L  + +  + C L +   L    +  L+++        LFVG S R++++PL+ C    +   C     P+C WD   + C  +  + N  L I N  T    ++ ++      + W  C  + +  D S   +C+   C+  R     L  +  +I    C  +G WT +SSW+ CS +CG G +VR R C NP P++GG+ C G + E + C  N  C    F      ++ W +WS CS  CG   +SR R C     C     E K+CN   C E +  + W+ W   NVT      + R RF C +    +   L      T     P+  T  C               +   +NG ++ W  WSSCS  C+     R+ R C  P        C G++ +Y+ C P            T  +  +     G   R R C   +       C G  TE + C  + C   +S W+EW  C E+  ++R R C         C+    Q++PC
Sbjct:   67 DFSQLALDPSRNQL-IVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYV----------RVLIVSGRKVFMCGTNAF-SPVCSSRQVGNL-SRTIEKINGVARCPYDPRHNSTAVISSQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNF-----------VAAFDIGLFAYFFLRENAVEHDCGRTVY-SRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEV----PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISKAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLRGCYLEELHVLPPGRLEPLRSLRILHSARALFVGLSDRVLRVPLERCSAYHSQGACLGARDPYCGWDGKRQLCSTLEDSSNMSLWIQNITTCPVRNVTRDGGFGPWSPWKPC--EHLDGDNSGSCLCRARSCDSPRPRCGGLECLGPSIHIANCSRNGAWTAWSSWAQCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF------WASWGSWSKCSNNCGGGVQSRRRSCENGNSCPGCGVEFKTCNPEACPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTC-RAPLPDPHGLQFGKRRTETRTCPADGTGACDTDALVEDLLRSGSTSPHTLNGGWATWGPWSSCSRDCELGFRVRK-RTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTAWSQCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCSTQACPEGWSLWSEWGVCTEDGAQSRSRSCEELLPGPGACVGNSSQSRPC 951          
BLAST of semaphorin 5-3 vs. UniProt/SwissProt
Match: sp|Q9P283|SEM5B_HUMAN (Semaphorin-5B OS=Homo sapiens OX=9606 GN=SEMA5B PE=2 SV=4)

HSP 1 Score: 168.318 bits (425), Expect = 5.677e-41
Identity = 206/933 (22.08%), Postives = 364/933 (39.01%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQC-----TSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRT--VHSATSDYTYAGLYMKSYKELMIFKN-----PLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKF---NEYKNI--CQLFTTGNQDSNFLINLQTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQP-KICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCK---CNIER----NTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQYESFNLSLN-DITRYIVYPSCSTADCQFKNNKQII--NGNFXXXXXXXXXXXXXXXXXXTR--------RTRNCITP-------ICFGESIDY-----KMCPIYLXXXXXXXXXXXXXXXXPCETR---GMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC----LYNNNCLFPLIQNKPC 2820
            +F  L+  P+ + + +V   N + RL L N++      + S    ++ C     T E+C+  +          ++L +    +    TN     MC + +  NL S  I +  G      D  H +  V S+  +   A +   S ++  I+++     PL     N   +N+ N            + ++      YF   E      C   V  +R+ R+C+ND G   L  + ++ F K  + C +        PF Y    +   L     +   FT+N     +SA+C + + +I  AFN   +      +      N   N     L  TG  ++    +LQ   + + +   +  VT +  + +   +F  +  +     +    VL++ T++  +   L  + +    C L +  +      E +  L+ ++      LFVG    ++++PL+ C    +   C     P+C WD   ++C  +   +   L + + T C   +  ++      + W  C  + +  D S   +C+   C+  R      D     + I+  C  +G WT +SSW+ CS +CG G +VR R C NP P++GG+ C G + E + C  N  C    F      ++ W +WS CS  CG   +SR R C     C     E K+CN   C E +  + W+ W   NVT      + R RF C +    +   L      T     P+  +  C      +++  +G+ S  +     +     S  +R        R R C  P        C G++ +Y     + CP+           +  T ++PC      G   R R C   +       C G  TE + C  + C   +S W+EWS C ++  ++R R C      ++ C     Q++PC
Sbjct:  125 DFSQLALDPSGNQL-IVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYV----------RVLIVAGRKVFMCGTNAFSP-MCTSRQVGNL-SRTIEKINGVARCPYDPRHNSTAVISSQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNF-----------VAAYDIGLFAYFFLRENAVEHDCGRTVY-SRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEV----PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARA--LFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNVTRDGGFGPWSPWQPC--EHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIA-NCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF------WASWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTC-RAPLADPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPV-------RGAWSCWTSWSPCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCATQACPEGWSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPC 1009          
BLAST of semaphorin 5-3 vs. TrEMBL
Match: A0A0K0LJ33 (Semaphorin 5-3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=sema5-3 PE=2 SV=1)

HSP 1 Score: 1842.4 bits (4771), Expect = 0.000e+0
Identity = 944/954 (98.95%), Postives = 945/954 (99.06%), Query Frame = 1
Query:  262 MADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITPICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPP 3123
            MADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVL+    RLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTK  F   SNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFSDWSEWSSCSNSCKGSEWTRRTRNCITPICFGESIDYKMCPIYLCKSSWNCWSTWSTCFTPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPP
Sbjct:    1 MADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLLH--ARLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKINFYY-SNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFSDWSEWSSCSNSCKGSEWTRRTRNCITPICFGESIDYKMCPIYLCKSSWNCWSTWSTCFTPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPP 951          
BLAST of semaphorin 5-3 vs. TrEMBL
Match: A0A1S2ZK72 (semaphorin-5A OS=Erinaceus europaeus OX=9365 GN=SEMA5A PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 2.159e-47
Identity = 225/1012 (22.23%), Postives = 385/1012 (38.04%), Query Frame = 1
Query:  247 LHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQCTS-----EQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLAS--DHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQPKI--CILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASS--LKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTD----------LNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTR--------------RTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR------------------MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPL--------IQNKPCLRQIKDKP---------------AEFSFIYMIVSGLVGFVCGLLMGSILCYIW 2934
            L ++   D  +F  L++ P    + VV   N + RL L +L+      +      KK C S     E+C+  I          ++L +  + +    TN     +C      NL    DHI+         +   +   H++T+  T  G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C + V  +R  R+C+ND G   L  + ++ F K  + C +        PF Y       +L     +   FT+N     +SA+C++ + +I  AFN   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  +  V+      E  ++F  +A +     +    +++++T    +  +    L P    C+L +  L      E +  L+ ++      LFVG    + K+PL  C+   T + C     P+C WD + KKC  +           S + C +     + +    + W  C       D S +G C C   R+ D              ++ I+  C  +G WT ++SWS CS TCG G +VR R C NP P++GG+ C G N E      + C+E         ++ W  W  C+  CG   ++R R C     C     E +SCN   C E K  + W+ W+  N++      + R R+ C         + +L ++ R  +     ++D     +   ++G+F     +S+ + +   S WT               R R C  P        C G S++Y+ C I                  PC   GM                   MR R C   +       C G  TE + C  + C  ++S+W++WS C+ +  + R RQC+     LFP+         + +PC+      P                EF+  +M+  GL   + G L+ ++L Y +
Sbjct:   46 LREFRAKDAVDFSQLTFDPGQKEL-VVGARNYLFRLHLEDLSLIQAVQWGCDVATKKACYSKGKSEEECQNYI----------RVLLVGGDRLFTCGTNAFTP-VCTNRTLSNLTEIHDHISG-------MARCPYSPQHNSTALLTAGGELYAATAMDFPGRDPAIYRSLGALPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGKTVF-SRAARVCKNDLGGRFLLEDTWTTFMKARLNCSRPGEV----PFYYHELQGTFFLPELDLIYGIFTTNVNSIAASAVCIFNLSAISQAFNGPFKYQ-ENSRSAWLPYPNPNPNFQCGTVDQGLYVNLTERNLQDAQKFILMHEVVQPVSPVPAFQEDSSRFSHVAVDVVQGRDALVHIIYLATDQGTIKKV-RAPLTPGATGCLLEEVELFPERRPEQVRGLRVLHSQSA--LFVGLRQHVAKVPLKRCHFHRTRSACIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISTCPTRNLTVDGRFGPWSAWTPCSH----TDGSAVGSCLCRT-RSCDSPAPQCGGWQCEGPRMEIT-NCSRNGGWTPWTSWSPCSTTCGIGFQVRQRACSNPAPRHGGRVCVGQNRE-----ERYCNEHLLCPPHMFWTGWGPWERCTAQCGGGVQARRRTCENGPDCVGCNVEYQSCNTNTCPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLP----DPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNIL-----------------PCPVDGMWSCWSSWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCSTQPCPESWSEWSDWSPCDASGVQIRARQCVL----LFPVGSQCSGNTTETRPCVYDSNFIPEVSVARSSSVEEKRCGEFNMFHMMAVGLSCSILGCLV-TLLVYTY 991          
BLAST of semaphorin 5-3 vs. TrEMBL
Match: A0A337S4F4 (Semaphorin 5A OS=Felis catus OX=9685 GN=SEMA5A PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 6.473e-46
Identity = 220/946 (23.26%), Postives = 370/946 (39.11%), Query Frame = 1
Query:  247 LHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQCTS-----EQCEKIIIDVVQFAKD-------SKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQPKI--CILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASS--LKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIER---------NTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNL-PLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTR--------------RTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR-MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPL--------IQNKPCL 2823
            L ++   +  +F  L++ P    + VV   N + RL+L +L+      +      KK C S     E+C+  I  V+    D       +    +C N  L SN  ++ DQ+    +       +  Q      +++  E   +++AT+   + G     Y+ L I   PL     N   +N+ N            ++S+      YF + E      C + V  +R  R+C+ND G   L  + ++ F K  + C +        PF Y    +  +L     +   FT+N     +SA+CV+ + +I  AFN   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  +  VTS     E  ++F  +A +     +    +++++T    +  +    L P    C+L +  L      E I  L+ ++   +  LFVG    + KIPL  C    T + C     P+C WD + KKC  +           S + C +     +      + W  C       D S +G C C               +    ++ I+  C  +G WT ++SWS CS TCG G +VR R C NP P++GG+ C G N E      + C+E         ++ W  W  C+  CG   ++R R C     C     E + CN+ P  E K  + W+ W+  N++      + R R+ C         + +L ++ R  +     ++D     +   ++G+F     +S+ + +   S WT               R R C  P        C G S++Y+ C I  C                    G   MR R C   +       C G  TE + C  + C  ++S+W++WS C+ +  + R RQC+     LFP+         +++PC+
Sbjct:   89 LREFRAKNAVDFSQLTFDPGQKEL-VVGARNYLFRLQLEDLSLIQAVEWGCDEVTKKACYSKGKSKEECQNYI-RVLLVGGDRLFTCGTNAFTPVCTNRSL-SNLTEIHDQISGMAR-----CPYSPQHNSTALLTAGGE---LYAATA-MDFPGRDPAIYRSLGILP-PLRTAQYNSKWLNEPNF-----------VSSYDIGNFTYFFFRENAVEHDCGKTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEV----PFYYNELQSTFFLPELDLIYGVFTTNVNSIAASAVCVFNLSAISQAFNGPFKYQ-ENSRSAWLPYPNPNPNFQCGTVDQGLYMNLTERNLQDAQKFILMHEVVQPVTSVPSFMEDNSRFSHVAVDVVQGRDMLVHIIYLATDYGTIKKV-RAPLAPAAGSCLLEEIELFPERRGEPIRSLQLLH--SRSALFVGLQEHVAKIPLKRCQFHRTRSACIGAQDPYCGWDMVMKKCTSLEESLSMTQWEQSTSTCPTRNLTVDGHFGAWSPWTPC----THTDGSAVGSCLCRTRSCDSPAPQCGGWECEGPRMEIA-NCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNRE-----ERYCNEHLLCPPHMFWTGWGPWERCTAQCGGGIQARRRTCENGPDCAGCNVEYQPCNINPCPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLP----DPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGLPCLGPSLEYQECNILPCPVDGVWSCWSPWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECDVSGVQIRARQCIL----LFPVGSQCSGNTTESRPCV 983          
BLAST of semaphorin 5-3 vs. TrEMBL
Match: A0A218V4X7 (Semaphorin-5A OS=Lonchura striata domestica OX=299123 GN=SEMA5A PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 6.698e-46
Identity = 213/924 (23.05%), Postives = 362/924 (39.18%), Query Frame = 1
Query:  247 LHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQCTS-----EQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDIVTSQAILY--ETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLL-EISLQPKICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASS--LKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTD---------LNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXT--------------RRTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR-MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPL 2802
            LH +      +F  L++ P    + +    N + RLKL +L+      +      K+ C S     E+C+  I          ++L +  N++    TN     +C      NL   H  Q +G     +   +   H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C + V  +R  R+C+ND G   + ++ ++ F K  + C +        PF Y    +  +L     +   FT+N     +SA+CV+ + +I  AFN   K   E +   +  Y N    F  G  D     NL     Q   K + +H  +     I Y  E  ++F  +  +     +    +++++T    +  +L  ++     C+L +  L      E I  L+ ++   +  LFVG    ++K+PL  C    T + C     P+C WD + KKC  +           S T C       +      +QW  C       D + +G C C   R  D         L E        C  +G WT ++SWS CS TCG G +VR R C NP P++GG+ C G N E      + C+E         ++ W  W  C+  CG   ++R R C     C     E + CN   C E K  + W+ W+  N++      + R R+ C         + +L ++ R  +     ++D     +   ++G+F     +S+ + +   S W+               R R C  P        C G S++Y+ C I  C          S         G   MR R C   +       C G  TE + C  + C  ++S+W+ WS+C+ + F+TR RQC+     LFP+
Sbjct:   49 LHVFKAEGAVDFSQLTFDPGQKEL-IAGARNYLFRLKLEDLSLIQAVEWQCDEATKRACYSKGKSKEECQNYI----------RVLLVGGNHLFTCGTNAFTP-ICTNRTLSNLTEIH-DQISGM----ARCPYSPQHNSTALLTSSGELYAATAMDFPGRDPAIYRSLGALPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGKTVF-SRAARVCKNDIGGKFVLADTWTTFMKARLNCSRPGEI----PFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAITQAFNGPFKYQ-ENSRSAWLPYPNPNPNFQCGTMDQGLYANLTERNLQDAQKFFLMHEVVQPVIPIPYFMEDNSRFSHVVVDVVQGKDTLFHIIYLATDYGTIKKVLAPVNQTSSSCLLEEIELLPKSQREPIRSLQILH--SQSVLFVGLQEHVIKVPLKRCLFYKTYSACIGSQDPYCGWDMVMKKCTTLEESMSMSEWEQSITVCPMRNLTVDGHFGTWSQWKPC----THTDGASVGSCLCRT-RMCDSPAPQCGGWLCEGPTMEIANCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNRE-----ERYCNEHLLCPPHVFWTGWGPWERCTAQCGGGIQARRRTCENGPDCPGCSVEYQPCNTNACPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLP----DPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRSGRYSAHTINGAWSPWSPWSQCSRDCSRGIRNRKRVCSNPEPKYGGLPCLGPSLEYQECNILPCPVDGGWSCWSSWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQPCPDSWSEWSTWSDCDSSGFQTRARQCIL----LFPV 928          

HSP 2 Score: 69.707 bits (169), Expect = 3.946e-8
Identity = 48/116 (41.38%), Postives = 66/116 (56.90%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-----SEKCTESLNEIKSCNL 2181
            C VDG W+ +SSWS CSATCG G  +R+R C NP P  GG  C G +TE  +C  + C +         +S+W+TWS C  + GF T  R+RQCI       +CT +  E ++C +
Sbjct:  840 CPVDGGWSCWSSWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQPCPD--------SWSEWSTWSDCDSS-GFQT--RARQCILLFPVGSQCTGNTTESRACAV 944          
BLAST of semaphorin 5-3 vs. TrEMBL
Match: G3ST50 (Semaphorin 5A OS=Loxodonta africana OX=9785 GN=SEMA5A PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.103e-45
Identity = 228/994 (22.94%), Postives = 392/994 (39.44%), Query Frame = 1
Query:  205 YPVLNMTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLN------FDSKYTLKKQCTS-----EQCEKIIIDVVQFAKD-------SKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDI--VTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQPKI--CILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLK----ENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISP---------ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNL-PLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTR--------------RTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR-MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPL--------IQNKPCL--------------RQIKDKP-AEFSFIYMIV 2874
            +PV++      +  L ++ + D  +F  L++ P    + VV   N + RL+L +L+      ++     KK C S     E+C+  I  V+    D       +    +C N  L SN  ++ DQ+    +       +  Q      +++  E   +++AT+   + G     Y+ L +   PL     N   +N+ N            ++S+      YF + E      C + V  +R  R+C+ND G   L  + ++ F K  + C +        PF Y    +   L     L   FT+N     +SA+C++ + +I  AF    K   E +   +  Y N    F  G  D    +NL     Q   K   +H  +  VT+     E  ++   +A +     +    +++++T    +  +    L P    C+L +  L     +E +  L+ ++   +  LFVG    + KIPL  C+   T + C     P+C WD   KKC  +S +    ++   +T  A   +    + Q +  + W  C       D S +G C C   R+ D    +    P          C  +G WT ++SWS CS TCG G +VR R C NP P++GG+ C G N E      + C+E         ++ W  W  C+  CG   ++R R C     C     E + CN  P  E K  + W+ W+  N++      + R R+ C         + +L ++ R  +     ++D     +   ++G+F     +S+ + +   S WT               R R C  P        C G S++Y+ C +  C          S         G   MR R C   +       C G  TE + C  + C  ++S+W++WS C+ +  + R RQC+     LFP+         +++PC               R +++K   EF+  +MI 
Sbjct:   34 HPVVSYEEIAPW--LREFRVKDAVDFSQLTFDPGQKEL-VVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYI-RVLLVGGDRLFTCGTNAFTPVCTNRTL-SNLTEIHDQISGMAR-----CPYSPQHNSTALLTAGGE---LYAATA-MDFPGRDPAIYRSLGVLP-PLRTAQYNSKWLNEPNF-----------VSSYDIGNFTYFFFRENAVEHDCGKTVF-SRAARVCKNDLGGRFLLEDTWTTFMKARLNCSRPGEV----PFYYNELQSTFLLPELDLLYGIFTTNVNSIAASAVCIFNLSAISQAFKGPFKYQ-ENSRSAWLPYPNPNPNFQCGTVDQGLYVNLTERNLQDAQKFILMHEVVQPVTAVPAFMEDNSRLSHVAVDVVQGRDLLVHIMYLATDHGTIKKV-RAPLGPAAGSCLLEEVELFPERRTEPVRSLRILH--SRSVLFVGLREHVAKIPLKRCHFHKTRSACIGAQDPYCGWDVALKKC--MSLEESLSMVQWEQTISACPTRNLTVDGQFSPWSPWTPC----THTDGSAVGSCLCRT-RSCDSPAPQCGGWPCTGPSVEITNCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNRE-----ERYCNEHLLCPPHVFWTGWGPWERCTAQCGGGIQARHRTCENGPDCAGCNVEYQPCNTNPCPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLP----DPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRMCNNPEPKYGGLPCLGPSLEYQECNVLPCPVDGLWSCWSSWSKCSTTCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECDASGVQVRTRQCIL----LFPVGGQCSGNSTESRPCAFDSNFIPEVSVARSRSVEEKRCGEFNMFHMIA 972          
BLAST of semaphorin 5-3 vs. Ensembl Cavefish
Match: sema5bb (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Bb [Source:ZFIN;Acc:ZDB-GENE-130530-778])

HSP 1 Score: 171.014 bits (432), Expect = 7.185e-43
Identity = 189/779 (24.26%), Postives = 312/779 (40.05%), Query Frame = 1
Query:  781 IITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELK-KSSEKTSY--KFNEYKNI-CQLFTTGNQDSNFL-INLQTLCKTYPLHRDIV---TSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQP-KICILRKF-LLSEN---ITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQC---SAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQW-----------------VQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQ-YESFNLSLNDITRYIVYPSCSTADCQ--------FKNNKQI--INGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAE---FSFIYMIVSGLVGFVCGLLMGSILCYI 2931
             +++++  +  YF   ET     C + V  +R+ R+C+ND G   L  + ++ F K  + C    S     PF Y    +  +L     +   FT+N     +SA+C + + +I  AFN   + + + +TS+    N   N  C     G    N    +LQ   + + L  D+V   +   ++ +   +F ++A +     +    V+++ T+   V   L  S    + C L +  LL E+     L   + ++D+  LFVG + +++KIPL+ C    T + C     P+C WD   K+C  +   +       + T+C       Q+     W                  QCR +S  +   Q G  +C           K+ ++  C  +G WT +SSWS CS +CG G  VR R C+NP P++GG+ C G   E ++C       L        +  W++WS CS  CG   +SR R C     C+    E K+CNL  C E +  + WS W   NVT      + R+RF C           L    +      P   T  C+         + ++ +  + G      E  S  +      +  R R+C++P        C G  ++Y+ C                    PC                    C G  TE + C   +C   +  W+EWS+CEE  F+ R R C  +     P   N    R     P+E   FS  +++++G+  F+   L GS + Y+
Sbjct:  161 FVSAYEVGRFTYFFLRETAVEQDCGKAVY-SRVARVCQNDVGGRFLLEDTWTTFMKARLNC----SRSGDVPFYYHELQSTFYLPEQDIIYGVFTTNVNSIAASAVCAFNLSAITQAFNGPFRYQENPRTSWLSTPNPIPNFQCGTVGDGGPGGNLTERSLQDAQRLF-LMNDVVQPISVNPLISQDNIRFSKVAVDIVQGRDRLYHVIYIGTEYGTVIKALSTSNNSLRGCYLEEMKLLPEDEWEPILNLQILQSDR-SLFVGLNSKVLKIPLERCSNYQTQSDCLDARDPYCGWDRKQKRCSTIEESSNMSQWIQNITHCPER-NLTQDGAFGSWSPWQSCNHNDGGENTSACQCRSRSCDSPAPQCGGLECV--------GAKIEVA-NCSRNGGWTPWSSWSPCSTSCGVGFEVRQRSCNNPAPRHGGRVCVGQAREERLCNENTPCPLPVS-----WVPWSSWSKCSAPCGGGIQSRVRTCENGNTCSGCPLEYKACNLEACAEVRRNTPWSPWYPVNVTVSGARQEQRVRFTCRALLANPHDLQLGKRKLETRTCPPGDGTPGCETDGLVDDLVRVSRPVNHVQGASWSPWETWSSCSKECSKGFRTRKRSCLSPDGKSSPFSCSGTPVEYQDC-----------------NTQPCSG----------------DICIGLHTEEALCNTHECE-GWGVWSEWSDCEEG-FQHRSRTCDVSTE---PCEGNNTAWRAC--APSESTGFSLFHLLLTGVSCFL-AALFGSFMVYV 876          
BLAST of semaphorin 5-3 vs. Ensembl Cavefish
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:103027847])

HSP 1 Score: 168.703 bits (426), Expect = 3.770e-42
Identity = 207/909 (22.77%), Postives = 355/909 (39.05%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNL-----------NFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDIVTSQAILY--ETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLL-EISLQPKICILRK---FLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIER---------NTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCN-LPLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPS------CSTADCQFKNNK---QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMC---PIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFP 2799
            ++  L++ P  + + +V   N + RL L +L            F       +  + E+C+  I          ++L +  + +    TN     +C      NL   H  Q +G     +   +  +H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C   V  +R  R+C+ND G   L  + ++ F K  + C +        PF Y       +L   + L   FT+N     +SA+C + + +I   F+   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  I     + Y  E   +F  +A +     +    +++++T    +  +L  ++     C+L +   F       +L  +    +  LFVG   +++KIPL  C    +   C     P+C WD + KKC  +           S T C   +   +    + + W  C      +D   +G+C+C                     + ++  C  +G WT +++W+ CS +CG G +VR R C NP P++GG+ C G N E + C  +  C    +      +S W+ W  C+  CG   +SR R C    +C     E +SCN LP  + K  + W+ W+  N++      + R R+ C K    E   L +      + Y S      CST     ++ +     +NG +S WS WS CS  C     +R+ R C  P        C G + +Y+ C   P  +  S            T C   G  +R R C           C G  TE + C  + C  ++S W+EWS+C+    + R R C    + LFP
Sbjct:   59 DYSQLTFDPGQNEL-IVGARNHLFRLHLEDLALIQEAEWHCDEFTKGACFSRGKSEEECQNYI----------RVLLVNGDRLFTCGTNAFT-PICTNRTLTNLTEIH-DQISGM----ARCPYNPLHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGRTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEI----PFSYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFKYQ-ENSRSAWLPYPNPNPDFQCGTIDYGSYVNLTERNLQDAQKFILMHEVIQPIVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELFPPRRRQPILSLLILHSRSELFVGVRDQVIKIPLIRCNFHKSREACVGARDPYCGWDLVLKKCVMLEDSVSMSQWEQSITKCPVRNVTVDGHFGLWSSWRPCSH----SDGGSVGLCQCRTRACNSPSPQCGGQQCQGTSVEVA-NCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLPCPPHIY------WSAWSPWERCTVPCGGGIQSRRRTCENGNECPGCSVEYQSCNTLPCPDLKKTTPWTPWTPVNISDNGGHYEQRFRYTC-KARVAEPGLLEVGRQRIEMRYCSSDGSTGCSTDGDLLRSGRITGLTVNGGWSAWSSWSQCSRDCSSGIRSRK-RTCTNPKPKYGGTSCLGPAQEYQECNTTPCPVDGSWSCWSPWSKCSVT-CGG-GHYIRTRTCSNPPPAYGGDICLGLHTEEALCNTQPCPESWSDWSEWSHCDSAGVQVRLRHC----DVLFP 924          

HSP 2 Score: 77.7962 bits (190), Expect = 5.261e-14
Identity = 40/114 (35.09%), Postives = 55/114 (48.25%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-----ISEKCTESLNEIKSC 2175
            C VDG W+ +S WS CS TCG G  +R+R C NP P  GG  C G +TE  +C  + C E         +S W+ WS C        + R R C        +C  + +E ++C
Sbjct:  837 CPVDGSWSCWSPWSKCSVTCGGGHYIRTRTCSNPPPAYGGDICLGLHTEEALCNTQPCPE--------SWSDWSEWSHCDSA---GVQVRLRHCDVLFPTGNQCAGNSSESRAC 939          
BLAST of semaphorin 5-3 vs. Ensembl Cavefish
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:103027847])

HSP 1 Score: 168.703 bits (426), Expect = 3.915e-42
Identity = 207/909 (22.77%), Postives = 355/909 (39.05%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNL-----------NFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDIVTSQAILY--ETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLL-EISLQPKICILRK---FLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIER---------NTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCN-LPLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPS------CSTADCQFKNNK---QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMC---PIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFP 2799
            ++  L++ P  + + +V   N + RL L +L            F       +  + E+C+  I          ++L +  + +    TN     +C      NL   H  Q +G     +   +  +H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C   V  +R  R+C+ND G   L  + ++ F K  + C +        PF Y       +L   + L   FT+N     +SA+C + + +I   F+   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  I     + Y  E   +F  +A +     +    +++++T    +  +L  ++     C+L +   F       +L  +    +  LFVG   +++KIPL  C    +   C     P+C WD + KKC  +           S T C   +   +    + + W  C      +D   +G+C+C                     + ++  C  +G WT +++W+ CS +CG G +VR R C NP P++GG+ C G N E + C  +  C    +      +S W+ W  C+  CG   +SR R C    +C     E +SCN LP  + K  + W+ W+  N++      + R R+ C K    E   L +      + Y S      CST     ++ +     +NG +S WS WS CS  C     +R+ R C  P        C G + +Y+ C   P  +  S            T C   G  +R R C           C G  TE + C  + C  ++S W+EWS+C+    + R R C    + LFP
Sbjct:   59 DYSQLTFDPGQNEL-IVGARNHLFRLHLEDLALIQEAEWHCDEFTKGACFSRGKSEEECQNYI----------RVLLVNGDRLFTCGTNAFT-PICTNRTLTNLTEIH-DQISGM----ARCPYNPLHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGRTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEI----PFSYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFKYQ-ENSRSAWLPYPNPNPDFQCGTIDYGSYVNLTERNLQDAQKFILMHEVIQPIVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELFPPRRRQPILSLLILHSRSELFVGVRDQVIKIPLIRCNFHKSREACVGARDPYCGWDLVLKKCVMLEDSVSMSQWEQSITKCPVRNVTVDGHFGLWSSWRPCSH----SDGGSVGLCQCRTRACNSPSPQCGGQQCQGTSVEVA-NCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLPCPPHIY------WSAWSPWERCTVPCGGGIQSRRRTCENGNECPGCSVEYQSCNTLPCPDLKKTTPWTPWTPVNISDNGGHYEQRFRYTC-KARVAEPGLLEVGRQRIEMRYCSSDGSTGCSTDGDLLRSGRITGLTVNGGWSAWSSWSQCSRDCSSGIRSRK-RTCTNPKPKYGGTSCLGPAQEYQECNTTPCPVDGSWSCWSPWSKCSVT-CGG-GHYIRTRTCSNPPPAYGGDICLGLHTEEALCNTQPCPESWSDWSEWSHCDSAGVQVRLRHC----DVLFP 924          

HSP 2 Score: 77.7962 bits (190), Expect = 5.202e-14
Identity = 40/114 (35.09%), Postives = 55/114 (48.25%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-----ISEKCTESLNEIKSC 2175
            C VDG W+ +S WS CS TCG G  +R+R C NP P  GG  C G +TE  +C  + C E         +S W+ WS C        + R R C        +C  + +E ++C
Sbjct:  837 CPVDGSWSCWSPWSKCSVTCGGGHYIRTRTCSNPPPAYGGDICLGLHTEEALCNTQPCPE--------SWSDWSEWSHCDSA---GVQVRLRHCDVLFPTGNQCAGNSSESRAC 939          
BLAST of semaphorin 5-3 vs. Ensembl Cavefish
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:103027847])

HSP 1 Score: 167.933 bits (424), Expect = 6.664e-42
Identity = 207/909 (22.77%), Postives = 355/909 (39.05%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNL-----------NFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDIVTSQAILY--ETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLL-EISLQPKICILRK---FLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIER---------NTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCN-LPLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPS------CSTADCQFKNNK---QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMC---PIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFP 2799
            ++  L++ P  + + +V   N + RL L +L            F       +  + E+C+  I          ++L +  + +    TN     +C      NL   H  Q +G     +   +  +H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C   V  +R  R+C+ND G   L  + ++ F K  + C +        PF Y       +L   + L   FT+N     +SA+C + + +I   F+   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  I     + Y  E   +F  +A +     +    +++++T    +  +L  ++     C+L +   F       +L  +    +  LFVG   +++KIPL  C    +   C     P+C WD + KKC  +           S T C   +   +    + + W  C      +D   +G+C+C                     + ++  C  +G WT +++W+ CS +CG G +VR R C NP P++GG+ C G N E + C  +  C    +      +S W+ W  C+  CG   +SR R C    +C     E +SCN LP  + K  + W+ W+  N++      + R R+ C K    E   L +      + Y S      CST     ++ +     +NG +S WS WS CS  C     +R+ R C  P        C G + +Y+ C   P  +  S            T C   G  +R R C           C G  TE + C  + C  ++S W+EWS+C+    + R R C    + LFP
Sbjct:   59 DYSQLTFDPGQNEL-IVGARNHLFRLHLEDLALIQEAEWHCDEFTKGACFSRGKSEEECQNYI----------RVLLVNGDRLFTCGTNAFT-PICTNRTLTNLTEIH-DQISGM----ARCPYNPLHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGRTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEI----PFSYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFKYQ-ENSRSAWLPYPNPNPDFQCGTIDYGSYVNLTERNLQDAQKFILMHEVIQPIVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELFPPRRRQPILSLLILHSRSELFVGVRDQVIKIPLIRCNFHKSREACVGARDPYCGWDLVLKKCVMLEDSVSMSQWEQSITKCPVRNVTVDGHFGLWSSWRPCSH----SDGGSVGLCQCRTRACNSPSPQCGGQQCQGTSVEVA-NCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLPCPPHIY------WSAWSPWERCTVPCGGGIQSRRRTCENGNECPGCSVEYQSCNTLPCPDLKKTTPWTPWTPVNISDNGGHYEQRFRYTC-KARVAEPGLLEVGRQRIEMRYCSSDGSTGCSTDGDLLRSGRITGLTVNGGWSAWSSWSQCSRDCSSGIRSRK-RTCTNPKPKYGGTSCLGPAQEYQECNTTPCPVDGSWSCWSPWSKCSVT-CGG-GHYIRTRTCSNPPPAYGGDICLGLHTEEALCNTQPCPESWSDWSEWSHCDSAGVQVRLRHC----DVLFP 924          

HSP 2 Score: 77.411 bits (189), Expect = 6.614e-14
Identity = 40/114 (35.09%), Postives = 55/114 (48.25%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-----ISEKCTESLNEIKSC 2175
            C VDG W+ +S WS CS TCG G  +R+R C NP P  GG  C G +TE  +C  + C E         +S W+ WS C        + R R C        +C  + +E ++C
Sbjct:  837 CPVDGSWSCWSPWSKCSVTCGGGHYIRTRTCSNPPPAYGGDICLGLHTEEALCNTQPCPE--------SWSDWSEWSHCDSA---GVQVRLRHCDVLFPTGNQCAGNSSESRAC 939          
BLAST of semaphorin 5-3 vs. Ensembl Cavefish
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:103027847])

HSP 1 Score: 164.851 bits (416), Expect = 7.102e-41
Identity = 186/782 (23.79%), Postives = 311/782 (39.77%), Query Frame = 1
Query:  622 VHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDIVTSQAILY--ETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLL-EISLQPKICILRK---FLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIER---------NTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCN-LPLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPS------CSTADCQFKNNK---QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMC---PIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFP 2799
            +H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C   V  +R  R+C+ND G   L  + ++ F K  + C +        PF Y       +L   + L   FT+N     +SA+C + + +I   F+   K   E +   +  Y N    F  G  D    +NL     Q   K   +H  I     + Y  E   +F  +A +     +    +++++T    +  +L  ++     C+L +   F       +L  +    +  LFVG   +++KIPL  C    +   C     P+C WD + KKC  +           S T C   +   +    + + W  C      +D   +G+C+C                     + ++  C  +G WT +++W+ CS +CG G +VR R C NP P++GG+ C G N E      + C+E         +S W+ W  C+  CG   +SR R C    +C     E +SCN LP  + K  + W+ W+  N++      + R R+ C K    E   L +      + Y S      CST     ++ +     +NG +S WS WS CS  C     +R+ R C  P        C G + +Y+ C   P  +  S            T C   G  +R R C           C G  TE + C  + C  ++S W+EWS+C+    + R R C    + LFP
Sbjct:  160 LHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEP-NFVSSYDIGNFTYFFFRENAVEHDCGRTVF-SRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEI----PFSYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFKYQ-ENSRSAWLPYPNPNPDFQCGTIDYGSYVNLTERNLQDAQKFILMHEVIQPIVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELFPPRRRQPILSLLILHSRSELFVGVRDQVIKIPLIRCNFHKSREACVGARDPYCGWDLVLKKCVMLEDSVSMSQWEQSITKCPVRNVTVDGHFGLWSSWRPCSH----SDGGSVGLCQCRTRACNSPSPQCGGQQCQGTSVEVA-NCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNRE-----ERYCNEHLPCPPHIYWSAWSPWERCTVPCGGGIQSRRRTCENGNECPGCSVEYQSCNTLPCPDLKKTTPWTPWTPVNISDNGGHYEQRFRYTC-KARVAEPGLLEVGRQRIEMRYCSSDGSTGCSTDGDLLRSGRITGLTVNGGWSAWSSWSQCSRDCSSGIRSRK-RTCTNPKPKYGGTSCLGPAQEYQECNTTPCPVDGSWSCWSPWSKCSVT-CGG-GHYIRTRTCSNPPPAYGGDICLGLHTEEALCNTQPCPESWSDWSEWSHCDSAGVQVRLRHC----DVLFP 916          

HSP 2 Score: 77.7962 bits (190), Expect = 5.244e-14
Identity = 40/114 (35.09%), Postives = 55/114 (48.25%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-----ISEKCTESLNEIKSC 2175
            C VDG W+ +S WS CS TCG G  +R+R C NP P  GG  C G +TE  +C  + C E         +S W+ WS C        + R R C        +C  + +E ++C
Sbjct:  829 CPVDGSWSCWSPWSKCSVTCGGGHYIRTRTCSNPPPAYGGDICLGLHTEEALCNTQPCPE--------SWSDWSEWSHCDSA---GVQVRLRHCDVLFPTGNQCAGNSSESRAC 931          
BLAST of semaphorin 5-3 vs. Ensembl Sea Lamprey
Match: sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:ZFIN;Acc:ZDB-GENE-030131-8969])

HSP 1 Score: 91.2781 bits (225), Expect = 5.532e-19
Identity = 88/379 (23.22%), Postives = 151/379 (39.84%), Query Frame = 1
Query: 1285 SQAILYETRTKFFEIASEESSWSNNRRV--VLFVSTQTKHVTSLLEISLQPKICILRKFLLS-----ENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLK----ENQNAVLNQWVQCRLKSIVNDLSQIGMCK---CNIE------RNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTR----GRYSQWTTWSACSKTCGFSTKSRSRQC------------ISEKCTESLNEIKSCNLPLC-EFKIYSQWSSW---------SKFNVTTFTKIRLRFKC 2274
             +A+L    ++F  +A + S+      V  +LF +T    V  +   S     C++ +  L      + +  L        +Y  VGT   ++K+PL+ C    T++ C     PFC WD   ++C   + +      ++     A +++    +      + W  C+        S   +C+   C+        R  D   +++     C  +G WT +S+WS C+ TC  G +VR R C NP P++GG+ C G N E + C          E+TR      +S W  W  CS  CG   ++R R C              E C     E ++C+   C E +  + W+ W         ++   T   + R R+ C
Sbjct:  362 GRALLARHGSRFTRLAIDSSARGRGGVVHRMLFEATDEGTVQKVAAAS----GCVIDEMELPWPAARQRVRALHASPGDGALY--VGTDGAVLKLPLERCSAFRTESTCVGSRDPFCGWDLTLRRC--TTLRESSGSGTSDSGGTAWNVRNLTVDGALGPWSVWETCQHSDGGETGSSSCLCRRRACDTPLPQCAGRPCDGATVQVA---NCSRNGGWTPWSAWSVCTTTCSMGFQVRQRSCSNPSPRHGGRVCVGQNREERFC---------NEHTRCPVPATWSPWGPWERCSAPCGGGVRTRRRTCANANANANANAANGEACAGCDTEHQACHSDPCPEARKNTPWTPWLPVPPSAAGNRTGATGRHEQRFRYTC 720          
BLAST of semaphorin 5-3 vs. Ensembl Sea Lamprey
Match: thbs1a (thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402-2])

HSP 1 Score: 88.1965 bits (217), Expect = 6.943e-18
Identity = 47/120 (39.17%), Postives = 61/120 (50.83%), Query Frame = 1
Query: 1852 KVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEK-------CTESLNEIKSCNLPLC 2190
            + DG W+ +S WS CS TCG G   R R C++P PQ GG EC G+  E Q C  + C         G+Y  W+ WSAC  TCG + + R+R C + K       C  S  E + CN   C
Sbjct:  429 RQDGGWSFWSPWSSCSVTCGAGVNTRIRLCNSPVPQMGGDECDGSGRENQKCEMEPC------PVDGQYGPWSPWSACPVTCGGALRERARLCNNPKPQYNGKDCLGSDRETEICNKKPC 542          

HSP 2 Score: 77.7962 bits (190), Expect = 1.058e-14
Identity = 50/146 (34.25%), Postives = 72/146 (49.32%), Query Frame = 1
Query: 1867 WTVYSSWSDCSATCGNGTRVRSRFCD---NPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS-------EKCTESLNEIKSCNLPLCEFKI-YSQWSSWSKFNVTTFTKIRLRFK 2271
            W+ +S W++CS TCG+GT+ R R CD   NP        C G + + + C  K CD+   ++  G +S W+ WS+CS TCG    +R R C S       ++C  S  E + C +  C     Y  WS WS   VT    +R R +
Sbjct:  378 WSPWSEWTECSVTCGSGTQQRGRSCDSVNNP--------CEGPSIQGRTCQLKACDKRVRQD--GGWSFWSPWSSCSVTCGAGVNTRIRLCNSPVPQMGGDECDGSGRENQKCEMEPCPVDGQYGPWSPWSACPVTCGGALRERAR 513          

HSP 3 Score: 67.3958 bits (163), Expect = 1.643e-11
Identity = 36/96 (37.50%), Postives = 53/96 (55.21%), Query Frame = 1
Query: 1735 VQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC 2022
            V  R++   + + Q+G  +C+    +     K  + P C VDG +  +S WS C  TCG   R R+R C+NPKPQ  GK+C G++ E +IC  K C
Sbjct:  451 VNTRIRLCNSPVPQMGGDECD---GSGRENQKCEMEP-CPVDGQYGPWSPWSACPVTCGGALRERARLCNNPKPQYNGKDCLGSDRETEICNKKPC 542          
BLAST of semaphorin 5-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000912.1 (pep scaffold:Pmarinus_7.0:GL477542:3:94122:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 1.519e-17
Identity = 38/115 (33.04%), Postives = 62/115 (53.91%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCE 2193
            C++DG W  ++ WS C+ +CG+G + R R CD+P P  GG+ C G + E + C  + C +         +S+W+ W+ CS  CG   ++R R C+   C       K+CN  +C+
Sbjct: 1388 CRIDGGWGSWTGWSACARSCGDGVQYRYRLCDSPAPHAGGRGCAGPSREEKECRARSCVD------SWPWSEWSPWANCSVGCGGGEQTRHRSCLHPPCPGLATHSKACNTHVCQ 1496          

HSP 2 Score: 71.2478 bits (173), Expect = 1.250e-12
Identity = 39/108 (36.11%), Postives = 51/108 (47.22%), Query Frame = 1
Query: 1774 QIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTC 2097
            QIG  KC  E      E    +S +C VDG W+ +S W+ CSA CG G + R RFC  P P   G++C G  +E ++C    C   N     G Y     +S C   C
Sbjct:  970 QIGCTKCTCENG----EAARCVSVDCDVDGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTHRNCSEVAGSY-----YSHCGPPC 1068          

HSP 3 Score: 68.1662 bits (165), Expect = 1.085e-11
Identity = 47/161 (29.19%), Postives = 68/161 (42.24%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGN-GTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDE-----------------LNFENTRGRYSQWTTWSACSKTCGF----STKSRSRQCISE-KCTESLNEIKSCNLPLCEFKI------------YSQWSSWS 2226
            C VDG  + +S W  CS TCG  G   R+R C  P P++GG+ CTG   + + C    C                   +   +T G +  WT WS CS+TC      + K+R R C     C     +   CNLP C+  +            ++ W++WS
Sbjct: 1625 CPVDGRLSSWSGWERCSRTCGGLGRMTRTRTCSEPAPRHGGRPCTGPTMDIKYCHTPDCRAAYTTPSPANVTIAPMPGVRSADTEG-FGSWTPWSPCSRTCSDPELPALKTRVRFCAPRATCRGESYQEHLCNLPQCDAPVSCEDGDCSVDCSWNAWTAWS 1784          

HSP 4 Score: 65.0846 bits (157), Expect = 9.903e-11
Identity = 33/94 (35.11%), Postives = 46/94 (48.94%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC 2130
            C VD  W+ +++WS C+ TC  GTR R R   +P    GG+ C+G   E   C    C        +  + +W  WS CS +CG   + RSR C
Sbjct:  801 CSVDCGWSEWTAWSLCTKTCDVGTRRRFRSATHPPAAFGGRGCSGLPVEVAYCGLLPC--------KAVWGEWEAWSGCSASCGGGVRVRSRTC 886          

HSP 5 Score: 63.929 bits (154), Expect = 2.382e-10
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 1
Query: 1822 EIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCD 2025
            E++   +  CKVDG W+ +S W+ C   CG G  +R R C NP  +NGG+ C G+  +  +C  + CD
Sbjct: 1820 EVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCD 1887          

HSP 6 Score: 62.3882 bits (150), Expect = 5.826e-10
Identity = 25/58 (43.10%), Postives = 34/58 (58.62%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC 2022
            C V+G W  +S+WS C   CG G RVR R C  P P+NGG+ C G+  + + C  + C
Sbjct:  358 CPVEGQWGAWSAWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPC 415          

HSP 7 Score: 60.8474 bits (146), Expect = 1.760e-9
Identity = 37/104 (35.58%), Postives = 53/104 (50.96%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC--DELNFE---NTRGRYSQWTTWSACSKTCGFS-----TKSRSRQC 2130
            C V   W+ +S W+ C   C  G++ R R   NP    GG  C G++TE + C    C  DE   E     RG + QW+ WS C++TC +S     T++R R+C
Sbjct:  518 CPVHCGWSAWSPWTPCDRPCRTGSQERYRSPTNPAASGGGAPCVGDSTELRDCNAGPCPGDEAPEEGGDGDRGGWGQWSAWSRCTRTCFYSPERVGTRARHRRC 621          

HSP 8 Score: 57.3806 bits (137), Expect = 2.156e-8
Identity = 38/102 (37.25%), Postives = 52/102 (50.98%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQ---ICVN---KKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS 2136
            C VDG W  +S W+ CS TCG+ T  R R C  P P++GG  C G    ++   + V    K C+   F  T G +  W++WSAC    G     R+R+C S
Sbjct: 1147 CPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNLFPFCPTDGGWGFWSSWSACDACAG-GAAVRTRECNS 1247          

HSP 9 Score: 55.4546 bits (132), Expect = 8.671e-8
Identity = 32/107 (29.91%), Postives = 48/107 (44.86%), Query Frame = 1
Query: 1876 YSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS------EKCTESLNEIKSCN 2178
            +S+W +CS +CG GTR R R C +    +    C G   + + C  + C              W  WS+CS +CG    SR+R  ++       +C E L   +SCN
Sbjct: 2524 WSAWGECSRSCGGGTRARHRDCPDASAPHA---CPGEPQQSEACSPQPC------RADCVLGDWAAWSSCSASCGGGVSSRNRSVVTAAAFGGAECPEPLVAQRSCN 2621          

HSP 10 Score: 55.0694 bits (131), Expect = 1.126e-7
Identity = 22/60 (36.67%), Postives = 35/60 (58.33%), Query Frame = 1
Query: 1876 YSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGR 2055
            ++ WSDC+ +CG G ++R+R C NP P+N G  C G + E Q C    C  +++ +   R
Sbjct: 2093 WAPWSDCTTSCGTGKQIRTRACINPPPRNNGTACQGPSLENQECATAPCPVISWSSLSNR 2152          

HSP 11 Score: 55.0694 bits (131), Expect = 1.257e-7
Identity = 35/125 (28.00%), Postives = 51/125 (40.80%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGG--KECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS-------EKCTESLNEIKSCNLPLCE 2193
            +C VD  W  +++WS CS  CG G + R R   NP   NG    +    N E + C    C         G +S W+ W+ C + CG     R R C +       + C     ++  CN   C+
Sbjct: 1770 DCSVDCSWNAWTAWSTCSRPCGVGQQQRMR-TYNPPLGNGSWCPDIIAGNWEVRFCNTDVC------KVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCD 1887          
BLAST of semaphorin 5-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000917.1 (pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 3.969e-17
Identity = 45/120 (37.50%), Postives = 64/120 (53.33%), Query Frame = 1
Query: 1774 QIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTC-GFSTKSRSRQC 2130
            QIG  KC  E      E    +S +C VDG W+ +S W+ CSA CG G + R RFC  P P   G++C G  +E ++C    C +       G +S W+ W+ CS++C G   +SR+R C
Sbjct:  919 QIGCTKCTCENG----EAARCVSVDCDVDGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTQ------DGAWSGWSRWAECSRSCGGGGLRSRARAC 1028          

HSP 2 Score: 77.7962 bits (190), Expect = 1.432e-14
Identity = 47/144 (32.64%), Postives = 67/144 (46.53%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGN-GTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGF----STKSRSRQCISE-KCTESLNEIKSCNLPLCEFKI------------YSQWSSWS 2226
            C VDG  + +S W  CS TCG  G   R+R C  P P++GG+ CTG   + + C    C      +T G +  WT WS CS+TC      + K+R R C     C     +   CNLP C+  +            ++ W++WS
Sbjct: 1586 CPVDGRLSSWSGWERCSRTCGGLGRMTRTRTCSEPAPRHGGRPCTGPTMDIKYCHTPDCRGERSADTEG-FGSWTPWSPCSRTCSDPELPALKTRVRFCAPRATCRGESYQEHLCNLPQCDAPVSCEDGDCSVDCSWNAWTAWS 1728          

HSP 3 Score: 68.9366 bits (167), Expect = 7.532e-12
Identity = 27/59 (45.76%), Postives = 38/59 (64.41%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC 2022
            +C+VDG WT ++ WSDC+ +CG G ++R+R C NP P+N G  C G + E Q C    C
Sbjct: 2027 DCRVDGGWTPWAPWSDCTTSCGTGKQIRTRACINPPPRNNGTACQGPSLENQECATAPC 2085          

HSP 4 Score: 68.5514 bits (166), Expect = 8.993e-12
Identity = 39/126 (30.95%), Postives = 61/126 (48.41%), Query Frame = 1
Query: 1831 LTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYS 2208
            + I+P C +D  W+ +++WS C+ TC  GTR R R   +P    GG+ C+G   E   C    C        +  + +W  WS CS +CG   + RSR C     T +  +++SC    C+ +  S
Sbjct:  735 VAIAPCCPLDCGWSEWTAWSLCTKTCDVGTRRRFRSATHPPAAFGGRGCSGLPVEVAYCGLLPC--------KAVWGEWEAWSGCSASCGGGVRVRSRTCP----TPAPPDMESCGTESCDGQTLS 848          

HSP 5 Score: 64.3142 bits (155), Expect = 1.925e-10
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 1
Query: 1822 EIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCD 2025
            E++   +  CKVDG W+ +S W+ C   CG G  +R R C NP  +NGG+ C G+  +  +C  + CD
Sbjct: 1764 EVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCD 1831          

HSP 6 Score: 63.929 bits (154), Expect = 2.241e-10
Identity = 26/58 (44.83%), Postives = 34/58 (58.62%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC 2022
            C V+G W  +SSWS C   CG G RVR R C  P P+NGG+ C G+  + + C  + C
Sbjct:  301 CPVEGQWGAWSSWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPC 358          

HSP 7 Score: 62.7734 bits (151), Expect = 4.670e-10
Identity = 44/146 (30.14%), Postives = 67/146 (45.89%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC--DELNFE---NTRGRYSQWTTWSACSKTCGFS-----TKSRSRQC--------ISEKCTESLNEIKSCNLPLCEFK----IYSQWSS 2220
            C V   W+ +S W+ C   C  G++ R R   NP    GG  C G++TE + C    C  DE   E     RG + QW+ WS C++TC +S     T++R R+C          + C E   + + C +  C  K     + +WS+
Sbjct:  461 CPVHCGWSAWSPWTPCDRPCRTGSQERYRSPTNPAASGGGAPCVGDSTELRDCNAGPCPGDEAPEEGGDGDRGGWGQWSAWSRCTRTCFYSPERVGTRARHRRCNATAVDDVTGDPCPEEDAQTELCGVRPCPVKKKTSFFVEWSN 606          

HSP 8 Score: 59.3066 bits (142), Expect = 6.123e-9
Identity = 31/84 (36.90%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNG-TRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTC 2097
            C  DG W+ +S W++CS +CG G  R R+R CD P P  GG  C G   + Q C  + C + N     G Y     +S C   C
Sbjct:  997 CTQDGAWSGWSRWAECSRSCGGGGLRSRARACDAPAPGGGGDYCEGPGVDTQECHAEPCPDRNCSEVAGSY-----YSHCGPPC 1075          

HSP 9 Score: 57.7658 bits (138), Expect = 1.714e-8
Identity = 38/102 (37.25%), Postives = 52/102 (50.98%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQ---ICVN---KKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS 2136
            C VDG W  +S W+ CS TCG+ T  R R C  P P++GG  C G    ++   + V    K C+   F  T G +  W++WSAC    G     R+R+C S
Sbjct: 1154 CPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNLFPFCPTDGGWGFWSSWSACDACAG-GAAVRTRECNS 1254          

HSP 10 Score: 55.0694 bits (131), Expect = 9.661e-8
Identity = 35/125 (28.00%), Postives = 51/125 (40.80%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGG--KECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS-------EKCTESLNEIKSCNLPLCE 2193
            +C VD  W  +++WS CS  CG G + R R   NP   NG    +    N E + C    C         G +S W+ W+ C + CG     R R C +       + C     ++  CN   C+
Sbjct: 1714 DCSVDCSWNAWTAWSTCSRPCGVGQQQRMR-TYNPPLGNGSWCPDIIAGNWEVRFCNTDVC------KVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCD 1831          
BLAST of semaphorin 5-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000925.1 (pep scaffold:Pmarinus_7.0:GL477542:4188:92377:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 9.290e-17
Identity = 45/120 (37.50%), Postives = 64/120 (53.33%), Query Frame = 1
Query: 1774 QIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTC-GFSTKSRSRQC 2130
            QIG  KC  E      E    +S +C VDG W+ +S W+ CSA CG G + R RFC  P P   G++C G  +E ++C    C +       G +S W+ W+ CS++C G   +SR+R C
Sbjct:  756 QIGCTKCTCENG----EAARCVSVDCDVDGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTQ------DGAWSGWSRWAECSRSCGGGGLRSRARAC 865          

HSP 2 Score: 76.2554 bits (186), Expect = 3.471e-14
Identity = 47/144 (32.64%), Postives = 67/144 (46.53%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGN-GTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGF----STKSRSRQCISE-KCTESLNEIKSCNLPLCEFKI------------YSQWSSWS 2226
            C VDG  + +S W  CS TCG  G   R+R C  P P++GG+ CTG   + + C    C      +T G +  WT WS CS+TC      + K+R R C     C     +   CNLP C+  +            ++ W++WS
Sbjct: 1411 CPVDGRLSSWSGWERCSRTCGGLGRMTRTRTCSEPAPRHGGRPCTGPTMDIKYCHTPDCRGERSADTEG-FGSWTPWSPCSRTCSDPELPALKTRVRFCAPRATCRGESYQEHLCNLPQCDAPVSCEDGDCSVDCSWNAWTAWS 1553          

HSP 3 Score: 68.9366 bits (167), Expect = 6.468e-12
Identity = 32/86 (37.21%), Postives = 50/86 (58.14%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC-DELNFENTRGRYSQWTTWSACSKTCG 2100
            +C+VDG WT ++ WSDC+ +CG G ++R+R C NP P+N G  C G + E Q C    C D+   +  + R     + ++ S+ CG
Sbjct: 1852 DCRVDGGWTPWAPWSDCTTSCGTGKQIRTRACINPPPRNNGTACQGPSLENQECATAPCPDDGVVDVNKWRLGTMESNNSNSRECG 1937          

HSP 4 Score: 63.5438 bits (153), Expect = 3.090e-10
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 1
Query: 1822 EIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCD 2025
            E++   +  CKVDG W+ +S W+ C   CG G  +R R C NP  +NGG+ C G+  +  +C  + CD
Sbjct: 1589 EVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCD 1656          

HSP 5 Score: 63.1586 bits (152), Expect = 3.689e-10
Identity = 26/58 (44.83%), Postives = 34/58 (58.62%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC 2022
            C V+G W  +SSWS C   CG G RVR R C  P P+NGG+ C G+  + + C  + C
Sbjct:  149 CPVEGQWGAWSSWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPC 206          

HSP 6 Score: 60.4622 bits (145), Expect = 2.614e-9
Identity = 37/104 (35.58%), Postives = 53/104 (50.96%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKC--DELNFE---NTRGRYSQWTTWSACSKTCGFS-----TKSRSRQC 2130
            C V   W+ +S W+ C   C  G++ R R   NP    GG  C G++TE + C    C  DE   E     RG + QW+ WS C++TC +S     T++R R+C
Sbjct:  309 CPVHCGWSAWSPWTPCDRPCRTGSQERYRSPTNPAASGGGAPCVGDSTELRDCNAGPCPGDEAPEEGGDGDRGGWGQWSAWSRCTRTCFYSPERVGTRARHRRC 412          

HSP 7 Score: 58.5362 bits (140), Expect = 1.070e-8
Identity = 31/84 (36.90%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNG-TRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTC 2097
            C  DG W+ +S W++CS +CG G  R R+R CD P P  GG  C G   + Q C  + C + N     G Y     +S C   C
Sbjct:  834 CTQDGAWSGWSRWAECSRSCGGGGLRSRARACDAPAPGGGGDYCEGPGVDTQECHAEPCPDRNCSEVAGSY-----YSHCGPPC 912          

HSP 8 Score: 57.7658 bits (138), Expect = 1.867e-8
Identity = 29/91 (31.87%), Postives = 44/91 (48.35%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRS 2121
            C VD  W+ +++WS C+ TC  GTR R R   +P    GG+ C+G   E   C    C        +  + +W  WS CS +CG   ++ +
Sbjct:  576 CSVDCGWSEWTAWSLCTKTCDVGTRRRFRSATHPPAAFGGRGCSGLPVEVAYCGLLPC--------KAVWGEWEAWSGCSASCGGGVRAHT 658          

HSP 9 Score: 56.9954 bits (136), Expect = 3.072e-8
Identity = 38/102 (37.25%), Postives = 52/102 (50.98%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQ---ICVN---KKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS 2136
            C VDG W  +S W+ CS TCG+ T  R R C  P P++GG  C G    ++   + V    K C+   F  T G +  W++WSAC    G     R+R+C S
Sbjct:  991 CPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNLFPFCPTDGGWGFWSSWSACDACAG-GAAVRTRECNS 1091          

HSP 10 Score: 54.299 bits (129), Expect = 1.901e-7
Identity = 35/125 (28.00%), Postives = 51/125 (40.80%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGG--KECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS-------EKCTESLNEIKSCNLPLCE 2193
            +C VD  W  +++WS CS  CG G + R R   NP   NG    +    N E + C    C         G +S W+ W+ C + CG     R R C +       + C     ++  CN   C+
Sbjct: 1539 DCSVDCSWNAWTAWSTCSRPCGVGQQQRMR-TYNPPLGNGSWCPDIIAGNWEVRFCNTDVC------KVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCD 1656          
BLAST of semaphorin 5-3 vs. Ensembl Nematostella
Match: EDO47624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLL1])

HSP 1 Score: 107.071 bits (266), Expect = 2.347e-25
Identity = 66/153 (43.14%), Postives = 84/153 (54.90%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECT--GNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-------SEKCTE--SLNEIKSCNLPLCEFKI-YSQWSSWSKFNVT--TFTKIRLR 2265
            C V+G +T +S+WS C  TCG G++ R+R C NP P+NGGK+CT  G   E ++C    C         G YS W+ W+ CS TCG  TKSRSR C           CT     N+   C+LP C     YS WS+W+K +VT    TKIRLR
Sbjct:   55 CSVNGGYTAWSNWSACPVTCGAGSQARTRNCSNPVPKNGGKDCTSLGPTMELKLCNRPLCP------VHGGYSLWSNWTKCSVTCGNGTKSRSRNCTNPGPLHGGNNCTNLGPNNQTIKCDLPACPVNGDYSPWSNWTKCSVTCRNGTKIRLR 201          

HSP 2 Score: 92.4337 bits (228), Expect = 1.964e-20
Identity = 60/160 (37.50%), Postives = 80/160 (50.00%), Query Frame = 1
Query: 1822 EIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKS---------CNLPLCEF-KIYSQWSSWSKFNVTTFTKIRLRFK 2271
            E+KL   P C V G ++++S+W+ CS TCGNGT+ RSR C NP P +GG  CT      Q     KCD L      G YS W+ W+ CS TC   TK R R C + +     N   +         C+L  C     YS WS+W+K +VT     + R +
Sbjct:  105 ELKLCNRPLCPVHGGYSLWSNWTKCSVTCGNGTKSRSRNCTNPGPLHGGNNCTNLGPNNQT---IKCD-LPACPVNGDYSPWSNWTKCSVTCRNGTKIRLRNCTNPEPLHGGNNCTNLGPNSQTIKCDLQACPINGGYSNWSNWTKCSVTCGNGTKTRSR 260          

HSP 3 Score: 82.0333 bits (201), Expect = 6.081e-17
Identity = 66/180 (36.67%), Postives = 88/180 (48.89%), Query Frame = 1
Query: 1855 VDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC-------ISEKCTE--SLNEIKSCNLPLCE-FKIYSQWSSWSKFNVTTFTKIRLRFK-CIKTYQYESF----NLSLNDITRYIVYPSC 2349
            VDG +T +SSWS+CS+ CG GT  R+R C NP P  GG  C+GN  E   C        N  +  G Y+ W+ WSAC  TCG  +++R+R C         + CT      E+K CN PLC     YS WS+W+K +VT     + R + C             NL  N+ T     P+C
Sbjct:    1 VDGGFTSWSSWSNCSSKCGIGTHNRTRNCTNPAPAFGGSNCSGNTMETGPCD-------NLCSVNGGYTAWSNWSACPVTCGAGSQARTRNCSNPVPKNGGKDCTSLGPTMELKLCNRPLCPVHGGYSLWSNWTKCSVTCGNGTKSRSRNCTNPGPLHGGNNCTNLGPNNQTIKCDLPAC 173          

HSP 4 Score: 55.4546 bits (132), Expect = 4.532e-8
Identity = 23/45 (51.11%), Postives = 33/45 (73.33%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECT 1980
             C ++G ++ +S+W+ CS TCGNGT+ RSR C NP+P +GG  CT
Sbjct:  231 ACPINGGYSNWSNWTKCSVTCGNGTKTRSRNCTNPEPLHGGNNCT 275          
BLAST of semaphorin 5-3 vs. Ensembl Nematostella
Match: EDO47623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLL0])

HSP 1 Score: 103.99 bits (258), Expect = 7.878e-24
Identity = 108/343 (31.49%), Postives = 151/343 (44.02%), Query Frame = 1
Query: 1855 VDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECT--GNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKS---------CNLPLCEF-KIYSQWSSWSKFNVTTFTKIRLRFK-CIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCIT--PICFGES------------IDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKC-----IYDSKRTSCRGNETEISDCPLKQC--SAAYSKWTEWSNCE---ENSFKTRKRQC 2772
            V+G +T +S+WS C  TCG G++ R+R C NP P+NGGK+CT  G   E ++C    C         G YS W+ W+ CS TCG  TKSRSR C + +     N   +         CNL  C     YS WS+W+K +VT     + R + C         N   N      + P   T  C  +     ING +S WS W+ CS +C     T R+RNC    P+  G +             D + CPI    S W+ W+  S         G + R+R C     ++     +  G  ++   C L+ C  +  YS W+ W+ C     N  KTR R C
Sbjct:    1 VNGGYTAWSNWSACPVTCGAGSQARTRNCSNPVPKNGGKDCTSLGPTIELKLCNRPLCP------VHGGYSLWSNWTKCSVTCGNGTKSRSRNCTNPEPLHGGNNCTNLGPKSQTIKCNLQACPINGGYSTWSNWTKCSVTCGNGTKTRSRNCTNPEPLHGGNNCTN------LGPHSQTIKCDLQ--ACPINGGYSPWSNWTKCSVTCGNGTKT-RSRNCTKPEPLHGGNNCTNLGPNSQTIKCDLQACPINGGYSPWSNWTQCSVTCG----NGTKTRSRNCTNPEPLHGGNNCTNLGPNSQTIKCDLQACPINGGYSPWSNWTKCSVTCGNGTKTRSRNC 324          

HSP 2 Score: 91.2781 bits (225), Expect = 1.205e-19
Identity = 56/152 (36.84%), Postives = 78/152 (51.32%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKS---------CNLPLCEF-KIYSQWSSWSKFNVTTFTKIRLRFK 2271
             C ++G ++ +S+W+ CS TCGNGT+ RSR C  P+P +GG  CT      Q     KCD L      G YS W+ W+ CS TCG  TK+RSR C + +     N   +         C+L  C     YS WS+W+K +VT     + R +
Sbjct:  175 ACPINGGYSPWSNWTKCSVTCGNGTKTRSRNCTKPEPLHGGNNCTNLGPNSQT---IKCD-LQACPINGGYSPWSNWTQCSVTCGNGTKTRSRNCTNPEPLHGGNNCTNLGPNSQTIKCDLQACPINGGYSPWSNWTKCSVTCGNGTKTRSR 322          

HSP 3 Score: 82.4185 bits (202), Expect = 1.274e-16
Identity = 44/99 (44.44%), Postives = 59/99 (59.60%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEK 2142
             C ++G ++ +S+W+ CS TCGNGT+ RSR C NP+P +GG  CT      Q     KCD L      G YS W+ W+ CS TCG  TK+RSR C + +
Sbjct:  234 ACPINGGYSPWSNWTQCSVTCGNGTKTRSRNCTNPEPLHGGNNCTNLGPNSQT---IKCD-LQACPINGGYSPWSNWTKCSVTCGNGTKTRSRNCTNPE 328          

HSP 4 Score: 56.225 bits (134), Expect = 4.065e-8
Identity = 23/45 (51.11%), Postives = 33/45 (73.33%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECT 1980
             C ++G ++ +S+W+ CS TCGNGT+ RSR C NP+P +GG  CT
Sbjct:  293 ACPINGGYSPWSNWTKCSVTCGNGTKTRSRNCTNPEPLHGGNNCT 337          
BLAST of semaphorin 5-3 vs. Ensembl Nematostella
Match: EDO47625 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLL2])

HSP 1 Score: 103.99 bits (258), Expect = 9.096e-24
Identity = 107/346 (30.92%), Postives = 157/346 (45.38%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECT--GNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKS---------CNLPLCEFK-IYSQWSSWSKFNVTTFTKIRLRFK-CIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCIT--PICFGES------------IDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKC-----IYDSKRTSCRGNETEISDCPLKQC--SAAYSKWTEWSNCE---ENSFKTRKRQC 2772
             C ++G ++ +S+W+ CS TCGNGT+ RSR C NP+P +GG  CT  G N++  +C  + C         G YS W+ W+ CS TCG  TK+RSR C + +     N   +         C+L  C     YS WS+W+K +VT     + R + C         N   N      + P+  T  C  +     ING +S WS W+ CS +C     T R+RNC    P+  G +             D + CPI    SSW+ W+  S         G + R+R C     ++     +  G  ++   C L+ C  + +YS W+ W+ C     N  KTR R C
Sbjct:    6 ACPINGGYSPWSNWTKCSVTCGNGTKTRSRNCTNPEPLHGGNNCTNLGPNSQTIMCDLQACP------INGGYSPWSNWTKCSVTCGNGTKTRSRNCTNPEPLHGGNNCTNLGPNSQTIMCDLQACPINGGYSPWSNWTKCSVTCGNGTKTRSRNCTNPEPLHGGNNCTN------LGPNSQTIKCDLQ--ACPINGGYSTWSNWTKCSVTCGNGTKT-RSRNCTNPEPLHGGNNCTNLGPNSQTIMCDLQACPINGGYSSWSNWTKCSVTCG----NGTKTRSRNCTNPEPLHGGNNCTNLGPNSQTIKCDLQACPINGSYSSWSNWTQCSVTCGNGTKTRSRNC 332          

HSP 2 Score: 95.9005 bits (237), Expect = 4.461e-21
Identity = 62/185 (33.51%), Postives = 91/185 (49.19%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECT--GNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKS---------CNLPLCEFK-IYSQWSSWSKFNVTTFTKIRLRFK-CIKTYQYESF----NLSLNDITRYIVYPSC 2349
             C ++G ++ +S+W+ CS TCGNGT+ RSR C NP+P +GG  CT  G N++  +C  + C         G YS W+ W+ CS TCG  TK+RSR C + +     N   +         C+L  C     YS WS+W++ +VT     + R + C             NL  N+ T     P+C
Sbjct:  183 ACPINGGYSTWSNWTKCSVTCGNGTKTRSRNCTNPEPLHGGNNCTNLGPNSQTIMCDLQACP------INGGYSSWSNWTKCSVTCGNGTKTRSRNCTNPEPLHGGNNCTNLGPNSQTIKCDLQACPINGSYSSWSNWTQCSVTCGNGTKTRSRNCTNPEPLHGGNNCTNLGPNNQTIKCDLPAC 361          

HSP 3 Score: 83.9593 bits (206), Expect = 3.504e-17
Identity = 51/125 (40.80%), Postives = 68/125 (54.40%), Query Frame = 1
Query: 1846 ECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEK-------CTE--SLNEIKSCNLPLCE 2193
             C ++G ++ +S+W+ CS TCGNGT+ RSR C NP+P +GG  CT      Q     KCD L      G YS W+ W+ CS TCG  TK+RSR C + +       CT     N+   C+LP C 
Sbjct:  242 ACPINGGYSSWSNWTKCSVTCGNGTKTRSRNCTNPEPLHGGNNCTNLGPNSQT---IKCD-LQACPINGSYSSWSNWTQCSVTCGNGTKTRSRNCTNPEPLHGGNNCTNLGPNNQTIKCDLPACP 362          
BLAST of semaphorin 5-3 vs. Ensembl Nematostella
Match: EDO48914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHU3])

HSP 1 Score: 107.842 bits (268), Expect = 9.531e-24
Identity = 164/733 (22.37%), Postives = 284/733 (38.74%), Query Frame = 1
Query:  268 DYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSK-ILWICFNYML---------YSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLY---MKSYKELMI---FKNPLVFTHDNLSNVNKINLPRSVIK--APGDIITSFQHNKSVYFLYTET---DFLCGCKENVLVTRLIRLCENDKG----LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKT---SYKFNEY-------KNICQLFTTGNQDSNFLIN--LQTLCKTYPLHRDI----VTSQAILYETRTKFFEIASEESSWSN----NRRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLS------ENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQC---SAPFCYWDNITKKCKY--VSTKNQF--------LLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVN--DLS-----QIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTR------GRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPL-CEFKIYSQWSSWSK 2229
            D  NF +L  + +++   VV   N I+++ L N  F S   LK + + E         V+F   S+     C+NY+L         ++         C  +K  +L+        G  F   D++   +   +  Y   G+     + Y   M+    + P++F+ D       +   R   K  +  + +TSF     VYF + E    +  CG       +R+ R+C+ D G    +    F  FNK  + C          P  Y +  +    S        FT+       SAIC Y++  I   FN + K   +KT   S + NE+       KN   +  +       +    + T   T P   D     + ++A+   T+   + I     S       N  +V +V T++  V  L         C++ +  LS      E +T L+     + +Y  V T  ++VK+ L  C        C     P+C W      C     S+K  +        +  +   ++ A  +    +   N   QCR +   +  D S     Q  + +C +++++  +E   T   E  + G WT +++WS CS T G+G RVR+R C NP P+NGG++C GN+ E   C V    +E   + T       G+           K  G+S ++ + +    +  + +   + CNLP      +++ WS W+K
Sbjct:   47 DVKNFSNL-LLDSANQQLVVGARNLIIQIDLGN--FSSFKVLKWEPSKEN--------VRFCTQSRRPKEECYNYILVLQPYQGRLFTCGTNAYTPTCKWIKLSDLSPASGTDSNGNVF-REDMDGVGLVPYSPRYKSTGIMSDQGRYYAGTMMDGSAREPIIFSLDFKRRYRMLRTLRGDDKWLSDAEFVTSFDVGLYVYFFFREAAVENMKCG---KTRYSRVARICKGDYGGSEYVMKNTFVTFNKARLNCSTTGEY----PAYYDLIQDVFLDSNRGVFYAVFTTQPNGVAGSAICAYSLDEINRVFNGDYKYGDDKTGEWSVQTNEHHFANCTVKNTSHVPISPEWKRKLVPEGMMSTPLFTKPAFDDSKRYQLMAEAVQPATQAAHYIIHGTRFSSVAVHVINNALVTYVGTESGSVLKLFTPEGHESACVIEEIRLSTQKGSSEPVTSLRLDVAMNAVY--VATQSKLVKLRLARCSQHTDRRSCMDAHDPYCGWKKEASACTPWDSSSKGSWEQELNRCPVAKAKWSSWSAWGVCTQPD---NNVCQCRTRVCRHACDPSECRGEQAQLKECTVDKSSWADEA--TWLREGVIHGGWTNWAAWSQCSVTQGSGFRVRTRACVNPPPRNGGRKCLGNSEEVDSCSVTVPLEEKRLDLTSELLGVVGKDDMAMRHRYTCKVKGYSLQNMTLELTKTESIDCMYNAEICNLPTEAPVGVWALWSVWTK 753          
BLAST of semaphorin 5-3 vs. Ensembl Nematostella
Match: EDO40760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S664])

HSP 1 Score: 107.071 bits (266), Expect = 2.071e-23
Identity = 54/134 (40.30%), Postives = 77/134 (57.46%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEK-------CTESLNEIKSCNLPLCEF-KIYSQWSSWS 2226
            C+V+G W+ YSSWS C+ TCG GT+ R+R C NPKP +GGKEC G+  E + C    C         G +S +++WS+C+KTCG  T++R+R C + K       C     E + C+   C     +S +SSWS
Sbjct:  169 CEVNGGWSDYSSWSSCTKTCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAAC------AVNGGWSDYSSWSSCTKTCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAACAVNGGWSDYSSWS 296          

HSP 2 Score: 100.523 bits (249), Expect = 1.824e-21
Identity = 53/136 (38.97%), Postives = 70/136 (51.47%), Query Frame = 1
Query: 1813 DLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCIS-------EKCTESLNEIKSCNLPLCEFK 2199
            D  E +      C V+G W+ YSSWS C+ TCG GT+ R+R C NPKP +GGKEC G+  E + C    C         G +S ++ W+ CSKTCG   + R+R C S       +KC     E + CN   C  K
Sbjct:  271 DAKETRHCSEAACAVNGGWSDYSSWSSCTKTCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAAC------AVNGGWSDFSKWTKCSKTCGGGKQERTRTCTSPAPSHNGKKCAGDAREERECNTDKCPPK 400          
BLAST of semaphorin 5-3 vs. Ensembl Medaka
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:101171867])

HSP 1 Score: 182.57 bits (462), Expect = 2.180e-46
Identity = 232/977 (23.75%), Postives = 381/977 (39.00%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNL-----------NFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDIVTSQAILY--ETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLL-------------EISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTD------LNEIKLTISPE---CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCN-LPLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPS------CSTADCQFKNNK---QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCE-TRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC--LY--NNNCLFPLIQNKPC--------------LRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCY 2928
            ++  L++ P  + + +V   N + RL L +L            F       +  + E+C+  I          ++L +  N +    TN     +C      NL   H  Q +G     +   +  +H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C   V  +R+ R+C+ND G   L  + ++ F K  + C +        PF Y       +L   + L   FT+N     +SA+C + + +I   FN   K   E +   +  Y N    F  G  +S   +NL     Q   K   +H  +     + Y  E   +F  +A +     +    +++++T    +  +L             EI L P     RK     ++ +L + +E     L+VG   +++KIPL  C    T   C     P+C WD + KKC  +    +      S T C   +   +      + W  C      ND    G C C   R  D        +    IS E   C  +G WT ++SWS CS +CG G +VR R C NP P++GG+ C G N E + C  +  C    +      +S W+ W  C+  CG   +SR R C     C     E +SCN LP  + K  + W+ W+  N++      + R R+ C       S  L +      + Y S      CST     +  +     +NG +S WS WS CS  C     +R+ R C  P        C G + +Y+ C I  C    +     S         RG  MR R C           C G  TE + C  + C  ++S+W+EWS+C+ +  + R R C  L+   N C     + +PC                Q + +  +F+  +MI  GL   + G L+ ++L Y
Sbjct:   65 DYSQLTFDPGQNEL-IVGARNHLFRLNLEDLTLIQEAEWHCDEFTKGACFSRGKSEEECQNYI----------RVLLVNGNRLFTCGTNAFT-PICTNRTLTNLTEIH-DQISGM----ARCPYNPLHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEP-NFVSSYDIANFTYFFFRENAVEHDCGRTVF-SRVGRVCKNDIGGRFLLEDTWTTFMKARMNCSRPGEI----PFNYNELQGTFYLPELELLYGIFTTNVNSIAASAVCAFNLSAISQVFNGPFKYQ-ENSRSAWLPYPNPNPDFKCGTINSGTYVNLTQRNLQDAQKFLLMHDVVQPVVPVPYFMEDNVRFTHVAVDVVQGKDMLLHIIYLATDYGTIRKVLSPLNQSTGSCLLEEIELFPP----RKRQPIRSLLILHSRSE-----LYVGVRDQVIKIPLKRCSYHKTREACVGARDPYCGWDLLLKKCTTLEESVRMSQWEQSITKCPVRNVTVDGGFGAWSGWSTCSH----NDGGSAGSCLCRT-RACDNPAPQCGGQTCFGISAEVANCSRNGAWTPWTSWSPCSTSCGIGFQVRQRSCSNPSPRHGGRVCVGQNREERYCNEHLPCPPHVY------WSAWSAWDRCNVPCGGGIQSRRRTCENGNDCPGCGQEYQSCNTLPCPDVKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARIPDPSM-LEVGRQRIEMRYCSSDGSTGCSTDGEVLRLGRISGHTVNGGWSAWSSWSQCSRDCSRGIRSRK-RTCTNPEPRYGGQTCLGPAQEYQECNITPCPVDGSWSCWSSWSKCSVTCGRGHYMRTRTCSNPPPANGGDICLGLHTEEALCNTQACPESWSRWSEWSHCDSSGAQLRVRHCDVLFPTGNQCSGNSSETRPCSPDSNFIPEVSIARSSQEERRCGDFNLFHMIAVGLSSSILGCLV-TLLVY 994          
BLAST of semaphorin 5-3 vs. Ensembl Medaka
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:101171867])

HSP 1 Score: 182.185 bits (461), Expect = 2.477e-46
Identity = 233/977 (23.85%), Postives = 381/977 (39.00%), Query Frame = 1
Query:  277 NFKHLSYIPNSDHIYVVSNENEIVRLKLNNL-----------NFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVF-THDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDIVTSQAILY--ETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLL-------------EISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTD------LNEIKLTISPE---CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCN-LPLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPS------CSTADCQFKNNK---QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCE-TRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC--LY--NNNCLFPLIQNKPC--------------LRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCY 2928
            ++  L++ P  + + +V   N + RL L +L            F       +  + E+C+  I          ++L +  N +    TN     +C      NL   H  Q +G     +   +  +H++T+  T +G    +       ++P ++ +   L  +         +  P + ++S+      YF + E      C   V  +R+ R+C+ND G   L  + ++ F K  + C    S     PF Y       +L   + L   FT+N     +SA+C + + +I   FN   K   E +   +  Y N    F  G  +S   +NL     Q   K   +H  +     + Y  E   +F  +A +     +    +++++T    +  +L             EI L P     RK     ++ +L + +E     L+VG   +++KIPL  C    T   C     P+C WD + KKC  +    +      S T C   +   +      + W  C      ND    G C C   R  D        +    IS E   C  +G WT ++SWS CS +CG G +VR R C NP P++GG+ C G N E + C  +  C    +      +S W+ W  C+  CG   +SR R C     C     E +SCN LP  + K  + W+ W+  N++      + R R+ C       S  L +      + Y S      CST     +  +     +NG +S WS WS CS  C     +R+ R C  P        C G + +Y+ C I  C    +     S         RG  MR R C           C G  TE + C  + C  ++S+W+EWS+C+ +  + R R C  L+   N C     + +PC                Q + +  +F+  +MI  GL   + G L+ ++L Y
Sbjct:   65 DYSQLTFDPGQNEL-IVGARNHLFRLNLEDLTLIQEAEWHCDEFTKGACFSRGKSEEECQNYI----------RVLLVNGNRLFTCGTNAFTP-ICTNRTLTNLTEIH-DQISGM----ARCPYNPLHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEP-NFVSSYDIANFTYFFFRENAVEHDCGRTVF-SRVGRVCKNDIGGRFLLEDTWTTFMKARMNC----SRPGEIPFNYNELQGTFYLPELELLYGIFTTNVNSIAASAVCAFNLSAISQVFNGPFKYQ-ENSRSAWLPYPNPNPDFKCGTINSGTYVNLTQRNLQDAQKFLLMHDVVQPVVPVPYFMEDNVRFTHVAVDVVQGKDMLLHIIYLATDYGTIRKVLSPLNQSTGSCLLEEIELFPP----RKRQPIRSLLILHSRSE-----LYVGVRDQVIKIPLKRCSYHKTREACVGARDPYCGWDLLLKKCTTLEESVRMSQWEQSITKCPVRNVTVDGGFGAWSGWSTCSH----NDGGSAGSCLCRT-RACDNPAPQCGGQTCFGISAEVANCSRNGAWTPWTSWSPCSTSCGIGFQVRQRSCSNPSPRHGGRVCVGQNREERYCNEHLPCPPHVY------WSAWSAWDRCNVPCGGGIQSRRRTCENGNDCPGCGQEYQSCNTLPCPDVKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARIPDPSM-LEVGRQRIEMRYCSSDGSTGCSTDGEVLRLGRISGHTVNGGWSAWSSWSQCSRDCSRGIRSRK-RTCTNPEPRYGGQTCLGPAQEYQECNITPCPVDGSWSCWSSWSKCSVTCGRGHYMRTRTCSNPPPANGGDICLGLHTEEALCNTQACPESWSRWSEWSHCDSSGAQLRVRHCDVLFPTGNQCSGNSSETRPCSPDSNFIPEVSIARSSQEERRCGDFNLFHMIAVGLSSSILGCLV-TLLVY 994          
BLAST of semaphorin 5-3 vs. Ensembl Medaka
Match: sema5ba (semaphorin 5B [Source:NCBI gene;Acc:101159709])

HSP 1 Score: 177.563 bits (449), Expect = 7.033e-45
Identity = 195/776 (25.13%), Postives = 325/776 (41.88%), Query Frame = 1
Query:  781 IITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTG---NQDSNFLI---NLQTLCKTYPLHRDIVTSQAI---LYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEI---SLQPKICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQC---SAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCN-------IERNTDLNEIKLTIS-PECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLN------DITRYIVYPSCSTADCQFKNNK----QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR-MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIW 2934
             I++++     +F   E      C + V  +R+ R+C+ND G   L  + ++ F K  + C    S     PF Y    +  +L     +   FT+N     +SA+C + + +I  AFN   + S E     +    N  + F  G   +   N  +   +LQ   + Y L  D+V  +++   + +   +F  +  +     +    V+++ST+   +   L     +LQ   C L +  L      E I  L+ ++ +D+  LFVG S R++KIPL+ C    T++ C     P+C WD   ++C  +   +       + T C     +  N     W Q +  +  + +  +  C C        + R    N +  TI    C  +G WT +SSW  CS TCG G  +R R C+NP P++GG+ C G + + + C     C +  F      ++ W++W+ CS  CG    SR R C     C     E K+CNL  C E K  + W+ W  FNVT      + R R+ C + +  +   L +        I ++    +C T     +  K    ++    +S W  WSSCS SC     TRR R C  P        C G  ++Y+ C +  C  +                 G    R R C   +  +    C G  TE + C    C   +  W++WS C+++  + R R C   ++   P + N    R   + PA F+ I +I +G+  F+   L+ S L Y++
Sbjct:  197 FISAYEIGLFTFFFLRENAVEHDCGKTVY-SRVARVCKNDIGGRFLLEDTWTTFMKARLNC----SRSGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAFNLSAITQAFNGPFR-SQENPRSTWLPTPNPIRDFQCGTISDHGPNEGLTERSLQDAQRLY-LMNDVVQPESVDPLVMQDDVRFSNLVVDIVQGMDTLYHVMYISTEYGTILKALATPNKNLQ--GCYLEEMELLPPGVQEPILSLQILH-SDR-SLFVGLSDRVMKIPLERCGTYKTESMCLEARDPYCGWDFRKRRCTTLEDSSNMSQWKQNITICPVRQNQTTNGGFGPWAQWQPCNNDDPVDGVSSCLCRSRSCDSPLPRCGGKNCVGTTIEVSNCSRNGGWTPWSSWGQCSTTCGTGFELRQRSCNNPSPRHGGRVCVGPSRDERFCNEGVPCPQPIF------WTPWSSWTKCSTACGGGVHSRVRTCENGNSCPGCALEYKACNLEACPEVKRNTPWTPWMPFNVTQSGARHEQRTRYMC-RAHLSDPHELQIGRRKTETRICKHDGTAACETDSLVEELLKIPVVRVAGLGWSSWETWSSCSQSCSKGYRTRR-RTCTGPEGKSAPVACRGSPVEYQDCNVQACPVNGAWSCWSPWSQCSVGCGGGHYQRTRSCNSPTPASGGDICIGLHTEEALCNTHTCDGGWMTWSQWSACDDSGLQMRSRVCGSQSS--IPCVGNSTQRRDCNEIPA-FTSIQLITTGVSCFLGAGLL-SFLIYVY 949          
BLAST of semaphorin 5-3 vs. Ensembl Medaka
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:101171867])

HSP 1 Score: 176.022 bits (445), Expect = 2.065e-44
Identity = 205/802 (25.56%), Postives = 319/802 (39.78%), Query Frame = 1
Query:  778 DIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINL-----QTLCKTYPLHRDIVTSQAILY--ETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLL-------------EISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSA---PFCYWDNITKKCKYVSTKNQFLLISNSKTYCA--SSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTD------LNEIKLTISPE---CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCN-LPLCEFKIYSQWSSWSKFNVT---TFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPS------CST----ADCQFKNNK---QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCE-TRGMRMRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC--LY--NNNCLFPLIQNKPC--------------LRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCY 2928
            + ++S+      YF + E      C   V  +R+ R+C+ND G   L  + ++ F K  + C    S     PF Y       +L   + L   FT+N     +SA+C + + +I   FN   K   E +   +  Y N    F  G  +S   +NL     Q   K   +H  +     + Y  E   +F  +A +     +    +++++T    +  +L             EI L P     RK     ++ +L + +E     L+VG   +++KIPL  C    T   C     P+C WD + KKC  +    +      S T C   +   +      + W  C      ND    G C C   R  D        +    IS E   C  +G WT ++SWS CS +CG G +VR R C NP P++GG+ C G N E + C  +  C    +      +S W+ W  C+  CG   +SR R C     C     E +SCN LP  + K  + W+ W+  N++      + R R+ C       S  L +      + Y S      CST     D   +  +     +NG +S WS WS CS  C     +R+ R C  P        C G + +Y+ C I  C    +     S         RG  MR R C           C G  TE + C  + C  ++S+W+EWS+C+ +  + R R C  L+   N C     + +PC                Q + +  +F+  +MI  GL   + G L+ ++L Y
Sbjct:  168 NFVSSYDIANFTYFFFRENAVEHDCGRTVF-SRVGRVCKNDIGGRFLLEDTWTTFMKARMNC----SRPGEIPFNYNELQGTFYLPELELLYGIFTTNVNSIAASAVCAFNLSAISQVFNGPFKYQ-ENSRSAWLPYPNPNPDFKCGTINSGTYVNLTQRNLQDAQKFLLMHDVVQPVVPVPYFMEDNVRFTHVAVDVVQGKDMLLHIIYLATDYGTIRKVLSPLNQSTGSCLLEEIELFPP----RKRQPIRSLLILHSRSE-----LYVGVRDQVIKIPLKRCSYHKTREACVGARDPYCGWDLLLKKCTTLEESVRMSQWEQSITKCPVRNVTVDGGFGAWSGWSTCSH----NDGGSAGSCLCRT-RACDNPAPQCGGQTCFGISAEVANCSRNGAWTPWTSWSPCSTSCGIGFQVRQRSCSNPSPRHGGRVCVGQNREERYCNEHLPCPPHVY------WSAWSAWDRCNVPCGGGIQSRRRTCENGNDCPGCGQEYQSCNTLPCPDVKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARIPDPSM-LEVGRQRIEMRYCSSDGSTGCSTDGECTDVMLRLGRISGHTVNGGWSAWSSWSQCSRDCSRGIRSRK-RTCTNPEPRYGGQTCLGPAQEYQECNITPCPVDGSWSCWSSWSKCSVTCGRGHYMRTRTCSNPPPANGGDICLGLHTEEALCNTQACPESWSRWSEWSHCDSSGAQLRVRHCDVLFPTGNQCSGNSSETRPCSPDSNFIPEVSIARSSQEERRCGDFNLFHMIAVGLSSSILGCLV-TLLVY 940          
BLAST of semaphorin 5-3 vs. Ensembl Medaka
Match: sema5ba (semaphorin 5B [Source:NCBI gene;Acc:101159709])

HSP 1 Score: 162.155 bits (409), Expect = 4.366e-40
Identity = 209/883 (23.67%), Postives = 357/883 (40.43%), Query Frame = 1
Query:  322 VVSNENEIVRLKLNNLNF-DSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSAT-SDYTYAGLYMK-SYKELMIFKN-----PLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKG---LTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTG---NQDSNFLI---NLQTLCKTYPLHRDIVTSQAI---LYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEIS---LQPKICILRKFLL-----SENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQC---SAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCN-------IERNTDLNEIKLTIS-PECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCI-SEKCTESLNEIKSCNLPLC-EFKIYSQWSSWSKFNVTTFT---KIRLRFKCIKTYQYESFNLSLN------DITRYIVYPSCSTADCQFKNNK----QIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITP-------ICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMR-MRNRKCIYDSKRTS---CRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQC 2772
            +V   N + RL LNN++   +      + T   C+      ++     ++L +    ++   TN  +  +C   +  N+ S  + +  G      D  H +    T S   YA   +  S ++ +I+++     PL     N   +N+ +            I++++     +F   E      C + V  +R+ R+C+ND G   L  + ++ F K  + C    S     PF Y    +  +L     +   FT+N     +SA+C + + +I  AFN   + S E     +    N  + F  G   +   N  +   +LQ   + Y L  D+V  +++   + +   +F  +  +     +    V+++ST+   +   L      LQ   C L +  L      E I  L+ ++ +D+  LFVG S R++KIPL+ C    T++ C     P+C WD   ++C  +   +       + T C     +  N     W Q +  +  + +  +  C C        + R    N +  TI    C  +G WT +SSW  CS TCG G  +R R C+NP P++GG+ C G + + + C     C +  F      ++ W++W+ CS  CG    SR R C     C     E K+CNL  C E K  + W+ W  FNVT      + R R+ C + +  +   L +        I ++    +C T     +  K    ++    +S W  WSSCS SC     TRR R C  P        C G  ++Y+ C +  C  +                 G    R R C   +  +    C G  TE + C    C   +  W++WS C+++  + R R C
Sbjct:   90 IVGARNYLFRLDLNNMSLAQATEWAPDEETRRSCQSKGKTEIECQNYIRVLLLNKTEVMTCGTNAFQP-LCITREVGNM-SRVLERVNGVARCPYDPRHNSTSVVTESGELYAATVIDFSGRDPVIYRSLGGMPPLRTAQYNSKWLNEPHF-----------ISAYEIGLFTFFFLRENAVEHDCGKTVY-SRVARVCKNDIGGRFLLEDTWTTFMKARLNC----SRSGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAFNLSAITQAFNGPFR-SQENPRSTWLPTPNPIRDFQCGTISDHGPNEGLTERSLQDAQRLY-LMNDVVQPESVDPLVMQDDVRFSNLVVDIVQGMDTLYHVMYISTEYGTILKALATPNKNLQ--GCYLEEMELLPPGVQEPILSLQILH-SDR-SLFVGLSDRVMKIPLERCGTYKTESMCLEARDPYCGWDFRKRRCTTLEDSSNMSQWKQNITICPLR-NQTTNGGFGPWAQWQPCNNDDPVDGVSSCLCRSRSCDSPLPRCGGKNCVGTTIEVSNCSRNGGWTPWSSWGQCSTTCGTGFELRQRSCNNPSPRHGGRVCVGPSRDERFCNEGVPCPQPIF------WTPWSSWTKCSTACGGGVHSRVRTCENGNSCPGCALEYKACNLEACPEVKRNTPWTPWMPFNVTQSGARHEQRTRYMC-RAHLSDPHELQIGRRKTETRICKHDGTAACETDSLVEELLKIPVVRVAGLGWSSWETWSSCSQSCSKGYRTRR-RTCTGPEGKSAPVACRGSPVEYQDCNVQACPVNGAWSCWSPWSQCSVGCGGGHYQRTRSCNSPTPASGGDICIGLHTEEALCNTHTCDGGWMTWSQWSACDDSGLQMRSRVC 939          

HSP 2 Score: 75.0998 bits (183), Expect = 3.314e-13
Identity = 45/140 (32.14%), Postives = 66/140 (47.14%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISE---KCTESLNEIKSCN-----LPLCEFKIYSQWSSWSKFNVTT 2244
            C V+G W+ +S WS CS  CG G   R+R C++P P +GG  C G +TE  +C    CD        G +  W+ WSAC  +     + RSR C S+    C  +  + + CN     LP   F    Q  +++   + T
Sbjct:  857 CPVNGAWSCWSPWSQCSVGCGGGHYQRTRSCNSPTPASGGDICIGLHTEEALCNTHTCD--------GGWMTWSQWSACDDS---GLQMRSRVCGSQSSIPCVGNSTQRRDCNEIPVILPASGFDKDQQCGAFTSIQLIT 985          
BLAST of semaphorin 5-3 vs. Planmine SMEST
Match: SMESG000033853.1 (SMESG000033853.1)

HSP 1 Score: 2040 bits (5284), Expect = 0.000e+0
Identity = 1032/1034 (99.81%), Postives = 1032/1034 (99.81%), Query Frame = 1
Query:  121 MIYYAKYLEFVTILNIFIIPVLSLINLHYPVLNMTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITPICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPPPQYYQDPNILFYPISHNVPLMHSHLPEEHIEMS 3222
            MIYYAKYLEFVTILNIFIIPVLSLINLHYPVLNMTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFL NLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNN RVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFSDWSEWSSCSNSCKGSEWTRRTRNCITPICFGESIDYKMCPIYLCKSSWNCWSTWSTCFTPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPPPQYYQDPNILFYPISHNVPLMHSHLPEEHIEMS
Sbjct:    1 MIYYAKYLEFVTILNIFIIPVLSLINLHYPVLNMTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLTNLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNNLRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFSDWSEWSSCSNSCKGSEWTRRTRNCITPICFGESIDYKMCPIYLCKSSWNCWSTWSTCFTPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPPPQYYQDPNILFYPISHNVPLMHSHLPEEHIEMS 1034          
BLAST of semaphorin 5-3 vs. Planmine SMEST
Match: SMESG000033853.1 (SMESG000033853.1)

HSP 1 Score: 1972.59 bits (5109), Expect = 0.000e+0
Identity = 999/1001 (99.80%), Postives = 999/1001 (99.80%), Query Frame = 1
Query:  220 MTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITPICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPPPQYYQDPNILFYPISHNVPLMHSHLPEEHIEMS 3222
            MTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFL NLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNN RVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFSDWSEWSSCSNSCKGSEWTRRTRNCITPICFGESIDYKMCPIYLCKSSWNCWSTWSTCFTPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPPPQYYQDPNILFYPISHNVPLMHSHLPEEHIEMS
Sbjct:    1 MTSFIHFQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLTNLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNNLRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFSDWSEWSSCSNSCKGSEWTRRTRNCITPICFGESIDYKMCPIYLCKSSWNCWSTWSTCFTPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPPPQYYQDPNILFYPISHNVPLMHSHLPEEHIEMS 1001          
BLAST of semaphorin 5-3 vs. Planmine SMEST
Match: SMESG000033853.1 (SMESG000033853.1)

HSP 1 Score: 1941.78 bits (5029), Expect = 0.000e+0
Identity = 985/987 (99.80%), Postives = 985/987 (99.80%), Query Frame = 1
Query:  262 MADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLINLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFXXXXXXXXXXXXXXXXXXTRRTRNCITPICFGESIDYKMCPIYLXXXXXXXXXXXXXXXXPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPPPQYYQDPNILFYPISHNVPLMHSHLPEEHIEMS 3222
            MADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFL NLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNN RVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFSDWSEWSSCSNSCKGSEWTRRTRNCITPICFGESIDYKMCPIYLCKSSWNCWSTWSTCFTPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPPPQYYQDPNILFYPISHNVPLMHSHLPEEHIEMS
Sbjct:    1 MADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLVTRLIRLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKFNEYKNICQLFTTGNQDSNFLTNLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESSWSNNLRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSSWSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQFKNNKQIINGNFSDWSEWSSCSNSCKGSEWTRRTRNCITPICFGESIDYKMCPIYLCKSSWNCWSTWSTCFTPCETRGMRMRNRKCIYDSKRTSCRGNETEISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPCLRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETYVGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSPPPQYYQDPNILFYPISHNVPLMHSHLPEEHIEMS 987          
BLAST of semaphorin 5-3 vs. Planmine SMEST
Match: SMESG000037895.1 (SMESG000037895.1)

HSP 1 Score: 127.102 bits (318), Expect = 2.284e-29
Identity = 168/701 (23.97%), Postives = 291/701 (41.51%), Query Frame = 1
Query:  175 IPVLSLINLHYPVLNMTSFIH-------FQNLHQYAMADYGNFKH-LSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKI-LWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSD--LEHRTVHSATSD-YTYAGLYMKSYKELMIFKN--PLVFTHDNLSNVNKINLPRSVIKAPG--DIITSFQHNKSVYFLYTET----DFLCGCKENVLVTRLIRLCENDKGLTS----EQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSEL-----KKSSEKTSY-KFNEYKNICQLFTTGNQDSNFLINLQTLCKTYPLHRDIVTSQ--AILYETRTKFFEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETD--KIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKS 2172
            +P+L L+ L  P  +   F H       +   H Y   DY +F+  + Y PN+D + + +N N IV+  +NN+N   K  + K      C +      ++A+     L+  +  +L SN + ++D + Y      LAS +  +   KT IS     ++  V   ++D + Y G   ++ K ++ FK   P  F  +NL +++   +  S I+       +  F++N  VYFL  E     D  C  ++  + +R++R+ +ND G +     E F  F K  +     + +R I                   L  TF+S   E  ++AIC Y++  IE AF+         ++SE  ++ K  E K  C           F   L  L K      + + +Q   I  E  ++ ++I    +S    ++    ++  T   +  L + L P+    R       IT +K +N  +  + +L +  S  + K+ ++ C + +T   C  PFC+W+  T KC  +     + L    +    S   +  ++   QW          +  Q  M  C      D +  +      C     W+ ++SWS+CS+ CG G   R RFC     QN    C G + E + C V+ +C     E      ++W+ WS C   CG   ++R R C   K    L+EI+S
Sbjct:    7 LPILILVMLLLPAHSNVLFFHDLYSKSPYVANHFYRPLDYVSFRDSILYPPNTDDLLITTN-NSIVKFSVNNMNIVYKLEIPKVDAYSSCFRD-----KYAEQYPCHLFGYWTKILPSNMD-VDDHLLYICHSNGLASYYKIKTFEKTTISRSHCPKYSIVSVVSADLHIYVGDLERAPK-ILRFKPEYPTGFPSENLKSLS-TTIQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFC--QDRTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIILVFFDKDRQI-------------------LFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTKCEENKFDCLSHRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPR-------ITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQWSSWNSWSECSSKCGKGNSTRQRFCF----QN--DYCPGKSVEIKPCLVDNQCKSTVLE----LLAEWSNWSDCFPKCGHGVRTRRRVC---KYKGLLSEIES 655          
BLAST of semaphorin 5-3 vs. Planmine SMEST
Match: SMESG000014725.1 (SMESG000014725.1)

HSP 1 Score: 101.679 bits (252), Expect = 1.757e-21
Identity = 53/136 (38.97%), Postives = 78/136 (57.35%), Query Frame = 1
Query: 1855 VDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEK-----CTESLNEIKSC-NLPLCEFKI-YSQWSSWSKFNVT 2241
            V+G W+ +S+W  CS TCGNGT +R R C NP P NGG  C  ++T++Q CVN  C  +        + +W++W+ACS TC   T+SRSR CI        C  +  + ++C N  LC     +S W++WS  +V+
Sbjct:  144 VNGSWSDWSNWGSCSVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-------SWGEWSSWAACSVTCNNGTQSRSRVCIDSSNSGLPCPGTDKDTQACGNSTLCPINGNWSSWNTWSSCSVS 272          

HSP 2 Score: 64.6994 bits (156), Expect = 3.711e-10
Identity = 26/56 (46.43%), Postives = 40/56 (71.43%), Query Frame = 1
Query: 1849 CKVDGDWTVYSSWSDCSATCG-NGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVN 2013
            C ++G+W+ +++WS CS +CG NG   RSR C+NP P N G++C+G +T+ Q C N
Sbjct:  254 CPINGNWSSWNTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTN 309          

HSP 3 Score: 51.9878 bits (123), Expect = 3.364e-6
Identity = 47/99 (47.47%), Postives = 66/99 (66.67%), Query Frame = 1
Query: 1837 ISPECKVDGDWTVYSSWSDCSATCG-NGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQC 2130
            +S  C V+G+W+ +S+WS CS +CG NG   RSR C+NP P N G++C+G +T+ Q C N     LN     G +S W+TWS+CS +CGF T+SR+R C
Sbjct:  370 VSLNCPVNGNWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNV---PLNCP-VNGMWSSWSTWSSCSSSCGFGTRSRTRNC 464          
The following BLAST results are available for this feature:
BLAST of semaphorin 5-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEMA5A8.635e-5023.45semaphorin 5A [Source:HGNC Symbol;Acc:HGNC:10736][more]
SEMA5A8.635e-5023.45semaphorin 5A [Source:HGNC Symbol;Acc:HGNC:10736][more]
SEMA5B2.639e-4222.00semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
SEMA5B7.337e-4222.08semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
SEMA5B7.655e-4222.08semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
back to top
BLAST of semaphorin 5-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adt-11.233e-2336.24A disintegrin and metalloproteinase with thrombosp... [more]
adt-24.003e-1827.22A disintegrin and metalloproteinase with thrombosp... [more]
adt-24.003e-1827.22A disintegrin and metalloproteinase with thrombosp... [more]
T21B6.39.266e-1524.18pep chromosome:WBcel235:X:10945160:10948970:-1 gen... [more]
adt-21.118e-1431.91A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of semaphorin 5-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sema5c5.678e-2923.02gene:FBgn0284221 transcript:FBtr0300339[more]
Sema5c5.937e-2923.02gene:FBgn0284221 transcript:FBtr0076052[more]
AdamTS-B8.804e-1046.43gene:FBgn0029791 transcript:FBtr0301084[more]
AdamTS-B1.391e-946.43gene:FBgn0029791 transcript:FBtr0301083[more]
Sema2a3.702e-923.70gene:FBgn0011260 transcript:FBtr0087090[more]
back to top
BLAST of semaphorin 5-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5a2.231e-4323.04sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5a4.532e-4323.04sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5a4.532e-4323.04sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5bb6.273e-4322.14sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5bb8.421e-4322.14sema domain, seven thrombospondin repeats (type 1 ... [more]
back to top
BLAST of semaphorin 5-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEMA5B4.910e-2327.46semaphorin 5B [Source:NCBI gene;Acc:100493363][more]
eftud25.832e-2136.43elongation factor Tu GTP binding domain containing... [more]
eftud26.083e-2136.43elongation factor Tu GTP binding domain containing... [more]
eftud26.240e-2136.43elongation factor Tu GTP binding domain containing... [more]
ENSXETT00000006505.18.316e-2140.34SCO-spondin [Source:NCBI gene;Acc:100497129][more]
back to top
BLAST of semaphorin 5-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sema5a6.190e-4922.68sema domain, seven thrombospondin repeats (type 1 ... [more]
Sema5b4.583e-4223.16sema domain, seven thrombospondin repeats (type 1 ... [more]
Sema5b7.987e-3922.46sema domain, seven thrombospondin repeats (type 1 ... [more]
Hmcn11.082e-2423.72hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Hmcn11.895e-2423.72hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
back to top
BLAST of semaphorin 5-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13591|SEM5A_HUMAN4.147e-4923.45Semaphorin-5A OS=Homo sapiens OX=9606 GN=SEMA5A PE... [more]
sp|D3ZTD8|SEM5A_RAT3.831e-4823.19Semaphorin-5A OS=Rattus norvegicus OX=10116 GN=Sem... [more]
sp|Q62217|SEM5A_MOUSE1.384e-4722.98Semaphorin-5A OS=Mus musculus OX=10090 GN=Sema5a P... [more]
sp|Q60519|SEM5B_MOUSE3.206e-4123.16Semaphorin-5B OS=Mus musculus OX=10090 GN=Sema5b P... [more]
sp|Q9P283|SEM5B_HUMAN5.677e-4122.08Semaphorin-5B OS=Homo sapiens OX=9606 GN=SEMA5B PE... [more]
back to top
BLAST of semaphorin 5-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K0LJ330.000e+098.95Semaphorin 5-3 (Fragment) OS=Schmidtea mediterrane... [more]
A0A1S2ZK722.159e-4722.23semaphorin-5A OS=Erinaceus europaeus OX=9365 GN=SE... [more]
A0A337S4F46.473e-4623.26Semaphorin 5A OS=Felis catus OX=9685 GN=SEMA5A PE=... [more]
A0A218V4X76.698e-4623.05Semaphorin-5A OS=Lonchura striata domestica OX=299... [more]
G3ST501.103e-4522.94Semaphorin 5A OS=Loxodonta africana OX=9785 GN=SEM... [more]
back to top
BLAST of semaphorin 5-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5bb7.185e-4324.26sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5a3.770e-4222.77semaphorin 5A [Source:NCBI gene;Acc:103027847][more]
sema5a3.915e-4222.77semaphorin 5A [Source:NCBI gene;Acc:103027847][more]
sema5a6.664e-4222.77semaphorin 5A [Source:NCBI gene;Acc:103027847][more]
sema5a7.102e-4123.79semaphorin 5A [Source:NCBI gene;Acc:103027847][more]
back to top
BLAST of semaphorin 5-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5a5.532e-1923.22sema domain, seven thrombospondin repeats (type 1 ... [more]
thbs1a6.943e-1839.17thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402... [more]
ENSPMAT00000000912.11.519e-1733.04pep scaffold:Pmarinus_7.0:GL477542:3:94122:1 gene:... [more]
ENSPMAT00000000917.13.969e-1737.50pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gen... [more]
ENSPMAT00000000925.19.290e-1737.50pep scaffold:Pmarinus_7.0:GL477542:4188:92377:1 ge... [more]
back to top
BLAST of semaphorin 5-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin 5-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476242.347e-2543.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476237.878e-2431.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476259.096e-2430.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489149.531e-2422.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407602.071e-2340.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of semaphorin 5-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5a2.180e-4623.75semaphorin 5A [Source:NCBI gene;Acc:101171867][more]
sema5a2.477e-4623.85semaphorin 5A [Source:NCBI gene;Acc:101171867][more]
sema5ba7.033e-4525.13semaphorin 5B [Source:NCBI gene;Acc:101159709][more]
sema5a2.065e-4425.56semaphorin 5A [Source:NCBI gene;Acc:101171867][more]
sema5ba4.366e-4023.67semaphorin 5B [Source:NCBI gene;Acc:101159709][more]
back to top
BLAST of semaphorin 5-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033853.10.000e+099.81SMESG000033853.1[more]
SMESG000033853.10.000e+099.80SMESG000033853.1[more]
SMESG000033853.10.000e+099.80SMESG000033853.1[more]
SMESG000037895.12.284e-2923.97SMESG000037895.1[more]
SMESG000014725.11.757e-2138.97SMESG000014725.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30001290
GenBankAJA72718.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001290 ID=SMED30001290|Name=semaphorin 5-3|organism=Schmidtea mediterranea sexual|type=transcript|length=3320bp
ATTTGATGTAGCAAGTAATGTGCTCAATAAACCAATACCGGTAAAGCAGC
AATGGATTTTGTTACTCATCAGTGAAATTGCTTAAAGTTCACTTAAAATA
TATCTATTACATTTTATATTATGATATATTATGCCAAGTACCTTGAATTT
GTAACAATTCTAAACATTTTTATTATTCCAGTATTGTCTTTAATAAATCT
ACATTATCCCGTGTTAAACATGACAAGTTTCATTCATTTTCAAAATCTAC
ATCAGTACGCAATGGCGGATTATGGAAACTTCAAACATCTTTCATATATT
CCGAATTCAGATCATATTTACGTAGTTTCTAACGAAAACGAAATTGTGCG
ATTGAAGTTAAACAATCTCAACTTCGACAGCAAATACACATTGAAAAAGC
AATGCACCTCGGAACAATGTGAAAAAATCATAATTGATGTCGTTCAATTT
GCTAAAGATTCAAAAATATTGTGGATTTGTTTTAATTATATGCTTTATTC
CAATACTAATAAATTAGAAGATCAAATGTGCTATGCATTGAAGAAAGAAA
ATCTTGCCAGTGATCATATTGCTCAATGGACAGGCAAAACTTTCATTTCA
AGTGATTTGGAACATCGAACAGTTCATTCCGCGACCTCAGATTATACCTA
TGCAGGATTGTATATGAAATCTTACAAAGAACTAATGATCTTTAAAAATC
CTCTCGTATTTACTCATGATAATTTATCTAATGTTAACAAAATTAATTTA
CCCAGATCCGTCATAAAAGCTCCGGGAGATATTATTACTTCATTCCAGCA
CAATAAATCGGTTTATTTTCTCTACACCGAAACAGATTTTTTATGTGGAT
GTAAAGAAAACGTCCTCGTTACACGCTTGATAAGGCTTTGTGAAAACGAC
AAAGGGCTTACATCAGAACAATTCTCTGTTTTCAACAAAGTTAATGTCGA
ATGTCAGCAAGTAAACAGTAACAGAGCTATACCACCCTTCAAATATCGAA
TAGCAACTAATGGACATTGGCTTTCACTAAGCAAACAGCTCGTCGTGACA
TTCACCAGTAATTATAAGGAGTTTGAATCATCTGCCATTTGTGTTTATAC
GATCAAATCCATTGAGGACGCATTCAACAGTGAATTGAAAAAATCATCAG
AAAAAACTAGCTACAAATTCAATGAATACAAAAACATTTGTCAGCTTTTT
ACCACTGGAAATCAGGATTCAAATTTCTTGATAAATCTCCAAACCCTGTG
CAAGACCTATCCACTTCACAGAGATATTGTGACAAGTCAAGCCATTTTAT
ATGAGACGAGGACAAAGTTTTTCGAAATAGCCTCTGAGGAATCTTCCTGG
TCAAATAATCGACGTGTAGTTTTATTTGTGTCGACTCAAACAAAACATGT
GACAAGTTTGCTGGAAATCAGTTTGCAGCCGAAAATATGCATTCTAAGAA
AGTTTCTGTTGTCAGAAAACATCACTTTGTTGAAAACTGTTAATGAAACG
GATAAGATATATTTATTCGTTGGTACTTCTCACAGAATTGTCAAAATTCC
GCTGGATATGTGTTATTTACAGGCCACTGACACTCAATGTTCGGCGCCAT
TTTGTTACTGGGATAATATCACTAAAAAGTGCAAATATGTTTCGACTAAA
AATCAATTTTTATTAATTTCAAATTCAAAAACATATTGTGCTAGTTCTTT
AAAAGAAAATCAAAACGCGGTCTTAAACCAGTGGGTTCAGTGCCGGCTAA
AATCTATTGTGAATGACCTGTCACAAATAGGAATGTGCAAGTGCAATATT
GAACGGAATACCGATCTTAATGAGATTAAATTAACCATTTCTCCAGAATG
TAAAGTTGATGGAGATTGGACAGTATATTCGTCGTGGTCCGACTGCAGTG
CAACGTGTGGAAACGGAACCCGGGTCAGATCAAGATTCTGCGATAATCCT
AAACCTCAAAATGGTGGCAAAGAATGTACTGGAAATAACACAGAATATCA
AATATGTGTTAATAAAAAATGTGATGAGTTGAATTTTGAAAATACAAGAG
GACGTTATTCTCAATGGACAACTTGGTCAGCTTGCTCAAAGACATGTGGA
TTTAGTACCAAGTCACGAAGTCGTCAGTGCATTTCGGAAAAATGTACTGA
AAGTCTAAATGAAATTAAAAGCTGCAATTTACCATTATGTGAATTTAAAA
TCTATTCCCAGTGGAGTTCCTGGTCCAAGTTTAATGTTACAACATTCACA
AAAATAAGGCTTAGATTTAAATGTATCAAAACTTATCAGTACGAATCCTT
TAATCTTTCGTTAAATGATATTACCCGATACATTGTCTACCCGTCATGCT
CTACTGCAGATTGTCAGTTCAAAAATAACAAACAGATAATTAATGGAAAT
TTCTCTGACTGGTCGGAATGGTCTAGCTGTAGTAATTCATGCAAAGGTTC
AGAGTGGACAAGAAGAACCAGGAACTGTATTACTCCAATATGTTTCGGCG
AGTCTATAGATTATAAAATGTGTCCAATATACTTGTGTAAAAGTTCATGG
AATTGTTGGTCAACGTGGTCAACCTGTTTTACACCGTGTGAAACTAGAGG
GATGAGAATGAGAAATAGAAAATGCATTTATGATAGTAAAAGAACATCGT
GCCGTGGAAATGAAACTGAAATCTCTGATTGTCCTCTAAAACAATGTTCA
GCTGCTTATTCCAAATGGACTGAATGGTCCAATTGTGAGGAAAATAGTTT
TAAAACTAGAAAGCGACAATGTTTATATAATAATAACTGCCTGTTCCCTT
TGATTCAAAATAAACCTTGTCTCAGACAAATAAAGGATAAACCAGCGGAA
TTTTCCTTCATATACATGATTGTATCGGGATTAGTTGGTTTCGTTTGCGG
ACTACTGATGGGATCTATTTTGTGTTATATTTGGTGGAGATGTACAATGA
ATGTGATAAAAGAGACGTATGTAGGATCAAACAGAATCAGTAATACTGGT
AATCCATTAGATAATCAGTCTATTTACGATTCGCAATCTCTACAACTAAC
CCCAGATCCATGCTACAGTACATTTCGACAGAGAACAACATCGAACAGTG
AAAGCAATATCAGATCCCCACCACCTCAATATTATCAGGATCCAAATATA
TTGTTCTATCCAATTTCTCATAATGTTCCTTTAATGCATTCCCATTTACC
GGAAGAACATATAGAGATGAGTTAGAATATTGAGTGGAAAAAACGATAAG
TACTCTCGGTGAAAGTTTTCTCTGATTTTTGTATAGATATTGTTTTAATA
CACGAATCTTTATTTTGTAA
back to top

protein sequence of SMED30001290-orf-1

>SMED30001290-orf-1 ID=SMED30001290-orf-1|Name=SMED30001290-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1035bp
MIYYAKYLEFVTILNIFIIPVLSLINLHYPVLNMTSFIHFQNLHQYAMAD
YGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQC
EKIIIDVVQFAKDSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHI
AQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHD
NLSNVNKINLPRSVIKAPGDIITSFQHNKSVYFLYTETDFLCGCKENVLV
TRLIRLCENDKGLTSEQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHW
LSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKF
NEYKNICQLFTTGNQDSNFLINLQTLCKTYPLHRDIVTSQAILYETRTKF
FEIASEESSWSNNRRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSEN
ITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNI
TKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDL
SQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGT
RVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWT
TWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCEFKIYSQWSS
WSKFNVTTFTKIRLRFKCIKTYQYESFNLSLNDITRYIVYPSCSTADCQF
KNNKQIINGNFSDWSEWSSCSNSCKGSEWTRRTRNCITPICFGESIDYKM
CPIYLCKSSWNCWSTWSTCFTPCETRGMRMRNRKCIYDSKRTSCRGNETE
ISDCPLKQCSAAYSKWTEWSNCEENSFKTRKRQCLYNNNCLFPLIQNKPC
LRQIKDKPAEFSFIYMIVSGLVGFVCGLLMGSILCYIWWRCTMNVIKETY
VGSNRISNTGNPLDNQSIYDSQSLQLTPDPCYSTFRQRTTSNSESNIRSP
PPQYYQDPNILFYPISHNVPLMHSHLPEEHIEMS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR036352Semap_dom_sf
IPR000884TSP1_rpt
IPR001627Semap_dom
IPR015943WD40/YVTN_repeat-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 863..908
e-value: 1.9
score: 6.8
coord: 646..691
e-value: 1.9E-8
score: 44.1
coord: 810..860
e-value: 0.059
score: 20.2
coord: 583..635
e-value: 2.2E-17
score: 73.8
coord: 761..807
e-value: 0.025
score: 23.6
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 587..634
e-value: 9.1E-15
score: 54.6
coord: 647..690
e-value: 4.3E-6
score: 26.8
coord: 813..859
e-value: 2.9E-4
score: 21.0
coord: 762..806
e-value: 0.025
score: 14.8
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 643..691
score: 11.277
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 808..860
score: 8.941
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 758..807
score: 9.638
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 580..635
score: 13.831
IPR001627Sema domainSMARTSM00630semacoord: 54..451
e-value: 6.4E-6
score: -72.8
IPR001627Sema domainPFAMPF01403Semacoord: 63..447
e-value: 2.8E-20
score: 72.6
IPR001627Sema domainPROSITEPS51004SEMAcoord: 35..478
score: 19.003
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 30..479
e-value: 3.5E-40
score: 139.8
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 758..806
e-value: 9.5E-6
score: 27.7
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 642..690
e-value: 3.0E-8
score: 35.7
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 579..634
e-value: 4.6E-18
score: 67.3
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 579..630
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 757..801
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 642..690
NoneNo IPR availablePANTHERPTHR22906PROPERDINcoord: 743..958
coord: 484..729
NoneNo IPR availablePANTHERPTHR22906:SF11PROPERDINcoord: 743..958
coord: 484..729
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 917..939
IPR036352Sema domain superfamilySUPERFAMILYSSF101912Sema domaincoord: 37..478