DNA polymerase nu

Overview
NameDNA polymerase nu
Smed IDSMED30001286
Length (bp)3982
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA polymerase nu (SMED30001286) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA polymerase nu (SMED30001286) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA polymerase nu (SMED30001286) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA polymerase nu (SMED30001286) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001286

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30001286SMESG000032684.1 dd_Smed_v4_10383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001286SMESG000032684.1 dd_Smed_v4_10383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001286SMESG000032684.1 dd_Smed_v4_10383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001286SMESG000032684.1 dd_Smed_v4_10383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001286SMESG000032684.1 dd_Smed_v4_10383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30001286SMESG000032684.1 dd_Smed_v4_10383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30001286SMESG000032684.1 dd_Smed_v4_32229_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30001286SMESG000032684.1 dd_Smed_v4_10383_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA polymerase nu vs. Ensembl Human
Match: POLN (DNA polymerase nu [Source:HGNC Symbol;Acc:HGNC:18870])

HSP 1 Score: 199.134 bits (505), Expect = 8.960e-54
Identity = 135/430 (31.40%), Postives = 233/430 (54.19%), Query Frame = 3
Query:  828 RVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQ-LSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMA---HNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGY-RGIGARLILSRHDELVWRVSNEDLID 2102
            R+   LC++L D  + +    ++  +      +LA ME   I+++ E+  +    +   LK LE++A  +AG    +TS + LRE+++ +LKL       QR+ L  + L    ST+E  L+ L   HPLP ++++YR + K KS +VD     +   K SIS TW Q  +VTGR+    PN+Q   +     ++  +       D+ L+++ +++F+SS  H++++ADFSQIELR+  HLS D  L++LFQ ++R+  D+F+ +     ++ ++     + R+ TK+V+YA +YG G + LA  L +    A   + +       +  FA   +     T  + +I+GRRR  PL RI    A      +Q +RQ +++V+QGSAAD+CK+AMI+    +     + ARL+   HDEL++ V +  + +
Sbjct:   40 RLTMDLCSKLKDYGLWQ----LFRTLELPLIPILAVMESHAIQVNKEEMEKTSALLGARLKELEQEAHFVAGERFLITSNNQLREILFGKLKLHL---LSQRNSLPRTGLQKYPSTSE-ALNALRDLHPLPKIILEYRQVHKIKSTFVDGLLACMK--KGSISSTWNQTGTVTGRLSAKHPNIQGISKHPIQITTPKNFKGKE--DKILTISPRAMFVSSKGHTFLAADFSQIELRILTHLSGDPELLKLFQESERD--DVFSTLTSQWKDVPVEQVTHAD-REQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRR--PLPRIH---AHDQQLRAQAERQAVNFVVQGSAADLCKLAMIHVFTAVAASHTLTARLVAQIHDELLFEVEDPQIPE 449          
BLAST of DNA polymerase nu vs. Ensembl Human
Match: POLN (DNA polymerase nu [Source:HGNC Symbol;Acc:HGNC:18870])

HSP 1 Score: 204.527 bits (519), Expect = 2.919e-53
Identity = 135/430 (31.40%), Postives = 234/430 (54.42%), Query Frame = 3
Query:  828 RVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQ-LSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMA---HNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGY-RGIGARLILSRHDELVWRVSNEDLID 2102
            R+   LC++L D  + +    ++  +      +LA ME   I+++ E+  +    +   LK LE++A  +AG    +TS + LRE+++ +LKL       QR+ L  + L    ST+E +L+ L   HPLP ++++YR + K KS +VD     +   K SIS TW Q  +VTGR+    PN+Q   +     ++  +       D+ L+++ +++F+SS  H++++ADFSQIELR+  HLS D  L++LFQ ++R+  D+F+ +     ++ ++     + R+ TK+V+YA +YG G + LA  L +    A   + +       +  FA   +     T  + +I+GRRR  PL RI    A      +Q +RQ +++V+QGSAAD+CK+AMI+    +     + ARL+   HDEL++ V +  + +
Sbjct:  406 RLTMDLCSKLKDYGLWQ----LFRTLELPLIPILAVMESHAIQVNKEEMEKTSALLGARLKELEQEAHFVAGERFLITSNNQLREILFGKLKLH---LLSQRNSLPRTGLQKYPSTSEAVLNALRDLHPLPKIILEYRQVHKIKSTFVDGLLACMK--KGSISSTWNQTGTVTGRLSAKHPNIQGISKHPIQITTPKNFKGKE--DKILTISPRAMFVSSKGHTFLAADFSQIELRILTHLSGDPELLKLFQESERD--DVFSTLTSQWKDVPVEQVTHAD-REQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRR--PLPRI---HAHDQQLRAQAERQAVNFVVQGSAADLCKLAMIHVFTAVAASHTLTARLVAQIHDELLFEVEDPQIPE 816          
BLAST of DNA polymerase nu vs. Ensembl Human
Match: POLN (DNA polymerase nu [Source:HGNC Symbol;Acc:HGNC:18870])

HSP 1 Score: 204.527 bits (519), Expect = 2.919e-53
Identity = 135/430 (31.40%), Postives = 234/430 (54.42%), Query Frame = 3
Query:  828 RVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQ-LSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMA---HNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGY-RGIGARLILSRHDELVWRVSNEDLID 2102
            R+   LC++L D  + +    ++  +      +LA ME   I+++ E+  +    +   LK LE++A  +AG    +TS + LRE+++ +LKL       QR+ L  + L    ST+E +L+ L   HPLP ++++YR + K KS +VD     +   K SIS TW Q  +VTGR+    PN+Q   +     ++  +       D+ L+++ +++F+SS  H++++ADFSQIELR+  HLS D  L++LFQ ++R+  D+F+ +     ++ ++     + R+ TK+V+YA +YG G + LA  L +    A   + +       +  FA   +     T  + +I+GRRR  PL RI    A      +Q +RQ +++V+QGSAAD+CK+AMI+    +     + ARL+   HDEL++ V +  + +
Sbjct:  406 RLTMDLCSKLKDYGLWQ----LFRTLELPLIPILAVMESHAIQVNKEEMEKTSALLGARLKELEQEAHFVAGERFLITSNNQLREILFGKLKLH---LLSQRNSLPRTGLQKYPSTSEAVLNALRDLHPLPKIILEYRQVHKIKSTFVDGLLACMK--KGSISSTWNQTGTVTGRLSAKHPNIQGISKHPIQITTPKNFKGKE--DKILTISPRAMFVSSKGHTFLAADFSQIELRILTHLSGDPELLKLFQESERD--DVFSTLTSQWKDVPVEQVTHAD-REQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRR--PLPRI---HAHDQQLRAQAERQAVNFVVQGSAADLCKLAMIHVFTAVAASHTLTARLVAQIHDELLFEVEDPQIPE 816          
BLAST of DNA polymerase nu vs. Ensembl Human
Match: POLQ (DNA polymerase theta [Source:HGNC Symbol;Acc:HGNC:9186])

HSP 1 Score: 155.992 bits (393), Expect = 2.532e-37
Identity = 132/516 (25.58%), Postives = 235/516 (45.54%), Query Frame = 3
Query:  831 VLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKL-----------QDKLGAEQRDELGISD-----LINAGSTNELMLSKLSAFHPLPVLVMQYRHMSK--TKSIYVDSFSMLIDPV--KKSISGTWEQHSSVTGRIYCSKPNLQAFP----------------------------RDXXXXXXXXXXXXXXHVDQ--------LSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGL--QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGI----------GYR---------GI--------------GARLILSRHDELVWRVSNEDLIDM 2105
            ++F   N+L   L   +  D++  +       LA +E  GI     +C   +  ++ +L A+E +A ++AG +   TS   + EV++ +LKL           +  LG+ +R   GI +     L    ST++ +L+KL A HPLP L++++R ++   TK ++       ++P    + I    + H++ TGRI  ++PN+Q  P                            R       S +    A +++         S++++  F+     S ++AD+SQ+ELR+ AHLS+D RLIQ+  +      D+F  +A    +    S G + RQ  K++ Y  +YG+G+K L E + I  + A   I++ K    G++ F +  ++      ++ TI+GRRRY P               +  +RQ ++ ++QGSAADI K+A +N Q+ +          G+R         G+              G   IL  HDEL++ V+ ED++ +
Sbjct: 2052 LIFNSMNQLNSLLQKENLQDVFRKVEMPSQYCLALLELNGIGFSTAECESQKHIMQAKLDAIETQAYQLAGHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRR---GIDNGRKLRLGRQFSTSKDVLNKLKALHPLPGLILEWRRITNAITKVVFPLQREKCLNPFLGMERIYPVSQSHTA-TGRITFTEPNIQNVPRDFEIKMPTLVGESPPSQAVGKGLLPMGRGKYKKGFSVNPRCQAQMEERAADRGMPFSISMRHAFVPFPGGSILAADYSQLELRILAHLSHDRRLIQVLNTG----ADVFRSIAAEWKMIEPESVGDDLRQQAKQICYGIIYGMGAKSLGEQMGIKENDAACYIDSFKSRYTGINQFMTETVKNCKRDGFVQTILGRRRYLP-----GIKDNNPYRKAHAERQAINTIVQGSAADIVKIATVNIQKQLETFHSTFKSHGHREGMLQSDQTGLSRKRKLQGMFCPIRGGFFILQLHDELLYEVAEEDVVQV 2554          
BLAST of DNA polymerase nu vs. Ensembl Human
Match: POLQ (DNA polymerase theta [Source:HGNC Symbol;Acc:HGNC:9186])

HSP 1 Score: 155.606 bits (392), Expect = 3.467e-37
Identity = 132/516 (25.58%), Postives = 235/516 (45.54%), Query Frame = 3
Query:  831 VLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKL-----------QDKLGAEQRDELGISD-----LINAGSTNELMLSKLSAFHPLPVLVMQYRHMSK--TKSIYVDSFSMLIDPV--KKSISGTWEQHSSVTGRIYCSKPNLQAFP----------------------------RDXXXXXXXXXXXXXXHVDQ--------LSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGL--QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGI----------GYR---------GI--------------GARLILSRHDELVWRVSNEDLIDM 2105
            ++F   N+L   L   +  D++  +       LA +E  GI     +C   +  ++ +L A+E +A ++AG +   TS   + EV++ +LKL           +  LG+ +R   GI +     L    ST++ +L+KL A HPLP L++++R ++   TK ++       ++P    + I    + H++ TGRI  ++PN+Q  P                            R       S +    A +++         S++++  F+     S ++AD+SQ+ELR+ AHLS+D RLIQ+  +      D+F  +A    +    S G + RQ  K++ Y  +YG+G+K L E + I  + A   I++ K    G++ F +  ++      ++ TI+GRRRY P               +  +RQ ++ ++QGSAADI K+A +N Q+ +          G+R         G+              G   IL  HDEL++ V+ ED++ +
Sbjct: 2187 LIFNSMNQLNSLLQKENLQDVFRKVEMPSQYCLALLELNGIGFSTAECESQKHIMQAKLDAIETQAYQLAGHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRR---GIDNGRKLRLGRQFSTSKDVLNKLKALHPLPGLILEWRRITNAITKVVFPLQREKCLNPFLGMERIYPVSQSHTA-TGRITFTEPNIQNVPRDFEIKMPTLVGESPPSQAVGKGLLPMGRGKYKKGFSVNPRCQAQMEERAADRGMPFSISMRHAFVPFPGGSILAADYSQLELRILAHLSHDRRLIQVLNTG----ADVFRSIAAEWKMIEPESVGDDLRQQAKQICYGIIYGMGAKSLGEQMGIKENDAACYIDSFKSRYTGINQFMTETVKNCKRDGFVQTILGRRRYLP-----GIKDNNPYRKAHAERQAINTIVQGSAADIVKIATVNIQKQLETFHSTFKSHGHREGMLQSDQTGLSRKRKLQGMFCPIRGGFFILQLHDELLYEVAEEDVVQV 2689          
BLAST of DNA polymerase nu vs. Ensembl Celegans
Match: polq-1 (DNA polymerase theta [Source:UniProtKB/Swiss-Prot;Acc:A0FLQ6])

HSP 1 Score: 146.747 bits (369), Expect = 5.312e-35
Identity = 107/389 (27.51%), Postives = 193/389 (49.61%), Query Frame = 3
Query:  912 ACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGT--WEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELV 2072
            +C  VL  + Y GI  D   C  F + I+ +++ LE     +A     + S + +  V++       +LG    +  G    +    TN+L+L +++  HP+   +++YR +  T        +  + P+ K I     W +  + TGRI  S PNLQ  P+                +    ++ + +F+++S +  + AD+ Q+ELR+ AHLSNDS L+ L  S DR   DLF      L +Q +     R   K++ Y  +YG+G+K L+E+  +S + A+ M+       PG+ ++ +   E V     +STI+GRR           A+G   + ++++R  ++Y IQGSA++I K A+++ +  I  +  GA+++L+ HDE++
Sbjct: 1277 SCQTVL-NIFYSGIVFDQALCNSFIYKIRKQIENLEENIWRLAYGKFNIHSSNEVANVLFY------RLGLIYPETSGCKPKLRHLPTNKLILEQMNTQHPIVGKILEYRQIQHT-------LTQCLMPLAKFIGRIHCWFEMCTSTGRILTSVPNLQNVPK---------------RISSDGMSARQLFIANSENLLIGADYKQLELRVLAHLSNDSNLVNLITS-DR---DLF----EELSIQWNF---PRDAVKQLCYGLIYGMGAKSLSELTRMSIEDAEKMLKAFFAMFPGVRSYINETKEKVCKEEPISTIIGRRTII-------KASGIGEERARIERVAVNYTIQGSASEIFKTAIVDIESKI--KEFGAQIVLTIHDEVL 1616          
BLAST of DNA polymerase nu vs. Ensembl Fly
Match: DNApol-theta (gene:FBgn0002905 transcript:FBtr0082662)

HSP 1 Score: 114.005 bits (284), Expect = 6.196e-25
Identity = 112/400 (28.00%), Postives = 188/400 (47.00%), Query Frame = 3
Query:  924 VLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHS-YVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLF-AIMAH-NLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLK----RQMMSYVIQGSAADICKVAMINCQRGIG-YR---GIG---ARLILSRHDELVWRV 2081
             L  ME +G     ++ +Q    +   +K +E K  E  GS   L S   + +V+    K + ++                 +T+  +L KL++  P+  L++ YR +S    +   S   L++  +           + TGRI  ++PNLQ   ++ S    S         D + ++ +S F+ +      +SADF Q+E+R+ AH+S D  L+++ +S+    +DLF AI AH N   +     + R  TK+V Y  +YG+G + LAE L+ S   A+ + +       G+  + +  +    S  ++ TI GRRRY  LE I S       D+  LK    RQ ++  IQGSAADI K A++  ++ I  YR    +G     L++  HDEL++ V
Sbjct: 1660 TLCQMELVGFPAQKQRLQQLYQRMVAVMKKVETKIYEQHGSRFNLGSSQAVAKVLGLHRKAKGRV-----------------TTSRQVLEKLNS--PISHLILGYRKLS---GLLAKSIQPLMECCQADRIHGQSITYTATGRISMTEPNLQNVAKEFSIQVGS---------DVVHISCRSPFMPTDESRCLLSADFCQLEMRILAHMSQDKALLEVMKSS----QDLFIAIAAHWNKIEESEVTQDLRNSTKQVCYGIVYGMGMRSLAESLNCSEQEARMISDQFHQAYKGIRDYTTRVVNFARSKGFVETITGRRRY--LENINS-------DVEHLKNQAERQAVNSTIQGSAADIAKNAILKMEKNIERYREKLALGDNSVDLVMHLHDELIFEV 2015          
BLAST of DNA polymerase nu vs. Ensembl Zebrafish
Match: poln (polymerase (DNA directed) nu [Source:ZFIN;Acc:ZDB-GENE-100917-1])

HSP 1 Score: 190.274 bits (482), Expect = 2.041e-48
Identity = 133/452 (29.42%), Postives = 231/452 (51.11%), Query Frame = 3
Query:  741 SDKLSHSIIDIKLIIDFEEXXXXXXXXXXRVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNL-GL-QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLS---QLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRV 2081
            S   +H      L    E++      S+  +L  L   L ++L  +    +Y  I      VLA ME   + +D E  ++    + ++LK LE++A + AG    ++S + LR +++ +L+L +    ++  +     +    ST+E  L +L   HPLP ++++YR + K K+ +VD   +L    K  IS TW Q S+V+GR+    PN QA P+      S          D ++++ +++F+     +++SADF Q+ELRL AHLS D +L+++FQS +    D F ++A    G+ +       R+  KR++Y+ +YG G + L+ +L +S + A    ++       + AF  H ++   S  ++ +I+GRRR+ P   I S       D S   Q +RQ +++V+QGSAAD+ K+AMI     +      ARL+   HDEL++ V
Sbjct:  652 SKHYTHQFTPTTLQPVLEQAKVTQVISNLSLLHKLMEELHNKLRTQGLWQLYSGIEQKMIPVLAAMESYKMHVDKEALKKTSEMLGSKLKQLEQEAHQAAGQKFLVSSSAQLRLILFEKLRLHELCENKKLPKT----VKQQQSTSETALLQLQKLHPLPKVILEYRQIHKIKTTFVDG--ILSCTRKTFISSTWNQTSTVSGRLSAKHPNFQALPK-LPLQISKKQYIHGKASDIVTVHPRAMFIPREGWTFLSADFCQVELRLLAHLSADPQLLRIFQSPE---ADAFTMLAAQWCGVSEDRVSLEDREQAKRIVYSVVYGAGRERLSGILGVSAEEASRFQDSFLKTYREVPAFIQHTIQHCQSHGFVRSIMGRRRFLP--HIHSA------DWSLRNQAERQAVNFVLQGSAADLAKLAMIRICSQVSSDSQTARLVAQIHDELLFEV 1085          
BLAST of DNA polymerase nu vs. Ensembl Zebrafish
Match: poln (polymerase (DNA directed) nu [Source:ZFIN;Acc:ZDB-GENE-100917-1])

HSP 1 Score: 187.578 bits (475), Expect = 1.113e-47
Identity = 132/452 (29.20%), Postives = 228/452 (50.44%), Query Frame = 3
Query:  741 SDKLSHSIIDIKLIIDFEEXXXXXXXXXXRVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLG--LQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLS---QLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRV 2081
            S   +H      L    E++      S+  +L  L   L  +L  +    +Y  I      VLA ME   + +D E  ++    + ++LK LE++A + AG    ++S + LR +++ +L+L +    ++  +     +    ST+E  L +L   HPLP ++++YR + K K+ +VD   +L    K  IS TW Q S+V+GR+    PN QA P+      S          D ++++ +++F+     +++SADF Q+ELRL AHLS D +L+++FQS +    D F ++A       +       R+  KR++Y+ +YG G + L+ +L +S + A    ++       + AF  H ++   S  ++ +I+GRRR+ P   I S       D S   Q +RQ +++V+QGSAAD+ K+AMI     +      ARL+   HDEL++ V
Sbjct:  653 SKHYTHQFTPTTLQPVLEQAKVTQVISNLSLLHKLMEELHYKLRTQGLWQLYSGIEQKMIPVLAAMESYKMHVDKEALKKTSEMLGSKLKQLEQEAHQAAGQKFLVSSSAQLRLILFEKLRLHELCENKKLPKT----VKQQQSTSETALLQLQKLHPLPKIILEYRQIHKIKTTFVDG--ILSCTRKTFISSTWNQTSTVSGRLSAKHPNFQALPK-LPLQISKKQYIHGKASDIVTVHPRAMFIPREGWTFLSADFCQVELRLLAHLSADPQLLRIFQSPE---ADAFTMLAAQWKGVSEDRVSLEDREQAKRIVYSVVYGAGRERLSGILGVSAEEASRFQDSFLKTYREVPAFIQHTIQHCQSHGFVRSIMGRRRFLP--HIHSA------DWSLRNQAERQAVNFVLQGSAADLAKLAMIRICSQVSSDSQTARLVAQIHDELLFEV 1086          
BLAST of DNA polymerase nu vs. Ensembl Zebrafish
Match: polq (polymerase (DNA directed), theta [Source:ZFIN;Acc:ZDB-GENE-040724-232])

HSP 1 Score: 167.162 bits (422), Expect = 5.766e-41
Identity = 129/495 (26.06%), Postives = 221/495 (44.65%), Query Frame = 3
Query:  867 LIARDS-VDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQ---DKLGAEQRDELGISDLINAG-------STNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQH------------SSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVD-------------------------------QLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGL--QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDL-SQLKRQMMSYVIQGSAADICKVAMINCQRGI--GYRGI-----------------------GARLILSRHDELVWRVSNEDLIDM 2105
            L+ +D  +D++  +       LA +E  GI   + +C   +  ++ +L ALE +A ++AG +  LTSP  + EV++ +LKL    D  G + +  LG +    A        ST + +L KL   HPLP +++++R ++       ++ + ++ P+++     W  H             + TGR+  ++PN+Q  P+D      +         +                               Q S++++  F+  S    ++ D+SQ+ELR+ AHLS D RL+ +  S      D+F  +A    +    S   N RQ  K++ Y  +YG+G+K L E + I  + A   I T K    G+  F    ++  G   Y+ T++GR+R+ P      G     V + S  +RQ ++  +QGSAADI K+A IN QR I   + G+                       G   IL  HDEL++ V+ ED+I +
Sbjct: 2065 LLEKDGFLDVFKKVEMPTQYCLALLELNGIGFSIAECEAQKHVMQAKLSALESQAYQLAGHSFSLTSPEDVAEVLFLELKLPPNGDLNGLKNKKTLGYTRRAGARIKLSKQFSTTKDVLEKLKPLHPLPGVILEWRRIT-------NALTKVVFPLQRE--KKWHSHLKMDRIHPISQSHTATGRVSFTEPNIQNVPKDFEIQMPTLIEESQTSQNGGSKMWCKRTKINRLLAPLLKVSDKSPDKGMQFSVSMRHAFVPFSGGLILAVDYSQLELRILAHLSRDRRLLHVLNSG----ADVFKSIAAEWKMVDPASVDDNMRQQAKQICYGIIYGMGAKSLGEQMGIEENDAACYIETFKSRYNGIQNFLRETVQKCGKNGYVKTLLGRKRFLP------GIKDSNVYIKSHAERQAVNTTVQGSAADIVKLATINIQRRIEEAFPGVPTSHQHPSIRLGGRHRNQFRPLRGGYFILQLHDELIYEVAEEDVIQV 2540          
BLAST of DNA polymerase nu vs. Ensembl Zebrafish
Match: polq (polymerase (DNA directed), theta [Source:ZFIN;Acc:ZDB-GENE-040724-232])

HSP 1 Score: 166.007 bits (419), Expect = 1.346e-40
Identity = 129/500 (25.80%), Postives = 221/500 (44.20%), Query Frame = 3
Query:  867 LIARDS-VDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQ---DKLGAEQRDELGISDLINAG-------STNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQH------------SSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVD------------------------------------QLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGL--QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDL-SQLKRQMMSYVIQGSAADICKVAMINCQRGI--GYRGI-----------------------GARLILSRHDELVWRVSNEDLIDM 2105
            L+ +D  +D++  +       LA +E  GI   + +C   +  ++ +L ALE +A ++AG +  LTSP  + EV++ +LKL    D  G + +  LG +    A        ST + +L KL   HPLP +++++R ++       ++ + ++ P+++     W  H             + TGR+  ++PN+Q  P+D      +         +                                    Q S++++  F+  S    ++ D+SQ+ELR+ AHLS D RL+ +  S      D+F  +A    +    S   N RQ  K++ Y  +YG+G+K L E + I  + A   I T K    G+  F    ++  G   Y+ T++GR+R+ P      G     V + S  +RQ ++  +QGSAADI K+A IN QR I   + G+                       G   IL  HDEL++ V+ ED+I +
Sbjct: 1861 LLEKDGFLDVFKKVEMPTQYCLALLELNGIGFSIAECEAQKHVMQAKLSALESQAYQLAGHSFSLTSPEDVAEVLFLELKLPPNGDLNGLKNKKTLGYTRRAGARIKLSKQFSTTKDVLEKLKPLHPLPGVILEWRRIT-------NALTKVVFPLQRE--KKWHSHLKMDRIHPISQSHTATGRVSFTEPNIQNVPKDFEIQMPTLIEESQTSQNGGSKMWYISKIYKHNYINRQLAPLLKVSDKSPDKGMQFSVSMRHAFVPFSGGLILAVDYSQLELRILAHLSRDRRLLHVLNSG----ADVFKSIAAEWKMVDPASVDDNMRQQAKQICYGIIYGMGAKSLGEQMGIEENDAACYIETFKSRYNGIQNFLRETVQKCGKNGYVKTLLGRKRFLP------GIKDSNVYIKSHAERQAVNTTVQGSAADIVKLATINIQRRIEEAFPGVPTSHQHPSIRLGGRHRNQFRPLRGGYFILQLHDELIYEVAEEDVIQV 2341          
BLAST of DNA polymerase nu vs. Ensembl Xenopus
Match: polq (polymerase (DNA directed), theta [Source:NCBI gene;Acc:733897])

HSP 1 Score: 155.221 bits (391), Expect = 3.101e-37
Identity = 136/503 (27.04%), Postives = 219/503 (43.54%), Query Frame = 3
Query:  831 VLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQ---DKLGAEQRDELGISDLINAG----------STNELMLSKLSAFHPLPVLVMQYRHMSK--TKSIYVDSFSMLIDP--VKKSISGTWEQHSSVTGRIYCSKPNLQAFPRD-------------------XXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYV--------SADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGL--QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQR--------------------GIG----YRGI--------GARLILSRHDELVWRVSNEDLIDM 2105
            V+F   N L   L      D +  +       LA +E  G+    E+C   +  ++ +L  +E  A ++AG +  LTS   L +V++ +LKL    D      +  LG +    A           ST + +L KL A HPLP L+++++ ++   TK ++      L++P    + I    + H++ TGR+  ++PN+Q  P+D                          ++  P   V+Q+       F  S  H++V        +AD+SQ+ELR+ AHLS D RLIQ+  S      D+F  +A    +    +     RQ  K++ Y  +YG+G+K L E + I    A   I+T K    G+  F    + +     ++ TI+GRRRY P  +  +  A      S  +RQ ++  +QGSAADI K A +N Q+                    G G    YR +        GA  IL  HDEL++  + ED I +
Sbjct: 1977 VVFSTMNALGALLEKEKLQDAFHRVEMPTQYCLALLELNGMGFSTEECETQKHIMEAKLNEIEAVAYQLAGRSFSLTSHDDLAQVLFLELKLPPNGDPKAQGNKKTLGYTRRAAASGARVRLGKQFSTAKDVLEKLKALHPLPGLILEWKRITNALTKVVFPLQREKLLNPNLGMERIYPISQTHTA-TGRVSFTEPNIQNVPKDFEIEMPRLVGESPPSQAPGPGKKPQVNTPGPKVPVEQIPAERGVSFFVSMRHAFVPFPGGLILAADYSQLELRILAHLSRDRRLIQVLNSGS----DVFKSIAAEWKMIDPEAVTDTVRQQAKQICYGIIYGMGAKSLGEQMGIEESDAACYIDTFKSRYTGIQKFLKETVRSCTRDGFVQTILGRRRYLPAIKDSNPYA-----KSHAERQAVNTTVQGSAADIVKTATVNIQKRLEETFPSVPKSHEHPVQAGGTGWYEPYRRLRHRPPPTRGAFFILQLHDELLYEAAQEDAIQV 2469          
BLAST of DNA polymerase nu vs. Ensembl Xenopus
Match: polq (polymerase (DNA directed), theta [Source:NCBI gene;Acc:733897])

HSP 1 Score: 155.221 bits (391), Expect = 3.569e-37
Identity = 136/503 (27.04%), Postives = 219/503 (43.54%), Query Frame = 3
Query:  831 VLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQ---DKLGAEQRDELGISDLINAG----------STNELMLSKLSAFHPLPVLVMQYRHMSK--TKSIYVDSFSMLIDP--VKKSISGTWEQHSSVTGRIYCSKPNLQAFPRD-------------------XXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYV--------SADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGL--QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQR--------------------GIG----YRGI--------GARLILSRHDELVWRVSNEDLIDM 2105
            V+F   N L   L      D +  +       LA +E  G+    E+C   +  ++ +L  +E  A ++AG +  LTS   L +V++ +LKL    D      +  LG +    A           ST + +L KL A HPLP L+++++ ++   TK ++      L++P    + I    + H++ TGR+  ++PN+Q  P+D                          ++  P   V+Q+       F  S  H++V        +AD+SQ+ELR+ AHLS D RLIQ+  S      D+F  +A    +    +     RQ  K++ Y  +YG+G+K L E + I    A   I+T K    G+  F    + +     ++ TI+GRRRY P  +  +  A      S  +RQ ++  +QGSAADI K A +N Q+                    G G    YR +        GA  IL  HDEL++  + ED I +
Sbjct: 1953 VVFSTMNALGALLEKEKLQDAFHRVEMPTQYCLALLELNGMGFSTEECETQKHIMEAKLNEIEAVAYQLAGRSFSLTSHDDLAQVLFLELKLPPNGDPKAQGNKKTLGYTRRAAASGARVRLGKQFSTAKDVLEKLKALHPLPGLILEWKRITNALTKVVFPLQREKLLNPNLGMERIYPISQTHTA-TGRVSFTEPNIQNVPKDFEIEMPRLVGESPPSQAPGPGKKPQVNTPGPKVPVEQIPAERGVSFFVSMRHAFVPFPGGLILAADYSQLELRILAHLSRDRRLIQVLNSGS----DVFKSIAAEWKMIDPEAVTDTVRQQAKQICYGIIYGMGAKSLGEQMGIEESDAACYIDTFKSRYTGIQKFLKETVRSCTRDGFVQTILGRRRYLPAIKDSNPYA-----KSHAERQAVNTTVQGSAADIVKTATVNIQKRLEETFPSVPKSHEHPVQAGGTGWYEPYRRLRHRPPPTRGAFFILQLHDELLYEAAQEDAIQV 2445          
BLAST of DNA polymerase nu vs. Ensembl Xenopus
Match: polq (polymerase (DNA directed), theta [Source:NCBI gene;Acc:733897])

HSP 1 Score: 150.214 bits (378), Expect = 1.103e-35
Identity = 135/508 (26.57%), Postives = 218/508 (42.91%), Query Frame = 3
Query:  831 VLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQ---DKLGAEQRDELGISDLINAG----------STNELMLSKLSAFHPLPVLVMQYRHMSK--TKSIYVDSFSMLIDP--VKKSISGTWEQHSSVTGRIYCSKPNLQAFPRD---------------------------XXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYV--------SADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGL--QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQR--------------------GIG------YRGI---GARLILSRHDELVWRVSNEDLIDM 2105
            V+F   N L   L      D +  +       LA +E  G+    E+C   +  ++ +L  +E  A ++AG +  LTS   L +V++ +LKL    D      +  LG +    A           ST + +L KL A HPLP L+++++ ++   TK ++      L++P    + I    + H++ TGR+  ++PN+Q  P+D                                  ++  P   V+Q+       F  S  H++V        +AD+SQ+ELR+ AHLS D RLIQ+  S      D+F  +A    +    +     RQ  K++ Y  +YG+G+K L E + I    A   I+T K    G+  F    + +     ++ TI+GRRRY P  +  +  A      S  +RQ ++  +QGSAADI K A +N Q+                    G G      +R     GA  IL  HDEL++  + ED I +
Sbjct: 2077 VVFSTMNALGALLEKEKLQDAFHRVEMPTQYCLALLELNGMGFSTEECETQKHIMEAKLNEIEAVAYQLAGRSFSLTSHDDLAQVLFLELKLPPNGDPKAQGNKKTLGYTRRAAASGARVRLGKQFSTAKDVLEKLKALHPLPGLILEWKRITNALTKVVFPLQREKLLNPNLGMERIYPISQTHTA-TGRVSFTEPNIQNVPKDFEIEMPRLVGESPPSQAPGPSAYPYRNRGKKPQVNTPGPKVPVEQIPAERGVSFFVSMRHAFVPFPGGLILAADYSQLELRILAHLSRDRRLIQVLNSGS----DVFKSIAAEWKMIDPEAVTDTVRQQAKQICYGIIYGMGAKSLGEQMGIEESDAACYIDTFKSRYTGIQKFLKETVRSCTRDGFVQTILGRRRYLPAIKDSNPYA-----KSHAERQAVNTTVQGSAADIVKTATVNIQKRLEETFPSVPKSHEHPVQAGGTGRAERLRHRPPPTRGAFFILQLHDELLYEAAQEDAIQV 2574          
BLAST of DNA polymerase nu vs. Ensembl Xenopus
Match: polq (polymerase (DNA directed), theta [Source:NCBI gene;Acc:733897])

HSP 1 Score: 150.214 bits (378), Expect = 1.252e-35
Identity = 135/508 (26.57%), Postives = 218/508 (42.91%), Query Frame = 3
Query:  831 VLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQ---DKLGAEQRDELGISDLINAG----------STNELMLSKLSAFHPLPVLVMQYRHMSK--TKSIYVDSFSMLIDP--VKKSISGTWEQHSSVTGRIYCSKPNLQAFPRD---------------------------XXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYV--------SADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGL--QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQR--------------------GIG------YRGI---GARLILSRHDELVWRVSNEDLIDM 2105
            V+F   N L   L      D +  +       LA +E  G+    E+C   +  ++ +L  +E  A ++AG +  LTS   L +V++ +LKL    D      +  LG +    A           ST + +L KL A HPLP L+++++ ++   TK ++      L++P    + I    + H++ TGR+  ++PN+Q  P+D                                  ++  P   V+Q+       F  S  H++V        +AD+SQ+ELR+ AHLS D RLIQ+  S      D+F  +A    +    +     RQ  K++ Y  +YG+G+K L E + I    A   I+T K    G+  F    + +     ++ TI+GRRRY P  +  +  A      S  +RQ ++  +QGSAADI K A +N Q+                    G G      +R     GA  IL  HDEL++  + ED I +
Sbjct: 2138 VVFSTMNALGALLEKEKLQDAFHRVEMPTQYCLALLELNGMGFSTEECETQKHIMEAKLNEIEAVAYQLAGRSFSLTSHDDLAQVLFLELKLPPNGDPKAQGNKKTLGYTRRAAASGARVRLGKQFSTAKDVLEKLKALHPLPGLILEWKRITNALTKVVFPLQREKLLNPNLGMERIYPISQTHTA-TGRVSFTEPNIQNVPKDFEIEMPRLVGESPPSQAPGPSAYPYRNRGKKPQVNTPGPKVPVEQIPAERGVSFFVSMRHAFVPFPGGLILAADYSQLELRILAHLSRDRRLIQVLNSGS----DVFKSIAAEWKMIDPEAVTDTVRQQAKQICYGIIYGMGAKSLGEQMGIEESDAACYIDTFKSRYTGIQKFLKETVRSCTRDGFVQTILGRRRYLPAIKDSNPYA-----KSHAERQAVNTTVQGSAADIVKTATVNIQKRLEETFPSVPKSHEHPVQAGGTGRAERLRHRPPPTRGAFFILQLHDELLYEAAQEDAIQV 2635          
BLAST of DNA polymerase nu vs. Ensembl Xenopus
Match: polq (polymerase (DNA directed), theta [Source:NCBI gene;Acc:733897])

HSP 1 Score: 149.828 bits (377), Expect = 1.616e-35
Identity = 134/507 (26.43%), Postives = 216/507 (42.60%), Query Frame = 3
Query:  831 VLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQ---DKLGAEQRDELGISDLINAG----------STNELMLSKLSAFHPLPVLVMQYRHMSK--TKSIYVDSFSMLIDP--VKKSISGTWEQHSSVTGRIYCSKPNLQAFPRD---------------------------XXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYV--------SADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGL--QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQR---------------------GIGYR-------GIGARLILSRHDELVWRVSNEDLIDM 2105
            V+F   N L   L      D +  +       LA +E  G+    E+C   +  ++ +L  +E  A ++AG +  LTS   L +V++ +LKL    D      +  LG +    A           ST + +L KL A HPLP L+++++ ++   TK ++      L++P    + I    + H++ TGR+  ++PN+Q  P+D                                  ++  P   V+Q+       F  S  H++V        +AD+SQ+ELR+ AHLS D RLIQ+  S      D+F  +A    +    +     RQ  K++ Y  +YG+G+K L E + I    A   I+T K    G+  F    + +     ++ TI+GRRRY P  +  +  A      S  +RQ ++  +QGSAADI K A +N Q+                     G   R         GA  IL  HDEL++  + ED I +
Sbjct: 1959 VVFSTMNALGALLEKEKLQDAFHRVEMPTQYCLALLELNGMGFSTEECETQKHIMEAKLNEIEAVAYQLAGRSFSLTSHDDLAQVLFLELKLPPNGDPKAQGNKKTLGYTRRAAASGARVRLGKQFSTAKDVLEKLKALHPLPGLILEWKRITNALTKVVFPLQREKLLNPNLGMERIYPISQTHTA-TGRVSFTEPNIQNVPKDFEIEMPRLVGESPPSQAPGPSAYPYRNRGKKPQVNTPGPKVPVEQIPAERGVSFFVSMRHAFVPFPGGLILAADYSQLELRILAHLSRDRRLIQVLNSGS----DVFKSIAAEWKMIDPEAVTDTVRQQAKQICYGIIYGMGAKSLGEQMGIEESDAACYIDTFKSRYTGIQKFLKETVRSCTRDGFVQTILGRRRYLPAIKDSNPYA-----KSHAERQAVNTTVQGSAADIVKTATVNIQKRLEETFPSVPKSHDWHLSVPTGRAERLRHRPPPTRGAFFILQLHDELLYEAAQEDAIQV 2455          
BLAST of DNA polymerase nu vs. Ensembl Mouse
Match: Poln (DNA polymerase N [Source:MGI Symbol;Acc:MGI:2675617])

HSP 1 Score: 211.46 bits (537), Expect = 7.155e-56
Identity = 137/424 (32.31%), Postives = 229/424 (54.01%), Query Frame = 3
Query:  828 RVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMA---HNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYR-GIGARLILSRHDELVWRVSN 2087
            ++L+ L   L  +L A     ++  +      +LA ME   I +D E+  +    +   LK LE++A  +AG    + S + LRE+++ +LKL       QR  L  + L N  ST+E ML+ L   HPLP L+++YR + K KS ++D     +   K SIS TW Q  +VTGR+    PN+Q   +     S   +       + ++++ +++F+SS  H++++ADFSQIELR+ AHLS D  L++LFQ ++R+  D+F+ +     ++ ++     + R+ TK+V+Y+ +YG G + LA  L ++   A   +         +  FA   +    S  Y+++I+GRRR  PL RI    A      +Q +RQ +++V+QGSAAD+CK+AMI     +     + ARL+   HDEL++ V +
Sbjct:  403 KILYDLTMDLCSKLKAYGLWQLFCTLELPLIPILAVMENHKIPVDKEEMERTSALLGARLKELEQEAHFVAGEQFLIMSNNQLREILFGKLKLH---LLSQRKHLPRTGLQNQLSTSEAMLNSLQDLHPLPKLILEYRQVHKIKSTFIDGLLAYMK--KGSISSTWNQTGTVTGRLSAKHPNIQGISKHPIKISKPWNFKGKEE-ETVTISPRTLFVSSEGHTFLAADFSQIELRILAHLSGDPELLKLFQESERD--DVFSTLTSQWKDIPIERVTHMD-REQTKKVVYSVVYGAGKERLAACLGVTVLEATHFLERFLQKYKKIKDFAQTVIGQCHSAGYVTSILGRRR--PLPRI---CAQDQQLRAQAERQAVNFVVQGSAADLCKLAMIRISTAVATSPTLTARLVAQIHDELLFEVED 812          
BLAST of DNA polymerase nu vs. Ensembl Mouse
Match: Poln (DNA polymerase N [Source:MGI Symbol;Acc:MGI:2675617])

HSP 1 Score: 195.282 bits (495), Expect = 1.282e-50
Identity = 132/424 (31.13%), Postives = 221/424 (52.12%), Query Frame = 3
Query:  828 RVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMA---HNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYR-GIGARLILSRHDELVWRVSN 2087
            ++L+ L   L  +L A     ++  +      +LA ME   I +D E+  +    +   LK LE++A  +AG    + S + LRE+++ +LKL       QR  L  + L N  ST+E ML+ L   HPLP L+++YR                    + SIS TW Q  +VTGR+    PN+Q   +     S   +       + ++++ +++F+SS  H++++ADFSQIELR+ AHLS D  L++LFQ ++R+  D+F+ +     ++ ++     + R+ TK+V+Y+ +YG G + LA  L ++   A   +         +  FA   +    S  Y+++I+GRRR  PL RI    A      +Q +RQ +++V+QGSAAD+CK+AMI     +     + ARL+   HDEL++ V +
Sbjct:  403 KILYDLTMDLCSKLKAYGLWQLFCTLELPLIPILAVMENHKIPVDKEEMERTSALLGARLKELEQEAHFVAGEQFLIMSNNQLREILFGKLKLH---LLSQRKHLPRTGLQNQLSTSEAMLNSLQDLHPLPKLILEYR--------------------QGSISSTWNQTGTVTGRLSAKHPNIQGISKHPIKISKPWNFKGKEE-ETVTISPRTLFVSSEGHTFLAADFSQIELRILAHLSGDPELLKLFQESERD--DVFSTLTSQWKDIPIERVTHMD-REQTKKVVYSVVYGAGKERLAACLGVTVLEATHFLERFLQKYKKIKDFAQTVIGQCHSAGYVTSILGRRR--PLPRI---CAQDQQLRAQAERQAVNFVVQGSAADLCKLAMIRISTAVATSPTLTARLVAQIHDELLFEVED 794          
BLAST of DNA polymerase nu vs. Ensembl Mouse
Match: Poln (DNA polymerase N [Source:MGI Symbol;Acc:MGI:2675617])

HSP 1 Score: 189.119 bits (479), Expect = 9.421e-49
Identity = 130/424 (30.66%), Postives = 216/424 (50.94%), Query Frame = 3
Query:  828 RVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMA---HNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYR-GIGARLILSRHDELVWRVSN 2087
            ++L+ L   L  +L A     ++  +      +LA ME   I +D E+  +    +   LK LE++A  +AG    + S + LRE+++ +LKL       QR  L  + L N  ST+E ML+ L   HPLP L+++YR + K KS ++D     +   K SIS TW Q  +VTGR+    PN+Q   +     S   +       + ++++ +++F+SS  H++++ADFSQIELR+ AHLS D  L++LFQ ++R+  D+F+ +     ++ ++     + R+ TK+V+Y+ +YG G                                            Y+++I+GRRR  PL RI    A      +Q +RQ +++V+QGSAAD+CK+AMI     +     + ARL+   HDEL++ V +
Sbjct:  403 KILYDLTMDLCSKLKAYGLWQLFCTLELPLIPILAVMENHKIPVDKEEMERTSALLGARLKELEQEAHFVAGEQFLIMSNNQLREILFGKLKLH---LLSQRKHLPRTGLQNQLSTSEAMLNSLQDLHPLPKLILEYRQVHKIKSTFIDGLLAYMK--KGSISSTWNQTGTVTGRLSAKHPNIQGISKHPIKISKPWNFKGKEE-ETVTISPRTLFVSSEGHTFLAADFSQIELRILAHLSGDPELLKLFQESERD--DVFSTLTSQWKDIPIERVTHMD-REQTKKVVYSVVYGAG--------------------------------------------YVTSILGRRR--PLPRI---CAQDQQLRAQAERQAVNFVVQGSAADLCKLAMIRISTAVATSPTLTARLVAQIHDELLFEVED 768          
BLAST of DNA polymerase nu vs. Ensembl Mouse
Match: Polq (polymerase (DNA directed), theta [Source:MGI Symbol;Acc:MGI:2155399])

HSP 1 Score: 153.68 bits (387), Expect = 7.288e-37
Identity = 134/512 (26.17%), Postives = 231/512 (45.12%), Query Frame = 3
Query:  831 VLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKL-----------QDKLGAEQR-DELGIS-DLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSK--TKSIYVDSFSMLIDPVKK--SISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXX------------------------HVDQLSLNVKS---IFLSSSHHSYV--------SADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGL--QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGI----------GYR---------GI--------------GARLILSRHDELVWRVSNEDLIDM 2105
            ++F   N+L   L   +  DI+  +       LA +E  GI     +C   +  ++ +L A+E +A ++AG +   TS   + +V++ +LKL           +  LG+ +R +E G    L    ST++ +L+KL   HPLP L++++R +S   TK ++       ++P+ +   I    + H++ TGRI  ++PN+Q  PRD      +                               H  Q+          F  S  H++V        +AD+SQ+ELR+ AHLS D RLIQ+  +      D+F  +A    +    + G + RQ  K++ Y  +YG+G+K L E + I  + A S I++ K    G++ F    ++      ++ TI+GRRRY P  +  +         +  +RQ ++  +QGSAADI K+A +N Q+ +          G+R         G+              G   IL  HDEL++ V+ ED++ +
Sbjct: 2007 LIFNSMNQLNSLLQKENLHDIFCKVEMPSQYCLALLELNGIGFSTAECESQKHVMQAKLDAIETQAYQLAGHSFSFTSADDIAQVLFLELKLPPNGEMKTQGSKKTLGSTRRGNESGRRMRLGRQFSTSKDILNKLKGLHPLPGLILEWRRISNAITKVVFPLQREKHLNPLLRMERIYPVSQSHTA-TGRITFTEPNIQNVPRDFEIKMPTLVRESPPSQAPKGRFPMAIGQDKKVYGLHPGHRTQMEEKASDRGVPFSVSMRHAFVPFPGGLILAADYSQLELRILAHLSRDCRLIQVLNTG----ADVFRSIAAEWKMIEPDAVGDDLRQHAKQICYGIIYGMGAKSLGEQMGIKENDAASYIDSFKSRYKGINHFMRDTVKNCRKNGFVETILGRRRYLPGIKDDN-----PYHKAHAERQAINTTVQGSAADIVKIATVNIQKQLETFRSTFKSHGHRESMLQNDRTGLLPKRKLKGMFCPMRGGFFILQLHDELLYEVAEEDVVQV 2508          
BLAST of DNA polymerase nu vs. Ensembl Mouse
Match: Polq (polymerase (DNA directed), theta [Source:MGI Symbol;Acc:MGI:2155399])

HSP 1 Score: 153.295 bits (386), Expect = 1.063e-36
Identity = 134/512 (26.17%), Postives = 231/512 (45.12%), Query Frame = 3
Query:  831 VLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKL-----------QDKLGAEQR-DELGIS-DLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSK--TKSIYVDSFSMLIDPVKK--SISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXX------------------------HVDQLSLNVKS---IFLSSSHHSYV--------SADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGL--QMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGI----------GYR---------GI--------------GARLILSRHDELVWRVSNEDLIDM 2105
            ++F   N+L   L   +  DI+  +       LA +E  GI     +C   +  ++ +L A+E +A ++AG +   TS   + +V++ +LKL           +  LG+ +R +E G    L    ST++ +L+KL   HPLP L++++R +S   TK ++       ++P+ +   I    + H++ TGRI  ++PN+Q  PRD      +                               H  Q+          F  S  H++V        +AD+SQ+ELR+ AHLS D RLIQ+  +      D+F  +A    +    + G + RQ  K++ Y  +YG+G+K L E + I  + A S I++ K    G++ F    ++      ++ TI+GRRRY P  +  +         +  +RQ ++  +QGSAADI K+A +N Q+ +          G+R         G+              G   IL  HDEL++ V+ ED++ +
Sbjct: 1728 LIFNSMNQLNSLLQKENLHDIFCKVEMPSQYCLALLELNGIGFSTAECESQKHVMQAKLDAIETQAYQLAGHSFSFTSADDIAQVLFLELKLPPNGEMKTQGSKKTLGSTRRGNESGRRMRLGRQFSTSKDILNKLKGLHPLPGLILEWRRISNAITKVVFPLQREKHLNPLLRMERIYPVSQSHTA-TGRITFTEPNIQNVPRDFEIKMPTLVRESPPSQAPKGRFPMAIGQDKKVYGLHPGHRTQMEEKASDRGVPFSVSMRHAFVPFPGGLILAADYSQLELRILAHLSRDCRLIQVLNTG----ADVFRSIAAEWKMIEPDAVGDDLRQHAKQICYGIIYGMGAKSLGEQMGIKENDAASYIDSFKSRYKGINHFMRDTVKNCRKNGFVETILGRRRYLPGIKDDN-----PYHKAHAERQAINTTVQGSAADIVKIATVNIQKQLETFRSTFKSHGHRESMLQNDRTGLLPKRKLKGMFCPMRGGFFILQLHDELLYEVAEEDVVQV 2229          
BLAST of DNA polymerase nu vs. UniProt/SwissProt
Match: sp|Q7TQ07|DPOLN_MOUSE (DNA polymerase nu OS=Mus musculus OX=10090 GN=Poln PE=2 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 5.370e-55
Identity = 137/424 (32.31%), Postives = 229/424 (54.01%), Query Frame = 3
Query:  828 RVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMA---HNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYR-GIGARLILSRHDELVWRVSN 2087
            ++L+ L   L  +L A     ++  +      +LA ME   I +D E+  +    +   LK LE++A  +AG    + S + LRE+++ +LKL       QR  L  + L N  ST+E ML+ L   HPLP L+++YR + K KS ++D     +   K SIS TW Q  +VTGR+    PN+Q   +     S   +       + ++++ +++F+SS  H++++ADFSQIELR+ AHLS D  L++LFQ ++R+  D+F+ +     ++ ++     + R+ TK+V+Y+ +YG G + LA  L ++   A   +         +  FA   +    S  Y+++I+GRRR  PL RI    A      +Q +RQ +++V+QGSAAD+CK+AMI     +     + ARL+   HDEL++ V +
Sbjct:  401 KILYDLTMDLCSKLKAYGLWQLFCTLELPLIPILAVMENHKIPVDKEEMERTSALLGARLKELEQEAHFVAGEQFLIMSNNQLREILFGKLKLH---LLSQRKHLPRTGLQNQLSTSEAMLNSLQDLHPLPKLILEYRQVHKIKSTFIDGLLAYMK--KGSISSTWNQTGTVTGRLSAKHPNIQGISKHPIKISKPWNFKGKEE-ETVTISPRTLFVSSEGHTFLAADFSQIELRILAHLSGDPELLKLFQESERD--DVFSTLTSQWKDIPIERVTHMD-REQTKKVVYSVVYGAGKERLAACLGVTVLEATHFLERFLQKYKKIKDFAQTVIGQCHSAGYVTSILGRRR--PLPRI---CAQDQQLRAQAERQAVNFVVQGSAADLCKLAMIRISTAVATSPTLTARLVAQIHDELLFEVED 810          
BLAST of DNA polymerase nu vs. UniProt/SwissProt
Match: sp|Q7Z5Q5|DPOLN_HUMAN (DNA polymerase nu OS=Homo sapiens OX=9606 GN=POLN PE=1 SV=2)

HSP 1 Score: 204.527 bits (519), Expect = 1.402e-52
Identity = 135/430 (31.40%), Postives = 234/430 (54.42%), Query Frame = 3
Query:  828 RVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQ-LSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMA---HNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGY-RGIGARLILSRHDELVWRVSNEDLID 2102
            R+   LC++L D  + +    ++  +      +LA ME   I+++ E+  +    +   LK LE++A  +AG    +TS + LRE+++ +LKL       QR+ L  + L    ST+E +L+ L   HPLP ++++YR + K KS +VD     +   K SIS TW Q  +VTGR+    PN+Q   +     ++  +       D+ L+++ +++F+SS  H++++ADFSQIELR+  HLS D  L++LFQ ++R+  D+F+ +     ++ ++     + R+ TK+V+YA +YG G + LA  L +    A   + +       +  FA   +     T  + +I+GRRR  PL RI    A      +Q +RQ +++V+QGSAAD+CK+AMI+    +     + ARL+   HDEL++ V +  + +
Sbjct:  406 RLTMDLCSKLKDYGLWQ----LFRTLELPLIPILAVMESHAIQVNKEEMEKTSALLGARLKELEQEAHFVAGERFLITSNNQLREILFGKLKLH---LLSQRNSLPRTGLQKYPSTSEAVLNALRDLHPLPKIILEYRQVHKIKSTFVDGLLACMK--KGSISSTWNQTGTVTGRLSAKHPNIQGISKHPIQITTPKNFKGKE--DKILTISPRAMFVSSKGHTFLAADFSQIELRILTHLSGDPELLKLFQESERD--DVFSTLTSQWKDVPVEQVTHAD-REQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRR--PLPRI---HAHDQQLRAQAERQAVNFVVQGSAADLCKLAMIHVFTAVAASHTLTARLVAQIHDELLFEVEDPQIPE 816          
BLAST of DNA polymerase nu vs. UniProt/SwissProt
Match: sp|O08307|DPO1_CHLAA (DNA polymerase I OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) OX=324602 GN=polA PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 3.010e-43
Identity = 122/422 (28.91%), Postives = 205/422 (48.58%), Query Frame = 3
Query:  843 LCNRLMDRLIARDSV-DIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAG-STNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNL-GLQMSA-GCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRVSNEDL 2096
            L  RL  +L A  ++ D+Y  +      VL  ME  GI +D E  R+        +  L  +  + AG    + S   L +V++       +LG + R   G+S L + G S    +L +LS  +P+   ++ YR ++K KS Y+D+   L++P    I  ++ Q  + TGR+  + PNLQ  P  +                +    ++  F++     +V+AD+SQIELR+ AH+S D  LI  FQ       D+ A  A  L G++ +A   N R++ K V++  +YGI + GLA+ L I  D A+ +I+ +    PG+  +    LE      Y+ T+ GRR      R+           +  +R+ ++  IQG+AAD+ K+AM+N  R +  +G+  RL+L  HDEL+     +++
Sbjct:  513 LTERLQRQLEAEPALHDLYYRVELPLIEVLTDMELTGIRLDQEYLRELGRHFAQRIADLVERIYQQAGGPFNINSGQQLNDVLF------GRLGIDPRAH-GLSKLKSGGYSITAEVLEELSQLYPIAADILTYRQLTKLKSTYIDALPDLVNPRTGRIHTSYNQLGAATGRLSSNNPNLQNIPVRT----------------EEGREIRRAFVAEPGWRFVAADYSQIELRVLAHMSGDENLIAAFQQG----LDIHAATASRLFGVEPTAVDKNQRRVAKTVVFGVIYGISAFGLAQRLGIERDLARQLIDNLFAQFPGIRRYIDQTLEFGRQHGYVQTLFGRR------RVMEDLRASGARRAAAEREAINAPIQGTAADLMKMAMVNVHRALREQGLRTRLLLQVHDELIAEAPEDEV 901          
BLAST of DNA polymerase nu vs. UniProt/SwissProt
Match: sp|Q588V7|TEB_ARATH (Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana OX=3702 GN=TEB PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 5.224e-43
Identity = 131/443 (29.57%), Postives = 217/443 (48.98%), Query Frame = 3
Query:  840 GLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAG----STNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSML----IDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHS-YVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNL--GLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIG------------------YRGIGARLILSRHDELVWRV 2081
             LC+ L   L++ + +     I      VLA ME  GI ID+E C + +  ++++L++LE+KA E+AG T  L +P+ +  V++ QLKL             I +  + G    ST++  L  L   HP+  ++ ++R ++K  +  + S   L    +   + ++ G W Q S+ TGR+   +PNLQ+   +       +    ++  D+  +N +  F+ +  +   ++AD+SQIELRL AH S DS LI         + D+F ++A       + S   + R  TKR+IY  LYG+G+  LAE L  + D AK  I + K   P + ++ +  +       Y+ T+ GRRR+    + G+     A + S+ +RQ ++ + QGSAADI K+AMIN    I                    +G   R++L  HDELV  V
Sbjct: 1688 ALCSALWKILVSEELLQALTTIEMPLVNVLADMELWGIGIDIEGCLRARNILRDKLRSLEKKAFELAGMTFSLHNPADIANVLFGQLKLP------------IPENQSKGKLHPSTDKHCLDLLRNEHPVVPIIKEHRTLAKLLNCTLGSICSLAKLRLSTQRYTLHGRWLQTSTATGRLSIEEPNLQSVEHEVEFKLDKNGRDVSSDADRYKINARDFFVPTQENWLLLTADYSQIELRLMAHFSRDSSLISKLSQP---EGDVFTMIAAKWTGKAEDSVSPHDRDQTKRLIYGILYGMGANRLAEQLECTSDEAKEKIRSFKSSFPAVTSWLNETISFCQEKGYIQTLKGRRRFLSKIKFGN-----AKEKSKAQRQAVNSMCQGSAADIIKIAMINIYSAIAEDVDTAASSSSSETRFHMLKG-RCRILLQVHDELVLEV 2109          
BLAST of DNA polymerase nu vs. UniProt/SwissProt
Match: sp|O52225|DPO1_THEFI (DNA polymerase I, thermostable OS=Thermus filiformis OX=276 GN=polA PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.323e-39
Identity = 121/438 (27.63%), Postives = 198/438 (45.21%), Query Frame = 3
Query:  786 DFEEXXXXXXXXXXRVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMS-AGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFP--LERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRVSNE 2090
            +F E + +      R+   L  RL ++L+      +Y  +    + VLA ME  G+ +D+       F ++ E++ LE +   +AG    L S   L  V++ +L L           +G ++     ST +  L  L   HP+  L++QYR +SK KS Y+D    L+ P    +   + Q ++ TGR+  S PNLQ  P  +                 L   ++  F++      ++AD+SQIELR+ AHLS D  L ++F+       +  A M    GL  +      R+  K V +  LYG+ +  L++ L I    A++ I       P + A+    LE   +  Y+ T+ GRRRY P    R+ S            +R   +  +QG+AAD+ K+AM+     +  + +GA L+L  HDELV  V  +
Sbjct:  399 EFTEDAAERALLSERLFQNLFPRLSEKLLW-----LYQEVERPLSRVLAHMEARGVRLDVPLLEALSFELEKEMERLEGEVFRLAGHPFNLNSRDQLERVLFDELGLTP---------VGRTEKTGKRSTAQGALEALRGAHPIVELILQYRELSKLKSTYLDPLPRLVHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRT----------------PLGQRIRKAFVAEEGWLLLAADYSQIELRVLAHLSGDENLKRVFREGKDIHTETAAWM---FGLDPALVDPKMRRAAKTVNFGVLYGMSAHRLSQELGIDYKEAEAFIERYFQSFPKVRAWIERTLEEGRTRGYVETLFGRRRYVPDLASRVRSVREAA-------ERMAFNMPVQGTAADLMKIAMVKLFPRL--KPLGAHLLLQVHDELVLEVPED 794          
BLAST of DNA polymerase nu vs. TrEMBL
Match: V4APT7 (POLAc domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_159543 PE=4 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 8.120e-64
Identity = 143/419 (34.13%), Postives = 234/419 (55.85%), Query Frame = 3
Query:  852 RLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNV--KSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQM--SAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRVSNEDL 2096
            ++ ++LI+ +   ++L +  A   +LA ME   I+I MEK  QF   +K +L  LE +A +  G T  + S   LR+V+Y +L+L  KL A  +  L  + + +  ST+E MLS+L+ +HPLP +V++YR + K KS YVD     ID  K  +S  W+Q  + TGR+    PN+QA P+     ++          D+  +++  +  F+S      ++ADF QIELRL AHLSND +L+++F ++  N+ED+F  +      +         R+ TKR++Y+ +YG+G   LA+ L +SPD AK ++N+     P ++ F   C++      +  T+ GRRRY P     +  +   V  +Q +RQ +++ +QGSAAD+CK AM+  +  +  R    RL++  HDELVW V  +D+
Sbjct:  669 KIREKLISENIYKLFL-VETALIPILACMETARIKIHMEKVNQFSSILKKKLSKLENEAFKSVGHTFLINSHPQLRQVLYEELQLDKKLPANSK--LVKTSVAHQKSTSESMLSQLTPYHPLPNIVLEYRQLQKLKSTYVDGMLSCID--KGYLSTYWDQIGAATGRLSSYHPNIQAIPKTCVTITNYQDNFIEGKTDESKIDIYAREPFISHDGWLLLAADFQQIELRLLAHLSNDPQLLEIFNTS--NKEDIFLTLTSQWLCKPYDRISQTEREQTKRIVYSVMYGVGKDRLADYLKVSPDNAKGIMNSFLIKFPAVNRFTKSCIQFCKKHGFTRTLFGRRRYVP-----NIHSYNPVLRAQAERQCVNFRVQGSAADLCKAAMVQVESKL--RQYNTRLLVQIHDELVWEVPEKDI 1073          
BLAST of DNA polymerase nu vs. TrEMBL
Match: A0A1B6GN23 (POLAc domain-containing protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.1118 PE=4 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 1.613e-62
Identity = 145/415 (34.94%), Postives = 215/415 (51.81%), Query Frame = 3
Query:  864 RLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLG-AEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKK--SISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHN-LGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRVSNEDL 2096
            RL A     ++  +      +LA ME   I +D++K  +    I   LK L+++A E+ G    L S   LR+V++ +LKL  K     ++ E G      A ST+E++L +L  FHPLP +V++ RH+ K KS YVD        VKK  ++  TWEQ  + TGRI    PNLQA P+                 D+  + +++IF S    S+++ADF QIE R+FAH + D  +IQ+F    R   D+F  +A   LG     G   R+  KR++Y+ +YG G + LAE L +    A S+I    D  P L       +       YL T+ GRRR FP  R     +  +   +  +RQ ++++IQGSAADICK AM+  Q  +  +G+ A+L+L  HDELVW V++  L
Sbjct:   13 RLSATSLWTVFTDLEMKLTPLLAIMECSSISVDVKKLHETSRVIDKRLKNLQKEAYELVGHPFQLNSHQQLRKVLFDELKLDTKFNIVVKQTEQG------AKSTSEVVLCQLKRFHPLPKIVLEQRHLQKVKSTYVDGLQQF---VKKDGTVGSTWEQTGAATGRITSKNPNLQAIPKVPVMLQ-----------DEEKIYLRAIFKSREGFSFLAADFQQIEFRVFAHFTQDENIIQMF----REGGDIFTQLAGQWLG---GDGEEEREKIKRIVYSVMYGAGPQKLAEYLHVGIHEASSIIKNFVDTFPCLRTLPQIVIAQCRRQGYLVTVSGRRRLFPNIR-----STNSRLRTYAERQAINFLIQGSAADICKAAMLESQTALSAQGLQAKLLLQIHDELVWEVADHHL 395          
BLAST of DNA polymerase nu vs. TrEMBL
Match: A0A2J7Q1N9 (POLAc domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G14844 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.214e-61
Identity = 144/432 (33.33%), Postives = 226/432 (52.31%), Query Frame = 3
Query:  828 RVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMSAGCNA--RQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIG--ARLILSRHDELVWRVSNEDLIDMIG 2111
            ++L  L  +L  +L+ +    I++ +      +LA ME  GI ++ E+ ++ +  ++N++  L+  A   AG    + S   L +++Y  LKL  K G + +  +       + ST+  ML  L  FHPLP +V++YRH+ K  S YV    ML       I  TWEQ +  TGR+  S PNLQ+ P+     +  +        +Q S+ ++S F+    H  ++ADF  IE R+FAHL+ D  LIQLF   +    D+F  +A     + SA   A  R+ TKR++YA +YG G++ LAE+L +  D A  +I++     PGL  F  H ++      YL T+ GRRR FP     S  +   +  +  +RQ +++VIQGSAAD+CK AM+  +  +    +   A L+L  HDELVW VS   L ++ G
Sbjct:   25 QLLSSLTEKLYQQLLKQKLWKIFVDMEMKLLPILAVMELRGILVNKERLKEMENVLENQMNRLKDAAYRAAGKHFHMNSVPQLSQILYEHLKLDQKAGIKVKTTMSR----GSKSTSIPMLKLLQPFHPLPGIVLEYRHLHKLNSTYVAG--MLQHTKGDYIFTTWEQTACATGRLTSSNPNLQSVPKQPISIAGQTD-------EQRSILLRSPFIPRPGHVLLAADFQHIEFRIFAHLAKDVALIQLFHKPN----DIFVNLAQMWLNRGSAVITAEDREKTKRIVYAMMYGAGAQKLAEILDVKGDEANFIISSFNSIFPGLHTFRQHVIDECQKQGYLCTVGGRRRLFP-----SICSSSFIVRAHTERQAVNFVIQGSAADLCKSAMLQIEHKLQEEQLAHDAHLLLQIHDELVWEVSIAQLQNVRG 434          
BLAST of DNA polymerase nu vs. TrEMBL
Match: A0A2J7Q1Q5 (POLAc domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G14844 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.113e-59
Identity = 144/432 (33.33%), Postives = 226/432 (52.31%), Query Frame = 3
Query:  828 RVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMSAGCNA--RQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIG--ARLILSRHDELVWRVSNEDLIDMIG 2111
            ++L  L  +L  +L+ +    I++ +      +LA ME  GI ++ E+ ++ +  ++N++  L+  A   AG    + S   L +++Y  LKL  K G + +  +       + ST+  ML  L  FHPLP +V++YRH+ K  S YV    ML       I  TWEQ +  TGR+  S PNLQ+ P+     +  +        +Q S+ ++S F+    H  ++ADF  IE R+FAHL+ D  LIQLF   +    D+F  +A     + SA   A  R+ TKR++YA +YG G++ LAE+L +  D A  +I++     PGL  F  H ++      YL T+ GRRR FP     S  +   +  +  +RQ +++VIQGSAAD+CK AM+  +  +    +   A L+L  HDELVW VS   L ++ G
Sbjct:  228 QLLSSLTEKLYQQLLKQKLWKIFVDMEMKLLPILAVMELRGILVNKERLKEMENVLENQMNRLKDAAYRAAGKHFHMNSVPQLSQILYEHLKLDQKAGIKVKTTMSR----GSKSTSIPMLKLLQPFHPLPGIVLEYRHLHKLNSTYVAG--MLQHTKGDYIFTTWEQTACATGRLTSSNPNLQSVPKQPISIAGQTD-------EQRSILLRSPFIPRPGHVLLAADFQHIEFRIFAHLAKDVALIQLFHKPN----DIFVNLAQMWLNRGSAVITAEDREKTKRIVYAMMYGAGAQKLAEILDVKGDEANFIISSFNSIFPGLHTFRQHVIDECQKQGYLCTVGGRRRLFP-----SICSSSFIVRAHTERQAVNFVIQGSAADLCKSAMLQIEHKLQEEQLAHDAHLLLQIHDELVWEVSIAQLQNVRG 637          
BLAST of DNA polymerase nu vs. TrEMBL
Match: A0A433SSJ0 (POLAc domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_020009 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 3.458e-57
Identity = 138/423 (32.62%), Postives = 225/423 (53.19%), Query Frame = 3
Query:  843 LCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXX--XXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLF-AIMAHNLGLQMSAGCNA-RQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIG-YRGIGARLILSRHDELVWRVSNEDL 2096
            L   L   L++ +   ++  I      +LA ME   I ID+    +F   +K +L  LE +  +  G +  + S   LR V+Y +LKL  +L ++ +  +G +++    ST+E  L++L   HPLP LV++YR + K KS YVD   ML      ++   W+Q ++ TGR+  ++PN+QA P+ +   +         A  + +  +NV+  F+S    S +SADF QIELR+ AHLS DS L+  F     N  D+F A+     G  + +   A R+ TKR++Y+ +YG+G   LA+ L + PD AK + ++     P ++ +   C +      Y  TI  RRRYFP   I S +    +  +Q +RQ +++ +QGSAADICK+AM++ +  +  +  I  RL+   HDEL+W V  + +
Sbjct:  151 LMKNLERNLVSLNQWSLFTEIEMRLVPILACMEMRAINIDVSVFLKFSDILKCKLSKLEERIHKEVGHSFSINSHMQLRHVLYDELKLDQRLPSKAK--IGKTNVAQVKSTSEASLNQLIDVHPLPSLVLEYRQLQKLKSTYVDG--MLSCVHDGTLRTHWDQTAAATGRLTSARPNIQAVPKTAITITDYQVNYVIGAKSLPEAKINVREPFISQKGFSLLSADFQQIELRILAHLSEDSSLLSTFWQP--NASDVFIALTGKWQGKDVDSVTYADREQTKRIVYSVMYGVGKDKLADYLKVKPDAAKCLRSSFLAQFPAIEKYTKKCQDFAKEFGYTETICARRRYFP--HINSSS---HILRAQAQRQAVNFCVQGSAADICKLAMLSVEEALKEHNEINCRLLFQIHDELIWEVKEDQV 562          
BLAST of DNA polymerase nu vs. Ensembl Cavefish
Match: poln (polymerase (DNA directed) nu [Source:ZFIN;Acc:ZDB-GENE-100917-1])

HSP 1 Score: 197.208 bits (500), Expect = 6.191e-51
Identity = 127/419 (30.31%), Postives = 221/419 (52.74%), Query Frame = 3
Query:  858 MDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNL-GLQM-SAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMIN-CQRGIGYRGIGARLILSRHDELVWRVSNEDLIDM 2105
            +D+L  +    +Y  +      VLA ME   I +D    ++    +  ++K LE++A + AG    ++S + LR V++ +L+L  +    +  +L  + L    ST+E  L +L   HPLP ++++YR   K KS +VD     +   K  IS TW Q S+V+GR+    PN QA P+     +   S       + ++++ +++F+     S++SADF Q+ELRL AHLS+D  L+++FQ+ +    D+F ++A    G+   +     R+  KR++Y+ +YG G + L+ +L +S + A    +T       +  F  H ++      Y+ +I+GRRR  P   + S   G     +Q +RQ +++V+QGSAAD+CK+AMI+ C        + ARL+   HDEL++ V +  + D 
Sbjct:  541 IDQLCTQGLWQLYFCMEQKMIPVLAAMESHRIHVDKAALKKTSEMLGTKVKQLEQEAHQAAGQQFLVSSSAQLRLVLFEKLRLHKRC---ENKKLPKTVLKQQQSTSEAALLQLQDLHPLPKIILEYRQAHKIKSTFVDGILSCV--TKSFISSTWNQTSTVSGRLSAKHPNFQALPKQPIQITKKQSVEGK-ESELVTVHPRTMFIPREGWSFLSADFCQVELRLLAHLSSDPELLRIFQNPE---ADVFTMLASQWKGVSKDTVSSEDREHAKRIVYSVVYGAGRERLSGILGVSSEEASRFQDTFLQTYREVQTFIQHTVQYCHKHGYVKSIMGRRRSLP--HVHSTDWGIR---NQAERQAVNFVVQGSAADLCKMAMIHICSHVSSSATLTARLVAQIHDELLFEVEDSQVEDF 945          
BLAST of DNA polymerase nu vs. Ensembl Cavefish
Match: polq (DNA polymerase theta [Source:NCBI gene;Acc:103039702])

HSP 1 Score: 155.221 bits (391), Expect = 1.917e-37
Identity = 128/488 (26.23%), Postives = 220/488 (45.08%), Query Frame = 3
Query:  885 VDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQ---DKLGAEQRDELGISDLINAG---------STNELMLSKLSAFHPLPVLVMQYRHMSK--TKSIYVDSFSMLIDPVKK--SISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXX---XXXXXXXHVDQLSLNVKSIFLSSSH------------------------HSYV--------SADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMSAGCN--ARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDL-SQLKRQMMSYVIQGSAADICKVAMINCQRGI--GYRGI-------------------------GARLILSRHDELVWRVSNEDLIDM 2105
            +D++  +       LA +E  GI   + +C   +  ++ +L  LE +A ++AG +  LTSP  + EV++ +LKL    D    + +  LG +    AG         ST + +L KL   H LP +++++R ++   TK ++      +  P  K   I    + H++ TGR+  ++PN+Q  P+D      +    S     H   +S   ++    ++H                        H++V        +AD+SQ+ELR+ AHLS D RL+Q+  S     ED+F  +A    +   A  +   RQ  K++ Y  +YG+G+K L E + I  + A   I + K    G+ AF    ++      ++ T++GR+R+ P      G     V + S  +RQ ++  +QGSAADI K+A +N Q  +   + G+                         GA  IL  HDEL++ V+ ED+I +
Sbjct: 2144 LDVFQRVEMPTQYCLALLELNGIGFSVAECEAQKHVMQAKLSDLESQAYQLAGHSFSLTSPDDVAEVLFLELKLPPNGDLNSLKNKKTLGYTRRAGAGARVKLSKQFSTTKDVLEKLKPLHQLPGVILEWRRITNAMTKVVFPLQREKIWHPKLKMDRIHPVSQSHTA-TGRVSFTEPNIQNVPKDFEIQMPTLIGESQPSQNHTTGVSSKSRNTISRTNHQLIALVKDSDKSPGKGMPFFVSMRHAFVPFSGGLILAADYSQLELRILAHLSCDKRLLQVLNSG----EDVFKSIAAEWKMVDPAAVDDSTRQQAKQICYGIIYGMGAKSLGEQMGIDENDAACYIESFKARYTGIQAFLRETVKNCSKNGFVKTLLGRKRFLP------GIKDSNVYIKSHAERQAVNTTVQGSAADIVKLATVNIQHRLEATFPGVPQSHQHNPSETADHGRYRSRSRPFRGAFFILQLHDELIYEVAEEDIIQV 2620          
BLAST of DNA polymerase nu vs. Ensembl Nematostella
Match: EDO43131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN4])

HSP 1 Score: 122.094 bits (305), Expect = 2.172e-31
Identity = 73/205 (35.61%), Postives = 116/205 (56.59%), Query Frame = 3
Query: 1509 DFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFA-IMAHNLGLQ-MSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYR-GIGARLILSRHDELVWRVSNEDLIDMIGG 2114
            DF  IELRL A+LS+D  L+++F   D    D+F  + +  LG+  +      R+ TKR++Y+ +YG+G + L   L + P+ AK  + +     PG++ F+  C+E   +  ++STI  R+R+ P   I S         SQ +RQ +++V+QGSAAD+CK AMI     +     + ARL+L  HDEL+  V++ D ID + G
Sbjct:    1 DFQSIELRLLANLSDDPDLLRVFN--DSTSIDIFTKLTSQWLGVPPVKVDFKERERTKRIVYSVIYGVGRERLGNTLCVEPNEAKGFMESFLGKFPGINEFSRKCIEDCNTNGFVSTIFKRKRWIP--HIKSRDFQIR---SQAERQAVNFVVQGSAADLCKSAMIQIVHALEKDVSLKARLLLQIHDELLLEVADTD-IDRVKG 197          
BLAST of DNA polymerase nu vs. Ensembl Nematostella
Match: EDO38599 (DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7SCG9])

HSP 1 Score: 110.538 bits (275), Expect = 1.578e-25
Identity = 91/341 (26.69%), Postives = 150/341 (43.99%), Query Frame = 3
Query:  927 LAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHL-REVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHM--SKTKSIY-VDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNV-----------------KSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNL-GLQM-SAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFP 1880
            L  ME  G      +C + +  ++ +L+ LE++A  +A  +  LTSP  + REV                                  L +L + HPLP +++++R +  + TK ++ V    +    +  S      Q  + TGR+  ++PNLQ  PRD      S  A       +   N+                 ++ F+  +    ++AD+SQ+ELRL AHL++DSRL ++         D+F ++A +L GL+  S     RQ  K++ Y  +YGIG+K L E L +  + A   I   K    G+  +    +E    T Y++TI  RRRY P
Sbjct:  115 LVRMELNGFGFSEAECDRLKAILQAKLRTLEQEAYRLANHSFSLTSPDDVAREV----------------------------------LERLKSLHPLPRIILEWRRVNCALTKVVFPVQREKLFHKSLHMSRIYPTSQTHTTTGRVSFNEPNLQNVPRDFEIELPSVIAESPPLGTRRRENIQKPARSDHSGMSCAVSMRTAFVPCAGGVLLAADYSQLELRLIAHLADDSRLRKVLNGGG----DVFRMIAGSLAGLEPGSVDDKQRQRAKQICYGIIYGIGAKALGEQLELGEEDASMYIEKFKSRFSGIRRYLKSTVEQCRKTGYVTTITKRRRYLP 417          
BLAST of DNA polymerase nu vs. Ensembl Medaka
Match: poln (DNA polymerase nu [Source:NCBI gene;Acc:101172689])

HSP 1 Score: 190.66 bits (483), Expect = 1.230e-48
Identity = 135/422 (31.99%), Postives = 219/422 (51.90%), Query Frame = 3
Query:  843 LCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAG-STNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNL-GLQMS-AGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGY-RGIGARLILSRHDELVWRVSNEDL 2096
            LC++L  R + +   D+ L +      VLA ME   I +D E  ++    +  +LK LE++A + AG    +TS S LR V++ +L+L      E  +   +   IN   ST+E  L +L   HPLP ++++YR + K KS ++D     +   K  IS TW Q S+VTGRI    PN QA P+     +        A  + ++++ +++F+     ++++ADF Q+ELRL AH S+D  L+ LF      Q D+F ++A    GL M       R+  KR+IY+ +YG G + L+ +L +S ++A    +        +  F    ++      Y+ +I+GRRR  P   I S   G  +   Q +RQ +++V+QGSAAD+CK+AMI     +     + ARL+   HDEL++ V +  L
Sbjct:  779 LCSKLQSRGLWKLYTDVELKM----IPVLAAMESHCIYVDKETLKKMSDLLGTKLKQLEQEAHQAAGQRFLVTSSSQLRTVLFEKLRLH-----EYCENKKLPKTINKQQSTSEAALLQLQDLHPLPKIILEYRQVHKIKSTFIDGILTCMK-SKNYISSTWCQTSAVTGRISAKHPNFQALPKQPLQITKKLFVHGGAE-EVVTVHPRAMFVPHKGWTFLAADFCQVELRLLAHFSSDPDLLHLFTIP---QADVFTMLAAQWKGLNMEDVSSEDREHAKRIIYSVIYGAGRERLSGILGVSAEQASQFQHRFLQTYRDVQTFIQKTIQQSHKQGYVLSIMGRRRNLP--DINSPDWGVRM---QSERQAVNFVVQGSAADLCKMAMIRIFNLVSTSSSLTARLVAQLHDELLYEVEDSQL 1181          
BLAST of DNA polymerase nu vs. Ensembl Medaka
Match: poln (DNA polymerase nu [Source:NCBI gene;Acc:101172689])

HSP 1 Score: 190.66 bits (483), Expect = 1.479e-48
Identity = 135/422 (31.99%), Postives = 219/422 (51.90%), Query Frame = 3
Query:  843 LCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAG-STNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNL-GLQMS-AGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGY-RGIGARLILSRHDELVWRVSNEDL 2096
            LC++L  R + +   D+ L +      VLA ME   I +D E  ++    +  +LK LE++A + AG    +TS S LR V++ +L+L      E  +   +   IN   ST+E  L +L   HPLP ++++YR + K KS ++D     +   K  IS TW Q S+VTGRI    PN QA P+     +        A  + ++++ +++F+     ++++ADF Q+ELRL AH S+D  L+ LF      Q D+F ++A    GL M       R+  KR+IY+ +YG G + L+ +L +S ++A    +        +  F    ++      Y+ +I+GRRR  P   I S   G  +   Q +RQ +++V+QGSAAD+CK+AMI     +     + ARL+   HDEL++ V +  L
Sbjct:  823 LCSKLQSRGLWKLYTDVELKM----IPVLAAMESHCIYVDKETLKKMSDLLGTKLKQLEQEAHQAAGQRFLVTSSSQLRTVLFEKLRLH-----EYCENKKLPKTINKQQSTSEAALLQLQDLHPLPKIILEYRQVHKIKSTFIDGILTCMK-SKNYISSTWCQTSAVTGRISAKHPNFQALPKQPLQITKKLFVHGGAE-EVVTVHPRAMFVPHKGWTFLAADFCQVELRLLAHFSSDPDLLHLFTIP---QADVFTMLAAQWKGLNMEDVSSEDREHAKRIIYSVIYGAGRERLSGILGVSAEQASQFQHRFLQTYRDVQTFIQKTIQQSHKQGYVLSIMGRRRNLP--DINSPDWGVRM---QSERQAVNFVVQGSAADLCKMAMIRIFNLVSTSSSLTARLVAQLHDELLYEVEDSQL 1225          
BLAST of DNA polymerase nu vs. Ensembl Medaka
Match: ENSORLT00000006618.2 (pep primary_assembly:ASM223467v1:1:12654319:12664856:-1 gene:ENSORLG00000005243.2 transcript:ENSORLT00000006618.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.369 bits (381), Expect = 2.817e-36
Identity = 129/488 (26.43%), Postives = 226/488 (46.31%), Query Frame = 3
Query:  831 VLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKL---GAEQRDELGISDLINAG-------STNELMLSKLSAFHPLPVLVMQYRHMSK--TKSIYVDSFSMLIDPVKK--SISGTWEQHSSVTGRIYCSKPNLQAFPRD-----XXXXXXXXXXXXXXH-----------------VDQ---LSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMA---HNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDL-SQLKRQMMSYVIQGSAADICKVAMINCQRGI-------------------GYRGI-GARLILSRHDELVWRVSNEDLIDM 2105
            +L  + N L   L    ++D++  +       LA +E  G+   +E+C + +  ++ +L ALE +A  +AG +  LTS   + +V++ +L L       G   +  LG +             ST + +L KL   HPLP +++++R ++   TK ++         P  K   I    + H++ TGR+  ++PN+Q  P+D      +    S  +  A H                  +Q    S++++  F+  S    ++AD+SQ+ELR+ AHLS D RL+Q+         D+F  +A    N+  + S   N RQ  K++ Y  +YG+G+K L E + +  + A   I + K    G++AF    ++      ++ T++GRRRY P      G    +  + +  +RQ ++  +QGSAADI K+A +N Q+ +                     R + GA  IL  HDEL++  + EDLI +
Sbjct: 1169 LLHTVMNHLTGLLEKDGTLDLFRNVEMPSQVCLALLELNGLGFSVEECERQKHVMQAKLSALESEAYTLAGHSFSLTSVDDIAQVLFLELHLPPNGEIGGIRTKKTLGYTRRGGGRVRFGKQFSTTKDVLEKLRPLHPLPGVILEWRRITNALTKVVFPLQREKQYHPTLKMDRIYPIAQTHTA-TGRVSFTEPNIQNVPKDFDIKMPTMVDESPPSQNAPHRPGKKRRPLTPALTRGLAEQGPAFSVSMRHAFVPFSGGMILAADYSQLELRVLAHLSKDQRLLQVLNGG----ADVFRCIAAEWKNVDPE-SVQDNLRQQAKQICYGIIYGMGAKSLGEQMGVEENDAACYIESFKARYKGINAFLKQTVKNCIKDGFVQTLMGRRRYLP------GILSSSPHIRAHAERQAVNTTVQGSAADIVKLATVNIQKRLQKTYPAAPPSHQHLHTARNQRRAVRGAYFILQLHDELIYETTQEDLIQV 1644          
BLAST of DNA polymerase nu vs. Planmine SMEST
Match: SMESG000032684.1 (SMESG000032684.1)

HSP 1 Score: 1441.79 bits (3731), Expect = 0.000e+0
Identity = 738/779 (94.74%), Postives = 739/779 (94.87%), Query Frame = 3
Query:   33 MAAYFSCELYYSIFRRHIERKIIEIDMNKNFTEKPILNFNSSQNVDYFKNDNFKSCNKSINDDLKLTEKEADDENKTELTSLYNASPRMDLEISSSESSNVDDFEFKLHQRQMFCKWFMSIIKDKADVIEIINGLLPASEISIVVQNKEQLLVMSNKDFDNVVNLSWNNCWAIIVIVSSANCNVCVFASKPLIIGMLESCVIELGMNNIDLYRVVAFLADCERPIIDLQLACSFVNSDKLSHSIIDIKLIIDFEEXXXXXXXXXXRVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRVSNEDLIDMIGGXXXXXXXXXXXXXXXXXXXHGYLSCLLIGSSAHSDLIYREMNVSSLQYPCGTRTASIDLRVPLKVKVRKGPSLLLMDPIEHLTES 2369
            MAAYFSCELYYSIFRRHIERKIIEIDMNKNFTEKPILNFNSSQNVDYFKNDNFKSCNKSINDDLKLTEKEADDENKTELTSLYNASPRMDLEISSSESSNVDDFEFKLHQRQMFCKWFMSIIKDKADVIEIINGLLPASEISIVVQNKEQLLVMSNKDFDNVVNL+WNNCWAIIVIVSSANCNVCVFASKPLIIGMLESC IELGMNNIDLYRVVAFLADCERPIIDLQLACSFVNSDKLSHSIIDIKLIIDFEESSGDCDSSDSRVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLA MEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDSSPCSSSSSASPAAHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAK MINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRVSNEDLIDMI                                    DLIYREMNVSSLQYPCGTRTASIDLRVPLKVKV KGPSLLLMDPIEHLTES
Sbjct:    1 MAAYFSCELYYSIFRRHIERKIIEIDMNKNFTEKPILNFNSSQNVDYFKNDNFKSCNKSINDDLKLTEKEADDENKTELTSLYNASPRMDLEISSSESSNVDDFEFKLHQRQMFCKWFMSIIKDKADVIEIINGLLPASEISIVVQNKEQLLVMSNKDFDNVVNLAWNNCWAIIVIVSSANCNVCVFASKPLIIGMLESCAIELGMNNIDLYRVVAFLADCERPIIDLQLACSFVNSDKLSHSIIDIKLIIDFEESSGDCDSSDSRVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLASMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDSSPCSSSSSASPAAHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKPMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRVSNEDLIDMI------------------------------------DLIYREMNVSSLQYPCGTRTASIDLRVPLKVKVSKGPSLLLMDPIEHLTES 743          
BLAST of DNA polymerase nu vs. Planmine SMEST
Match: SMESG000032684.1 (SMESG000032684.1)

HSP 1 Score: 1389.02 bits (3594), Expect = 0.000e+0
Identity = 712/753 (94.56%), Postives = 713/753 (94.69%), Query Frame = 3
Query:  111 MNKNFTEKPILNFNSSQNVDYFKNDNFKSCNKSINDDLKLTEKEADDENKTELTSLYNASPRMDLEISSSESSNVDDFEFKLHQRQMFCKWFMSIIKDKADVIEIINGLLPASEISIVVQNKEQLLVMSNKDFDNVVNLSWNNCWAIIVIVSSANCNVCVFASKPLIIGMLESCVIELGMNNIDLYRVVAFLADCERPIIDLQLACSFVNSDKLSHSIIDIKLIIDFEEXXXXXXXXXXRVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLAGMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRVSNEDLIDMIGGXXXXXXXXXXXXXXXXXXXHGYLSCLLIGSSAHSDLIYREMNVSSLQYPCGTRTASIDLRVPLKVKVRKGPSLLLMDPIEHLTES 2369
            MNKNFTEKPILNFNSSQNVDYFKNDNFKSCNKSINDDLKLTEKEADDENKTELTSLYNASPRMDLEISSSESSNVDDFEFKLHQRQMFCKWFMSIIKDKADVIEIINGLLPASEISIVVQNKEQLLVMSNKDFDNVVNL+WNNCWAIIVIVSSANCNVCVFASKPLIIGMLESC IELGMNNIDLYRVVAFLADCERPIIDLQLACSFVNSDKLSHSIIDIKLIIDFEESSGDCDSSDSRVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLA MEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDSSPCSSSSSASPAAHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAK MINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRVSNEDLIDMI                                    DLIYREMNVSSLQYPCGTRTASIDLRVPLKVKV KGPSLLLMDPIEHLTES
Sbjct:    1 MNKNFTEKPILNFNSSQNVDYFKNDNFKSCNKSINDDLKLTEKEADDENKTELTSLYNASPRMDLEISSSESSNVDDFEFKLHQRQMFCKWFMSIIKDKADVIEIINGLLPASEISIVVQNKEQLLVMSNKDFDNVVNLAWNNCWAIIVIVSSANCNVCVFASKPLIIGMLESCAIELGMNNIDLYRVVAFLADCERPIIDLQLACSFVNSDKLSHSIIDIKLIIDFEESSGDCDSSDSRVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLASMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDSSPCSSSSSASPAAHVDQLSLNVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMSAGCNARQITKRVIYACLYGIGSKGLAEMLSISPDRAKPMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGIGYRGIGARLILSRHDELVWRVSNEDLIDMI------------------------------------DLIYREMNVSSLQYPCGTRTASIDLRVPLKVKVSKGPSLLLMDPIEHLTES 717          
BLAST of DNA polymerase nu vs. Planmine SMEST
Match: SMESG000034022.1 (SMESG000034022.1)

HSP 1 Score: 131.724 bits (330), Expect = 2.274e-30
Identity = 108/404 (26.73%), Postives = 182/404 (45.05%), Query Frame = 3
Query:  993 IKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKL--QDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHM----SKTKSIYVDSFSMLI---DPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSL-------------------NVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHN-LGLQMSAGCNA-RQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGI--GYRGIG---------ARLILSRHDELVWRV 2081
            +K  +  L++ A  ++G T  + SP  + ++++ +++   Q      +      +  I A +   L  + L + HPLP L+++YRH+     KT +   ++   ++         I   ++Q SS TGR+  + PNLQ+ P+         +     H+D+  L                   N +S F +S     V+AD+ Q+ELR+ +H S D  LI  F   ++   D+F  MA   L   M +  +  RQ  K++ Y  +YGI ++GL+E +SI   +A+ MIN      PG+  F    ++      ++ TI GRRRY P        +      S  +RQ +   IQGSAADI K AM+     I   Y+              ++L  HDE+++ V
Sbjct: 1668 VKRTVDILKQMAFIVSGKTFNIDSPKEVSKLLFIEMRFPVQGIFNGGKITRKNSTSKITASTKKNL--NHLLSLHPLPGLILEYRHLGMLVEKTLNPLFEACKKVVIANSTTNPKIKCIYQQLSS-TGRLNSTSPNLQSVPK-----PIQINWFKLLHLDKRDLFKNKAKELGIDKNEDSVICNFRSCFNASHGFVLVTADYRQLELRILSHFSRDPALIGFF--INQPDVDIFIKMASKWLKKPMESITDVDRQQAKQISYGIIYGISAQGLSEQMSIEESKAEQMINEFMIAFPGVSQFIKSTIDICRKNGFIETITGRRRYLP-----DIISENPFCRSHAERQAIHSTIQGSAADIVKTAMVMVDNAITADYKNKSFHRKSLNQIPAMVLHLHDEILYEV 2056          
BLAST of DNA polymerase nu vs. Planmine SMEST
Match: SMESG000034022.1 (SMESG000034022.1)

HSP 1 Score: 131.339 bits (329), Expect = 2.730e-30
Identity = 108/404 (26.73%), Postives = 182/404 (45.05%), Query Frame = 3
Query:  993 IKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLKL--QDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHM----SKTKSIYVDSFSMLI---DPVKKSISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSL-------------------NVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHN-LGLQMSAGCNA-RQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGI--GYRGIG---------ARLILSRHDELVWRV 2081
            +K  +  L++ A  ++G T  + SP  + ++++ +++   Q      +      +  I A +   L  + L + HPLP L+++YRH+     KT +   ++   ++         I   ++Q SS TGR+  + PNLQ+ P+         +     H+D+  L                   N +S F +S     V+AD+ Q+ELR+ +H S D  LI  F   ++   D+F  MA   L   M +  +  RQ  K++ Y  +YGI ++GL+E +SI   +A+ MIN      PG+  F    ++      ++ TI GRRRY P        +      S  +RQ +   IQGSAADI K AM+     I   Y+              ++L  HDE+++ V
Sbjct: 1158 VKRTVDILKQMAFIVSGKTFNIDSPKEVSKLLFIEMRFPVQGIFNGGKITRKNSTSKITASTKKNL--NHLLSLHPLPGLILEYRHLGMLVEKTLNPLFEACKKVVIANSTTNPKIKCIYQQLSS-TGRLNSTSPNLQSVPK-----PIQINWFKLLHLDKRDLFKNKAKELGIDKNEDSVICNFRSCFNASHGFVLVTADYRQLELRILSHFSRDPALIGFF--INQPDVDIFIKMASKWLKKPMESITDVDRQQAKQISYGIIYGISAQGLSEQMSIEESKAEQMINEFMIAFPGVSQFIKSTIDICRKNGFIETITGRRRYLP-----DIISENPFCRSHAERQAIHSTIQGSAADIVKTAMVMVDNAITADYKNKSFHRKSLNQIPAMVLHLHDEILYEV 1546          
BLAST of DNA polymerase nu vs. Planmine SMEST
Match: SMESG000034022.1 (SMESG000034022.1)

HSP 1 Score: 130.568 bits (327), Expect = 4.878e-30
Identity = 109/407 (26.78%), Postives = 183/407 (44.96%), Query Frame = 3
Query:  993 IKNELKALERKAIEIAGSTLCLTSPSHLREVIYRQLK--LQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVMQYRHMSKTKSIYVDSFSMLIDPVKK----------SISGTWEQHSSVTGRIYCSKPNLQAFPRDXXXXXXXXXXXXXXHVDQLSL-------------------NVKSIFLSSSHHSYVSADFSQIELRLFAHLSNDSRLIQLFQSADRNQEDLFAIMAHN-LGLQMSAGCNA-RQITKRVIYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVGSTNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADICKVAMINCQRGI--GYRGIG---------ARLILSRHDELVWRV 2081
            +K  +  L++ A  ++G T  + SP  + ++++ +++  +Q      +      +  I A +   L  + L + HPLP L+++YRH+     +   + + L +  KK           I   ++Q SS TGR+  + PNLQ+ P+         +     H+D+  L                   N +S F +S     V+AD+ Q+ELR+ +H S D  LI  F   ++   D+F  MA   L   M +  +  RQ  K++ Y  +YGI ++GL+E +SI   +A+ MIN      PG+  F    ++      ++ TI GRRRY P        +      S  +RQ +   IQGSAADI K AM+     I   Y+              ++L  HDE+++ V
Sbjct: 1168 VKRTVDILKQMAFIVSGKTFNIDSPKEVSKLLFIEMRFPVQGIFNGGKITRKNSTSKITASTKKNL--NHLLSLHPLPGLILEYRHLG---MLVEKTLNPLFEACKKVVIANSTTNPKIKCIYQQLSS-TGRLNSTSPNLQSVPK-----PIQINWFKLLHLDKRDLFKNKAKELGIDKNEDSVICNFRSCFNASHGFVLVTADYRQLELRILSHFSRDPALIGFF--INQPDVDIFIKMASKWLKKPMESITDVDRQQAKQISYGIIYGISAQGLSEQMSIEESKAEQMINEFMIAFPGVSQFIKSTIDICRKNGFIETITGRRRYLP-----DIISENPFCRSHAERQAIHSTIQGSAADIVKTAMVMVDNAITADYKNKSFHRKSLNQIPAMVLHLHDEILYEV 1556          
The following BLAST results are available for this feature:
BLAST of DNA polymerase nu vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POLN8.960e-5431.40DNA polymerase nu [Source:HGNC Symbol;Acc:HGNC:188... [more]
POLN2.919e-5331.40DNA polymerase nu [Source:HGNC Symbol;Acc:HGNC:188... [more]
POLN2.919e-5331.40DNA polymerase nu [Source:HGNC Symbol;Acc:HGNC:188... [more]
POLQ2.532e-3725.58DNA polymerase theta [Source:HGNC Symbol;Acc:HGNC:... [more]
POLQ3.467e-3725.58DNA polymerase theta [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of DNA polymerase nu vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
polq-15.312e-3527.51DNA polymerase theta [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of DNA polymerase nu vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DNApol-theta6.196e-2528.00gene:FBgn0002905 transcript:FBtr0082662[more]
back to top
BLAST of DNA polymerase nu vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
poln2.041e-4829.42polymerase (DNA directed) nu [Source:ZFIN;Acc:ZDB-... [more]
poln1.113e-4729.20polymerase (DNA directed) nu [Source:ZFIN;Acc:ZDB-... [more]
polq5.766e-4126.06polymerase (DNA directed), theta [Source:ZFIN;Acc:... [more]
polq1.346e-4025.80polymerase (DNA directed), theta [Source:ZFIN;Acc:... [more]
back to top
BLAST of DNA polymerase nu vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polq3.101e-3727.04polymerase (DNA directed), theta [Source:NCBI gene... [more]
polq3.569e-3727.04polymerase (DNA directed), theta [Source:NCBI gene... [more]
polq1.103e-3526.57polymerase (DNA directed), theta [Source:NCBI gene... [more]
polq1.252e-3526.57polymerase (DNA directed), theta [Source:NCBI gene... [more]
polq1.616e-3526.43polymerase (DNA directed), theta [Source:NCBI gene... [more]
back to top
BLAST of DNA polymerase nu vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Poln7.155e-5632.31DNA polymerase N [Source:MGI Symbol;Acc:MGI:267561... [more]
Poln1.282e-5031.13DNA polymerase N [Source:MGI Symbol;Acc:MGI:267561... [more]
Poln9.421e-4930.66DNA polymerase N [Source:MGI Symbol;Acc:MGI:267561... [more]
Polq7.288e-3726.17polymerase (DNA directed), theta [Source:MGI Symbo... [more]
Polq1.063e-3626.17polymerase (DNA directed), theta [Source:MGI Symbo... [more]
back to top
BLAST of DNA polymerase nu vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7TQ07|DPOLN_MOUSE5.370e-5532.31DNA polymerase nu OS=Mus musculus OX=10090 GN=Poln... [more]
sp|Q7Z5Q5|DPOLN_HUMAN1.402e-5231.40DNA polymerase nu OS=Homo sapiens OX=9606 GN=POLN ... [more]
sp|O08307|DPO1_CHLAA3.010e-4328.91DNA polymerase I OS=Chloroflexus aurantiacus (stra... [more]
sp|Q588V7|TEB_ARATH5.224e-4329.57Helicase and polymerase-containing protein TEBICHI... [more]
sp|O52225|DPO1_THEFI2.323e-3927.63DNA polymerase I, thermostable OS=Thermus filiform... [more]
back to top
BLAST of DNA polymerase nu vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4APT78.120e-6434.13POLAc domain-containing protein OS=Lottia gigantea... [more]
A0A1B6GN231.613e-6234.94POLAc domain-containing protein (Fragment) OS=Cuer... [more]
A0A2J7Q1N91.214e-6133.33POLAc domain-containing protein OS=Cryptotermes se... [more]
A0A2J7Q1Q52.113e-5933.33POLAc domain-containing protein OS=Cryptotermes se... [more]
A0A433SSJ03.458e-5732.62POLAc domain-containing protein (Fragment) OS=Elys... [more]
back to top
BLAST of DNA polymerase nu vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
poln6.191e-5130.31polymerase (DNA directed) nu [Source:ZFIN;Acc:ZDB-... [more]
polq1.917e-3726.23DNA polymerase theta [Source:NCBI gene;Acc:1030397... [more]
back to top
BLAST of DNA polymerase nu vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA polymerase nu vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA polymerase nu vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO431312.172e-3135.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385991.578e-2526.69DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7SCG... [more]
back to top
BLAST of DNA polymerase nu vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
poln1.230e-4831.99DNA polymerase nu [Source:NCBI gene;Acc:101172689][more]
poln1.479e-4831.99DNA polymerase nu [Source:NCBI gene;Acc:101172689][more]
ENSORLT00000006618.22.817e-3626.43pep primary_assembly:ASM223467v1:1:12654319:126648... [more]
back to top
BLAST of DNA polymerase nu vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032684.10.000e+094.74SMESG000032684.1[more]
SMESG000032684.10.000e+094.56SMESG000032684.1[more]
SMESG000034022.12.274e-3026.73SMESG000034022.1[more]
SMESG000034022.12.730e-3026.73SMESG000034022.1[more]
SMESG000034022.14.878e-3026.78SMESG000034022.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001286 ID=SMED30001286|Name=DNA polymerase nu|organism=Schmidtea mediterranea sexual|type=transcript|length=3982bp
AGAACAACTATTGAAATAGTCAATTAATACTAATGGCGGCATATTTTTCC
TGTGAGCTATATTATTCAATATTTAGACGCCATATTGAAAGGAAGATTAT
TGAAATTGATATGAATAAGAATTTTACGGAAAAACCAATTTTAAATTTTA
ATTCATCACAAAATGTTGATTATTTTAAAAATGACAATTTTAAGTCCTGT
AACAAGTCAATTAATGACGATTTAAAACTGACAGAAAAAGAAGCTGATGA
TGAAAACAAAACGGAATTGACTTCACTTTATAATGCGTCGCCTCGAATGG
ATTTGGAAATTTCGTCTTCTGAAAGTTCAAACGTCGACGATTTTGAATTT
AAACTGCACCAGAGGCAAATGTTTTGCAAATGGTTTATGTCTATAATAAA
GGACAAGGCTGATGTTATAGAAATTATCAATGGATTATTACCAGCCAGTG
AAATATCGATTGTTGTTCAGAACAAAGAGCAATTACTGGTAATGAGTAAC
AAAGATTTTGATAATGTGGTTAATTTATCATGGAACAATTGCTGGGCAAT
AATTGTCATTGTTTCTAGCGCCAATTGCAATGTGTGTGTGTTTGCCAGTA
AGCCACTGATAATAGGCATGCTCGAATCGTGTGTCATCGAGCTTGGCATG
AATAATATCGATCTCTACCGAGTTGTGGCATTCCTGGCCGACTGTGAGCG
TCCAATCATCGATCTGCAATTGGCATGTAGCTTTGTGAATTCAGATAAAT
TATCACATTCAATAATCGATATCAAGTTGATTATTGATTTCGAGGAATCG
AGTGGCGACTGCGATTCGAGTGATTCGAGAGTGCTATTTGGCCTGTGCAA
TCGATTGATGGACCGATTGATCGCCCGGGATTCGGTGGATATCTACTTGT
TCATTGGTTGTGCTTGCAACGCAGTTCTGGCCGGCATGGAATATCTGGGC
ATCGAAATCGACATGGAAAAGTGCCGTCAGTTCCAGTTCTGCATCAAGAA
TGAACTGAAAGCCCTGGAAAGGAAAGCGATTGAAATCGCCGGCTCAACAT
TGTGTCTGACAAGCCCGTCGCATTTGAGGGAGGTAATTTATCGGCAATTG
AAACTCCAGGACAAGCTCGGTGCTGAGCAGCGGGACGAGCTGGGAATTAG
CGATCTAATCAATGCCGGATCAACCAATGAATTGATGCTGTCGAAATTAT
CGGCTTTCCATCCGTTGCCGGTTCTGGTTATGCAATATCGGCACATGAGC
AAGACCAAATCCATATATGTCGACTCGTTCTCAATGCTTATCGATCCCGT
CAAGAAATCGATATCGGGAACCTGGGAGCAGCACTCATCGGTCACCGGGC
GCATATATTGCTCTAAACCCAATCTACAAGCGTTCCCTCGTGACAGTTCC
CCGTGTTCCAGCTCATCCTCAGCATCACCAGCAGCTCATGTCGATCAGCT
CTCACTCAATGTCAAATCGATATTCCTCTCCTCCAGCCATCACTCATACG
TGTCAGCAGATTTCTCACAGATTGAGCTGCGCTTGTTTGCCCACCTTTCT
AATGATTCCCGCCTCATCCAGTTGTTCCAGTCCGCTGATCGTAACCAGGA
GGATTTGTTCGCAATCATGGCTCACAATCTGGGGCTGCAAATGTCTGCAG
GTTGCAACGCTAGGCAAATCACTAAGCGGGTCATTTATGCTTGCCTTTAT
GGAATCGGTAGCAAAGGACTGGCCGAAATGCTCTCCATTTCCCCGGACCG
GGCCAAATCTATGATCAATACGGTAAAGGACTATCTGCCGGGCTTGGACG
CGTTTGCATCGCACTGCTTGGAAACTGTTGGCAGCACAAACTACCTGTCA
ACAATTGTAGGGAGAAGGCGATATTTTCCATTGGAGCGGATTGGTAGCGG
TGCTGCCGGTGGTGCTGTCGACCTATCGCAGTTGAAACGCCAGATGATGA
GTTACGTAATCCAAGGATCTGCTGCCGACATTTGTAAGGTTGCGATGATA
AATTGCCAGCGCGGAATTGGGTACAGGGGTATCGGTGCAAGGTTGATTCT
CAGTAGGCATGATGAGCTCGTGTGGCGGGTCAGCAATGAGGATCTGATCG
ATATGATAGGTGGTTGTTGTTGTGTTGTTGTTCCAGTTCTTTGTTGCTGT
TCTTTGTTGTTAGCCTGTTGCCATGGATATTTATCATGTCTATTGATCGG
TTCATCGGCTCATTCAGATCTCATCTACAGGGAGATGAATGTCAGCTCCT
TGCAATATCCCTGTGGTACTCGCACTGCCTCCATTGACCTCCGTGTTCCC
CTCAAGGTCAAGGTCAGGAAGGGGCCCAGTCTCCTTCTTATGGACCCTAT
TGAGCATCTTACTGAGTCATGATGATGATTCCATTGGTTCTGTTGTTTTG
TCGGCTGTTGTGAGGTTCATGCTTATATATATCAATAAATGTGTTCCGAT
TTATTTCTGTGTTTGTTTGCTGGCCAATAAGGCAGAGGGGGGGAGAGGTG
GATGGACTCCATTGCCATTTGATAGGCTAACGTTAACACAGATACTGATA
ATCATACCGCGATGCTGGCAATTACTAGCAGGCGCCGTTTGCACTGGGGG
AGTGAGGTTATCGCCCGGGAGGCCATTCAGTCCACCCCGGATTCACATTC
CTAGTAACGACCAAATGACTAACAACCGCTATGACTCTGGCAATCGACTG
CATGAATTACACATGGAATTGCACACGTGACAGCAAATCGGATTACTTGT
GATTAGACTCAAACTACATAGAGTTAAGCTGTAACTCAGAAGGTTGAATG
TAATTAATTTAGCAAACGCATTTAATTATTGATCCACTGCGCAAGTTATA
AACCTTACCTAAAACCCGTAAACCTGATATCTTGCCAAAATTCTCTCCGT
CGATCGTGATTGCGCCTCAATTCTTGTTCTGCTCTCAAACTAAGCTCATA
AATTTTGCCTCTAACCTCAAATACATTGGAAATAGTTTCTAATTTTCTTT
CCAAATCACCGTTTCTTCTCTGATTTCGTTTTAGTTCGTACAGAACTCGC
ATTATTCCTTTTCAGCGTCAGTCAATCATGATTTTTTATGCCATTCGGTT
AGCTCCTCTCTTTTTACCGACTGTCGCATCTCATGGTGCCGTCTCTTTCC
CGTATTTGAAATTTGTCATTCTCGTGTTCTTGTTCTCATATGTGTAACGA
TTCATTTCGAATTTCCGCGGATATCAATCTGCTCCATTCTTCTTTGGCTT
ATTCCCAATTTTCGAATCGTGCTGTAATGAAATCGATTCGAATTACATCT
TGTCGGTTTTCTAGATCTTCAACTCGATGTTTTCCCAATATTTGGAATCG
ATTATCCTTAGGAGTCATTTTTGTTGTCCAGAACTTTAAGAACTGGATTT
TCATTTGACAACATAAAAATATCTCGAAAAGCCGAATTTAGAAATTGGCA
TTGAAAATTAAACCTGGCTGTCGCAGGTTTAATGCAGCCTTTTCTCTGGC
ACTTGCTCTTTGCTGGGCTTAGTATAGATCTGCATGAGAGTTGTTGATTG
GTCTGAAGTCACTATGTGCTGGGCCCAGGTTTCGATGATGAGCGCGTATC
GACAATTCACCAATCCATGAATATTGTGATGCAACTGGTATTTTTTCTAT
TTTTCGTTATAATTATTGATTTTCTACTTTTAATTTTGCGATGAAAACGT
AATCCGAAAGAAATTTTGAAATGGCTTTTTTGTCTTGATAATTTTTATTT
ACATAATTGAAATAAAATTTCAACTCAGCAAAATATTTATCAGTTAAATT
TCTGAAAATAAGAAAACTATTATTTAAAATTTCTTTATTTTTATCAATTT
GATTTTTAATGTTTTTCTCAATGAAAAAATCAGGTTTTTCATTTTAAATT
TCCTTAATACCAAGGGTTTTATTAAAAATATTTTTTCCTTTATGTTTCCT
TTTTATTAGACTTAAAAACATTTCACTATCAC
back to top

protein sequence of SMED30001286-orf-1

>SMED30001286-orf-1 ID=SMED30001286-orf-1|Name=SMED30001286-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=780bp
MAAYFSCELYYSIFRRHIERKIIEIDMNKNFTEKPILNFNSSQNVDYFKN
DNFKSCNKSINDDLKLTEKEADDENKTELTSLYNASPRMDLEISSSESSN
VDDFEFKLHQRQMFCKWFMSIIKDKADVIEIINGLLPASEISIVVQNKEQ
LLVMSNKDFDNVVNLSWNNCWAIIVIVSSANCNVCVFASKPLIIGMLESC
VIELGMNNIDLYRVVAFLADCERPIIDLQLACSFVNSDKLSHSIIDIKLI
IDFEESSGDCDSSDSRVLFGLCNRLMDRLIARDSVDIYLFIGCACNAVLA
GMEYLGIEIDMEKCRQFQFCIKNELKALERKAIEIAGSTLCLTSPSHLRE
VIYRQLKLQDKLGAEQRDELGISDLINAGSTNELMLSKLSAFHPLPVLVM
QYRHMSKTKSIYVDSFSMLIDPVKKSISGTWEQHSSVTGRIYCSKPNLQA
FPRDSSPCSSSSSASPAAHVDQLSLNVKSIFLSSSHHSYVSADFSQIELR
LFAHLSNDSRLIQLFQSADRNQEDLFAIMAHNLGLQMSAGCNARQITKRV
IYACLYGIGSKGLAEMLSISPDRAKSMINTVKDYLPGLDAFASHCLETVG
STNYLSTIVGRRRYFPLERIGSGAAGGAVDLSQLKRQMMSYVIQGSAADI
CKVAMINCQRGIGYRGIGARLILSRHDELVWRVSNEDLIDMIGGCCCVVV
PVLCCCSLLLACCHGYLSCLLIGSSAHSDLIYREMNVSSLQYPCGTRTAS
IDLRVPLKVKVRKGPSLLLMDPIEHLTES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000724double-strand break repair via homologous recombination
GO:0019985translesion synthesis
GO:0036297interstrand cross-link repair
GO:0006261DNA-dependent DNA replication
GO:0006260DNA replication
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
GO:0071897DNA biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0030332cyclin binding
GO:0003887DNA-directed DNA polymerase activity
GO:0003677DNA binding
GO:0003676nucleic acid binding
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001098DNA-dir_DNA_pol_A_palm_dom
IPR002298DNA_polymerase_A
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 57..77
NoneNo IPR availableGENE3DG3DSA:1.20.1060.10coord: 305..429
e-value: 9.2E-21
score: 76.0
NoneNo IPR availableGENE3DG3DSA:3.30.70.370coord: 436..688
e-value: 6.7E-55
score: 188.1
NoneNo IPR availableGENE3DG3DSA:1.10.150.20coord: 497..647
e-value: 6.7E-55
score: 188.1
NoneNo IPR availablePANTHERPTHR10133:SF27DNA POLYMERASE THETAcoord: 205..767
NoneNo IPR availableSUPERFAMILYSSF56672DNA/RNA polymerasescoord: 290..690
IPR002298DNA polymerase APRINTSPR00868DNAPOLIcoord: 603..614
score: 49.68
coord: 670..683
score: 47.25
coord: 427..449
score: 39.46
coord: 544..569
score: 36.24
coord: 640..656
score: 59.5
IPR002298DNA polymerase APANTHERPTHR10133DNA POLYMERASE Icoord: 205..767
IPR001098DNA-directed DNA polymerase, family A, palm domainSMARTSM00482polaultra3coord: 474..687
e-value: 2.2E-32
score: 123.6
IPR001098DNA-directed DNA polymerase, family A, palm domainPFAMPF00476DNA_pol_Acoord: 312..691
e-value: 7.8E-78
score: 262.1