Methyltransf_25 domain-containing protein

Overview
NameMethyltransf_25 domain-containing protein
Smed IDSMED30001279
Length (bp)1475
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Methyltransf_25 domain-containing protein (SMED30001279) t-SNE clustered cells

Violin plots show distribution of expression levels for Methyltransf_25 domain-containing protein (SMED30001279) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Methyltransf_25 domain-containing protein (SMED30001279) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Methyltransf_25 domain-containing protein (SMED30001279) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001279

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001279SMESG000050769.1 Contig375GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001279SMESG000018708.1 Contig375GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30001279SMESG000018708.1 dd_Smed_v4_5408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Human
Match: METTL27 (methyltransferase like 27 [Source:HGNC Symbol;Acc:HGNC:19068])

HSP 1 Score: 68.1662 bits (165), Expect = 2.927e-12
Identity = 43/142 (30.28%), Postives = 71/142 (50.00%), Query Frame = 3
Query:  156 FYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            FY+ WA  Y+QD+A +   Y A  L +  L   L    +   I+D+  G+GL+  E++  GFL +  +DGS  MLE+A++  +Y      T+G E L S E  ++  ++  G      +    +P L    K GG++ +  R
Sbjct:   31 FYDRWAPDYDQDVATLL--YRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEG-TFDAVLIVGALSDGQVPCNAIPEL-HVTKPGGLVCLTTR 168          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Zebrafish
Match: mettl27 (methyltransferase like 27 [Source:ZFIN;Acc:ZDB-GENE-060421-5918])

HSP 1 Score: 67.0106 bits (162), Expect = 4.008e-12
Identity = 47/179 (26.26%), Postives = 84/179 (46.93%), Query Frame = 3
Query:   45 FVFLKIILLSCHISMEKQSKIESFLTDNFKNDEYVSKFYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            F  ++ ++LS H + E Q K+                FY+ WA +YEQD+A ++  Y A  L    +         K  ++D+  G+GL+   +K++GF + D +DGS  MLE A+   +Y    H  +G ++ + ++ E+Y  ++  G      +  K +  L    K GG + +  R
Sbjct:   15 FSDVRNVILSAHKNTEAQDKV---------------GFYDTWADNYEQDVAVLD--YRAPLLAAECVSSFFNDDREKATVLDVACGTGLVSKHLKRMGFRHFDGVDGSLRMLEGAKKTGLYKQLMHCMLGQDR-IPVKAETYDVVIIVGALSVGQVPLKVIRELWDATKPGGYVCMTTR 175          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Xenopus
Match: vegfb (vascular endothelial growth factor B [Source:Xenbase;Acc:XB-GENE-483494])

HSP 1 Score: 60.8474 bits (146), Expect = 5.987e-10
Identity = 42/144 (29.17%), Postives = 71/144 (49.31%), Query Frame = 3
Query:  156 FYNNWAASYEQDLANIE--GGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            FY++WA  YE+D++ +E    Y A   L SA+  N E       ++D+  G+GL   E+   GF     +DGS+ ML+ A +K +Y+      +G E L     + Y+ ++  G      +    +P L+R  K+GG + +  R
Sbjct:   30 FYDHWAPEYEEDVSVLEYKAPYLAAYTLASAIGSNRE----SQLVLDVACGTGLAAQELHHCGFRLFHGVDGSTGMLQVAETKELYLELKQCMLGQESL-PFPSDLYNAVIIVGALSDGQVPVSVIPELLRVTKQGGFVCLTTR 168          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Mouse
Match: Mettl27 (methyltransferase like 27 [Source:MGI Symbol;Acc:MGI:1933146])

HSP 1 Score: 76.2554 bits (186), Expect = 2.143e-15
Identity = 42/143 (29.37%), Postives = 76/143 (53.15%), Query Frame = 3
Query:  153 KFYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            +FY++WA  Y+QD+A ++  Y A  L +  L        +   I+D+  G+GL+  E++  GFL +  +DGS  ML++AR++ +Y +    T+G E L   E  ++  ++  G      +    +P L+R  K GG++ +  R
Sbjct:   30 RFYDDWAPEYDQDVAALK--YRAPRLAVDCLSRAFRGSPHDALILDVACGTGLVAVELQARGFLQVQGVDGSPEMLKQARARGLYHHLSLCTLGQEPLPDPEG-TFDAVIIVGALSEGQVPCSAIPELLRVTKPGGLVCLTTR 169          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Mouse
Match: Mettl27 (methyltransferase like 27 [Source:MGI Symbol;Acc:MGI:1933146])

HSP 1 Score: 75.8702 bits (185), Expect = 3.908e-15
Identity = 42/143 (29.37%), Postives = 76/143 (53.15%), Query Frame = 3
Query:  153 KFYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            +FY++WA  Y+QD+A ++  Y A  L +  L        +   I+D+  G+GL+  E++  GFL +  +DGS  ML++AR++ +Y +    T+G E L   E  ++  ++  G      +    +P L+R  K GG++ +  R
Sbjct:   30 RFYDDWAPEYDQDVAALK--YRAPRLAVDCLSRAFRGSPHDALILDVACGTGLVAVELQARGFLQVQGVDGSPEMLKQARARGLYHHLSLCTLGQEPLPDPEG-TFDAVIIVGALSEGQVPCSAIPELLRVTKPGGLVCLTTR 169          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Mouse
Match: Mettl27 (methyltransferase like 27 [Source:MGI Symbol;Acc:MGI:1933146])

HSP 1 Score: 75.8702 bits (185), Expect = 3.908e-15
Identity = 42/143 (29.37%), Postives = 76/143 (53.15%), Query Frame = 3
Query:  153 KFYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            +FY++WA  Y+QD+A ++  Y A  L +  L        +   I+D+  G+GL+  E++  GFL +  +DGS  ML++AR++ +Y +    T+G E L   E  ++  ++  G      +    +P L+R  K GG++ +  R
Sbjct:   30 RFYDDWAPEYDQDVAALK--YRAPRLAVDCLSRAFRGSPHDALILDVACGTGLVAVELQARGFLQVQGVDGSPEMLKQARARGLYHHLSLCTLGQEPLPDPEG-TFDAVIIVGALSEGQVPCSAIPELLRVTKPGGLVCLTTR 169          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Mouse
Match: Mettl27 (methyltransferase like 27 [Source:MGI Symbol;Acc:MGI:1933146])

HSP 1 Score: 75.8702 bits (185), Expect = 3.908e-15
Identity = 42/143 (29.37%), Postives = 76/143 (53.15%), Query Frame = 3
Query:  153 KFYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            +FY++WA  Y+QD+A ++  Y A  L +  L        +   I+D+  G+GL+  E++  GFL +  +DGS  ML++AR++ +Y +    T+G E L   E  ++  ++  G      +    +P L+R  K GG++ +  R
Sbjct:   30 RFYDDWAPEYDQDVAALK--YRAPRLAVDCLSRAFRGSPHDALILDVACGTGLVAVELQARGFLQVQGVDGSPEMLKQARARGLYHHLSLCTLGQEPLPDPEG-TFDAVIIVGALSEGQVPCSAIPELLRVTKPGGLVCLTTR 169          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Mouse
Match: Mettl27 (methyltransferase like 27 [Source:MGI Symbol;Acc:MGI:1933146])

HSP 1 Score: 62.003 bits (149), Expect = 3.085e-11
Identity = 34/102 (33.33%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  153 KFYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIE 458
            +FY++WA  Y+QD+A ++  Y A  L +  L        +   I+D+  G+GL+  E++  GFL +  +DGS  ML++AR++ +Y +    T+G E L   E
Sbjct:   30 RFYDDWAPEYDQDVAALK--YRAPRLAVDCLSRAFRGSPHDALILDVACGTGLVAVELQARGFLQVQGVDGSPEMLKQARARGLYHHLSLCTLGQEPLPDPE 129          
BLAST of Methyltransf_25 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N6F8|MET27_HUMAN (Methyltransferase-like protein 27 OS=Homo sapiens OX=9606 GN=METTL27 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.406e-11
Identity = 43/142 (30.28%), Postives = 71/142 (50.00%), Query Frame = 3
Query:  156 FYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            FY+ WA  Y+QD+A +   Y A  L +  L   L    +   I+D+  G+GL+  E++  GFL +  +DGS  MLE+A++  +Y      T+G E L S E  ++  ++  G      +    +P L    K GG++ +  R
Sbjct:   31 FYDRWAPDYDQDVATLL--YRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEG-TFDAVLIVGALSDGQVPCNAIPEL-HVTKPGGLVCLTTR 168          
BLAST of Methyltransf_25 domain-containing protein vs. TrEMBL
Match: A0A1I8IBM4 (MTS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001749g1 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.976e-34
Identity = 83/215 (38.60%), Postives = 130/215 (60.47%), Query Frame = 3
Query:   93 KQSKIESFLTDNFKNDEYVSKFYNNWAASYEQDLANIEGGY-HAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMREEFLSTCLELRDFQPALQKMSSXXXXXXXXXXXXXXYYNKKPGKIFIFKRL 734
            +  KI   L D  K+ + V   Y++W+ SYE DL N+  GY H  ++   A + +  + D   RI+D+ +G+GL G  +K+LGF NIDA+DGS  ML+ A  K IY N F E +G + + S+E  SY  +V+SG+F+P HL   HL  L  T+K GG+  + MREE+L T   L D +P + +M +E   + + + ++E+YYN  PG  ++++R+
Sbjct:   16 RSDKIVGELHD--KDPDGVKSMYDSWSGSYELDLLNMSHGYTHPQKI---ARVADTHLKDKNARILDVCAGTGLGGVALKELGFTNIDAIDGSRGMLDLAAKKQIYKNLFEELIGSDSVKSVEQASYDAIVTSGSFLPGHLGPMHLKPLALTLKSGGLFCMAMREEYLRTDY-LLDLEPTMDRMEAEGIWQKVQKGIMEHYYNDLPGVFYVYRRV 224          
BLAST of Methyltransf_25 domain-containing protein vs. TrEMBL
Match: A0A267DEP5 (Methyltransf_25 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014729g1 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 7.959e-34
Identity = 85/223 (38.12%), Postives = 130/223 (58.30%), Query Frame = 3
Query:   87 MEKQSKIESFLTDNFKNDEY----VSKFYNNWAASYEQDLANIEGGYHAHELLI---SALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMREEFLSTCLELRDFQPALQKMSSXXXXXXXXXXXXXXYYNKKPGKIFIFKRL 734
            +E  ++ E FL+  F N  Y     S+ Y++W+  YE++  N+  GY   E +    +++LP     D   RI+D+ +G+GL G  +KK GF NIDALDGS+ MLE+AR K IY+    E +G   L  +E  +Y  +V+SG+FVP HL    L  L  T+K  G+  + MRE +L T   LRD QP +++M  E   +I   + ++NY+N   G++FI++RL
Sbjct:    7 LEADAESEKFLS-QFTNMHYGGQKTSELYSDWSDEYEKNFLNMTSGYEHPERIADIAASVLP-----DKTCRILDVCAGTGLGGAALKKRGFDNIDALDGSAGMLEKARQKGIYICIVQEVIGTGPLTKVEKGAYDAIVTSGSFVPGHLGPGQLRVLAGTLKPNGLFCMAMREAYLETDY-LRDLQPEMERMQQEGIWKIERCDRMDNYHNGLSGRVFIYRRL 222          
BLAST of Methyltransf_25 domain-containing protein vs. TrEMBL
Match: A0A267EL55 (Methyltransf_25 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007718g1 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.129e-33
Identity = 86/223 (38.57%), Postives = 129/223 (57.85%), Query Frame = 3
Query:   87 MEKQSKIESFLTDNFKNDEY----VSKFYNNWAASYEQDLANIEGGYHAHELLI---SALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMREEFLSTCLELRDFQPALQKMSSXXXXXXXXXXXXXXYYNKKPGKIFIFKRL 734
            +E  ++ E FL+  F N  Y     S+ Y++W+  YE++  N+  GY   E +    +++LP     D   RI+D+ +G+GL G  +KK GF NIDALDGS+ MLE+AR K IY   F E +G   L  +E  +Y  +V+SG+FVP HL    L  L  T+K  G+  + MRE +L T   LRD QP +++M  E   +I   + ++NY+N   G++FI +RL
Sbjct:    7 LEADAESEKFLS-QFTNMHYGGQKTSELYSDWSDEYEKNFLNMTSGYEHPERIADIAASVLP-----DKTCRILDVCAGTGLGGAALKKRGFDNIDALDGSAGMLEKARQKGIYSCIFQEVIGTGPLTKVEKGAYDAIVTSGSFVPGHLGPGQLRVLAGTLKPNGLFCMAMREAYLETDY-LRDLQPEMERMQQEGIWKIERCDRMDNYHNGLSGRVFICRRL 222          
BLAST of Methyltransf_25 domain-containing protein vs. TrEMBL
Match: A0A267DED2 (Methyltransf_25 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014729g2 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.729e-33
Identity = 85/223 (38.12%), Postives = 129/223 (57.85%), Query Frame = 3
Query:   87 MEKQSKIESFLTDNFKNDEY----VSKFYNNWAASYEQDLANIEGGYHAHELLI---SALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMREEFLSTCLELRDFQPALQKMSSXXXXXXXXXXXXXXYYNKKPGKIFIFKRL 734
            +E  ++ E FL+  F N  Y     S+ Y++W+  YE++  N+  GY   E +    +++LP     D   RI+D+ +G+GL G  +KK GF NIDALDGS+ MLE+AR K IY+    E +G   L  +E  +Y  +V+SG+FVP HL    L  L  T+K  G+  + MRE +L T   LRD QP +++M  E   +I   + ++NY+N   G++FI +RL
Sbjct:    7 LEADAESEKFLS-QFTNMHYGGQKTSELYSDWSDEYEKNFLNMTSGYEHPERIADIAASVLP-----DKTCRILDVCAGTGLGGAALKKRGFDNIDALDGSAGMLEKARQKGIYICIVQEVIGTGPLTKVEKGAYDAIVTSGSFVPGHLGPGQLRVLAGTLKPNGLFCMAMREAYLETDY-LRDLQPEMERMQQEGIWKIERCDRMDNYHNGLSGRVFICRRL 222          
BLAST of Methyltransf_25 domain-containing protein vs. TrEMBL
Match: A0A267FYP0 (MTS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001749g6 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 8.170e-33
Identity = 82/229 (35.81%), Postives = 132/229 (57.64%), Query Frame = 3
Query:   87 MEKQSKIESFLTDNFKNDEYV------------SKFYNNWAASYEQDLANIEGGY-HAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMREEFLSTCLELRDFQPALQKMSSXXXXXXXXXXXXXXYYNKKPGKIFIFKRL 734
            ME+Q + +   T++  N  +             S+ Y+ +A  YE DL N+  GY H  ++   A + +  + D   RI+D+ +G+GL G  +K+LGF NIDA+DGS  ML+ A  K IY N F E +G + + S+E  SY  +V+SG+F+P HL   HL  L  T+K GG+  + MREE+L T   L D +P + +M +E   + + + ++E+YYN  PG  ++++R+
Sbjct:    1 MEQQQQKQPLATESIANAFFAQFDTMTSSGAKTSEMYSGFAGEYEHDLLNMSHGYTHPQKI---ARVADTHLKDKNARILDVCAGTGLGGVALKELGFTNIDAIDGSRGMLDLAAKKQIYKNLFEELIGSDSVKSVEQASYDAIVTSGSFLPGHLGPMHLKPLALTLKSGGLFCMAMREEYLRTDY-LLDLEPTMDRMEAEGIWQKVQKGIMEHYYNDLPGVFYVYRRV 225          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Cavefish
Match: mettl27 (methyltransferase like 27 [Source:ZFIN;Acc:ZDB-GENE-060421-5918])

HSP 1 Score: 62.7734 bits (151), Expect = 6.446e-11
Identity = 40/142 (28.17%), Postives = 70/142 (49.30%), Query Frame = 3
Query:  156 FYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            FYN WA +YEQD+A ++  Y A  L    +  + +    +  I+D+  G+GL+   +K++GF     +DGS  ML+ AR   +Y+      +G +    +++E+Y  +V  G      +    L  L +  K GG + +  R
Sbjct:   32 FYNTWAENYEQDVALLD--YRAPLLAAECITSHFKGDKERAIILDVACGTGLVSAHLKRMGFCQFIGVDGSEGMLDLARKTGLYLELMQCMLGQDPF-PVQNETYDIVVIVGALSVGQVPVAVLRELWQVTKPGGYVCMTTR 170          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Nematostella
Match: EDO45905 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRY0])

HSP 1 Score: 77.7962 bits (190), Expect = 1.881e-16
Identity = 49/153 (32.03%), Postives = 83/153 (54.25%), Query Frame = 3
Query:  147 VSKFYNNWAASYEQDLANIEGGYHAH----ELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMREEFL 593
            + + Y+NWA +YE D  +   GY AH    ++  + +      +   +R++D G+G+G++G  +++LG+ N+D LD S  ML  AR K +Y N     +   ++  I D  Y  +V SGT   +H+ +  L  L R +K GGII   +R++ L
Sbjct:   22 IRQIYDNWATNYEMDTNS--HGYVAHKTCTDVFDAEMAKAYPKYRLSLRVMDAGAGTGIVGEHLQQLGYTNVDGLDISQEMLNIARQKRVYKNLICAGLSETEIAEIADGQYEGIVCSGTITVAHVKAASLGELRRWLKPGGIICFTIRQDAL 172          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Nematostella
Match: EDO42150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2H3])

HSP 1 Score: 72.7886 bits (177), Expect = 1.075e-14
Identity = 55/154 (35.71%), Postives = 86/154 (55.84%), Query Frame = 3
Query:  114 FLTDNFKNDEYVSKFYNNWAASYEQDLANIEG--GYHAHELLISALLPNLEMFDNK-IRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGII 566
             LT+N   D  V K Y++WA  YE+D+A I G   +H +  ++ + L  L   +++ + I+D G+G+GL+G   K+LG+  IDALD S  ML  A+ KN+Y       +G  K   I  ++Y  L+ +GT    ++ +  L  LI  VK GG+I
Sbjct:   12 LLTENSSPDA-VKKVYDDWALDYEKDIA-IRGFDSHHTYARILDSTLATLFPGNHQSLHILDAGAGTGLMGVSFKRLGYTIIDALDFSQEMLNCAKEKNVYRRLICAPIGEGKHSDISQDNYDVLICTGTLSSPNVRASGLDELIHYVKPGGVI 163          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Nematostella
Match: EDO35583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL24])

HSP 1 Score: 68.1662 bits (165), Expect = 6.386e-13
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 3
Query:  123 DNFKNDEYVSKFYNNWAASYEQDLANIEGGYHAHELL--ISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSK-HLPTLIRTVKKGGIIGIIMREEFL 593
            ++F N + +  +Y+  A  Y++ + +  G Y   E+   I+A     + F    RI+D+GSG+GL    + K GF NIDALD S    E AR KN+Y NY  + +   + ++I D  Y  +   G F   H+T++  +  ++R V+  G++   +RE+ +
Sbjct:   40 NDFDNLKELVSYYDETAIHYDKYVKDARG-YIGPEVAASITAKFLKSQGFSEDCRILDVGSGTGLQAEGLVKHGFTNIDALDPSEKSNEVARKKNLYKNYITDYLEPGRKLNISDGDYDAVACVGVFTKGHVTAEAAMDEMVRVVRAEGLVCFTIREDVM 198          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Nematostella
Match: EDO29865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2F0])

HSP 1 Score: 56.225 bits (134), Expect = 1.039e-8
Identity = 46/134 (34.33%), Postives = 74/134 (55.22%), Query Frame = 3
Query:  174 ASYEQDLANIEG--GYHAHELLISALLPNLEMFDNK-IRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGII 566
            AS  +D+A I G   +H +  ++ + L  L   +++ + I+D G+G+GL+G   K+LG+  IDALD S  ML  A+ KN+Y       +G  K   I  ++Y  L+ +GT    ++ +  L  LI  VK GG+I
Sbjct:  137 ASNPRDIA-IRGFDSHHTYARILDSTLATLFPGNHQSLHILDAGAGTGLMGVSFKRLGYTIIDALDFSQEMLNCAKEKNVYRRLICAPIGEGKHSDISQDNYDVLICTGTLSSPNVRASGLDELIHYVKPGGVI 269          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Medaka
Match: mettl27 (methyltransferase like 27 [Source:NCBI gene;Acc:101164667])

HSP 1 Score: 58.151 bits (139), Expect = 3.394e-9
Identity = 45/179 (25.14%), Postives = 80/179 (44.69%), Query Frame = 3
Query:   45 FVFLKIILLSCHISMEKQSKIESFLTDNFKNDEYVSKFYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            F  +K  +LS H S   + K+                FYN+WA +Y+Q +A ++  Y A  L   ++LP+         ++D+  G+GL+  ++KK GF     +DGS +ML EA+   +Y +     +G E   ++    +  ++  G      +    +  L    K GG+I +  R
Sbjct:    6 FENVKATILSAHESTTPREKV---------------NFYNSWAKNYDQHVAVLD--YRAPTLAADSVLPHFSGSRKSAALLDVACGTGLVAKQMKKHGFELFVGVDGSDAMLNEAKESGLYQDLKQCLLGEEPFPALWAGFFDVVMIVGALSLGQVPVAVVRDLCEAAKPGGLICMTTR 167          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Medaka
Match: mettl27 (methyltransferase like 27 [Source:NCBI gene;Acc:101164667])

HSP 1 Score: 58.151 bits (139), Expect = 3.394e-9
Identity = 45/179 (25.14%), Postives = 80/179 (44.69%), Query Frame = 3
Query:   45 FVFLKIILLSCHISMEKQSKIESFLTDNFKNDEYVSKFYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            F  +K  +LS H S   + K+                FYN+WA +Y+Q +A ++  Y A  L   ++LP+         ++D+  G+GL+  ++KK GF     +DGS +ML EA+   +Y +     +G E   ++    +  ++  G      +    +  L    K GG+I +  R
Sbjct:    6 FENVKATILSAHESTTPREKV---------------NFYNSWAKNYDQHVAVLD--YRAPTLAADSVLPHFSGSRKSAALLDVACGTGLVAKQMKKHGFELFVGVDGSDAMLNEAKESGLYQDLKQCLLGEEPFPALWAGFFDVVMIVGALSLGQVPVAVVRDLCEAAKPGGLICMTTR 167          
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Medaka
Match: mettl27 (methyltransferase like 27 [Source:NCBI gene;Acc:101164667])

HSP 1 Score: 58.151 bits (139), Expect = 3.405e-9
Identity = 45/179 (25.14%), Postives = 80/179 (44.69%), Query Frame = 3
Query:   45 FVFLKIILLSCHISMEKQSKIESFLTDNFKNDEYVSKFYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMR 581
            F  +K  +LS H S   + K+                FYN+WA +Y+Q +A ++  Y A  L   ++LP+         ++D+  G+GL+  ++KK GF     +DGS +ML EA+   +Y +     +G E   ++    +  ++  G      +    +  L    K GG+I +  R
Sbjct:    6 FENVKATILSAHESTTPREKV---------------NFYNSWAKNYDQHVAVLD--YRAPTLAADSVLPHFSGSRKSAALLDVACGTGLVAKQMKKHGFELFVGVDGSDAMLNEAKESGLYQDLKQCLLGEEPFPALWAGFFDVVMIVGALSLGQVPVAVVRDLCEAAKPGGLICMTTR 167          
BLAST of Methyltransf_25 domain-containing protein vs. Planmine SMEST
Match: SMESG000018708.1 (SMESG000018708.1)

HSP 1 Score: 382.104 bits (980), Expect = 2.513e-132
Identity = 211/216 (97.69%), Postives = 215/216 (99.54%), Query Frame = 3
Query:   87 MEKQSKIESFLTDNFKNDEYVSKFYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMREEFLSTCLELRDFQPALQKMSSXXXXXXXXXXXXXXYYNKKPGKIFIFKRL 734
            M+KQSKIESFLTDN KNDEYVSKFYNNWAA+YEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIGSGSGLLG+EIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMREEFLSTCLELRDFQPALQKMSSEN+IEIITENLVENYYNKKPGKIFIFKRL
Sbjct:    1 MQKQSKIESFLTDNSKNDEYVSKFYNNWAAAYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIGSGSGLLGHEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMREEFLSTCLELRDFQPALQKMSSENQIEIITENLVENYYNKKPGKIFIFKRL 216          
BLAST of Methyltransf_25 domain-containing protein vs. Planmine SMEST
Match: SMESG000018166.1 (SMESG000018166.1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.147e-21
Identity = 47/135 (34.81%), Postives = 92/135 (68.15%), Query Frame = 3
Query:  156 FYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGL-EKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKG 557
             YN W+ +Y++DL+  +   +   +++S LL      D   RI+DIG+G+GL+  E++KLG+ NIDAL+ +++M+ +A+ KN+Y+NY+ E +   E + +I++++Y  ++++G F P+HL S+H+  +++ +K G
Sbjct:   29 LYNEWSKTYDEDLS--KPNSYCGFIMVSKLLDLFSFRDKSRRILDIGAGTGLVAEELRKLGYNNIDALESNAAMIAKAKVKNLYLNYYEEFLEPNEPVKTIQEDTYDRIIAAGVFSPAHLDSRHIKPMLKLLKSG 161          
BLAST of Methyltransf_25 domain-containing protein vs. Planmine SMEST
Match: SMESG000018162.1 (SMESG000018162.1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.771e-19
Identity = 48/137 (35.04%), Postives = 93/137 (67.88%), Query Frame = 3
Query:  156 FYNNWAASYEQDLA--NIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGL-EKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKG 557
             YN W+ +Y++DL+  N   G+    +++S LL      D   RI+DIG+G+GL+  E++KLG+ NID+L+ +++M+ +A+ KN+Y+NY+ E +   E + +I++++Y  ++++G F P+HL S+H+  +++ +K G
Sbjct:   29 LYNEWSKTYDEDLSKPNSYCGF----IMVSKLLDLFSFRDKSRRILDIGAGTGLVAEELRKLGYNNIDSLESNAAMIAKAKVKNLYLNYYEEFLEPNEPVKTIQEDTYDRIIAAGVFSPAHLDSRHIKPMLKLLKSG 161          
BLAST of Methyltransf_25 domain-containing protein vs. Planmine SMEST
Match: SMESG000070491.1 (SMESG000070491.1)

HSP 1 Score: 77.411 bits (189), Expect = 4.857e-16
Identity = 66/210 (31.43%), Postives = 112/210 (53.33%), Query Frame = 3
Query:  102 KIESFLTDNFKNDEYVSKFYNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMREEFLSTCLELRDFQPALQKMSSXXXXXXXXXXXXXXYYNKKPGKIFIFKR 731
            KI   L D    D  V   Y NWA +YE+D+   + GY   E+ IS ++ +L   +  ++I+DI +G+GL+  E+KKL + NIDA+D   +ML +A+ KN+Y NYF +  G E     +  +Y  +  +G F  +H+    +  L++  K  G+  ++ R E +S+    ++    + ++ SE  IE+I E  +  YY    G + + KR
Sbjct:    8 KIFDTLYDKTPKDGMVD-LYTNWAETYEKDVVLTDEGYKGFEI-ISKII-DLFSVNKDLKILDIAAGTGLVSQELKKLEYYNIDAMDSCEAMLTKAKVKNLYKNYFCQFAG-EDPNDPKYGTYDHVSIAGGFSKNHMNYTDILKLVKYSKINGLTSLVFRYEAISSY--QKEVPVEIHRLKSEGIIELILETEIPKYYTNVSGYLVVMKR 211          
BLAST of Methyltransf_25 domain-containing protein vs. Planmine SMEST
Match: SMESG000070472.1 (SMESG000070472.1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.371e-13
Identity = 49/147 (33.33%), Postives = 85/147 (57.82%), Query Frame = 3
Query:  159 YNNWAASYEQDLANIEGGYHAHELLISALLPNLEMFDNKIRIIDIXXXXXXXXNEIKKLGFLNIDALDGSSSMLEEARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTLIRTVKKGGIIGIIMREEFLST 599
            Y NWA +YE+D+   + GY   E+ IS ++ +L   +  ++I+DI +G+GL+  E+KKL + NIDA+D   +ML +A+ KN+Y NYF +  G E     +  +Y  +  +G F  +H+    +  L++  K  G+  +  R E +S+
Sbjct:   27 YTNWAETYEKDVVLTDEGYKGFEI-ISKII-DLFSVNKDLKILDIAAGTGLVSQELKKLEYYNIDAMDPCEAMLTKAKVKNLYKNYFCQFAG-EDPNDPKYGTYDHVSIAGGFSKNHMNYTDILKLVKYSKINGLTSLAFRYEAISS 170          
The following BLAST results are available for this feature:
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
METTL272.927e-1230.28methyltransferase like 27 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl274.008e-1226.26methyltransferase like 27 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vegfb5.987e-1029.17vascular endothelial growth factor B [Source:Xenba... [more]
back to top
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mettl272.143e-1529.37methyltransferase like 27 [Source:MGI Symbol;Acc:M... [more]
Mettl273.908e-1529.37methyltransferase like 27 [Source:MGI Symbol;Acc:M... [more]
Mettl273.908e-1529.37methyltransferase like 27 [Source:MGI Symbol;Acc:M... [more]
Mettl273.908e-1529.37methyltransferase like 27 [Source:MGI Symbol;Acc:M... [more]
Mettl273.085e-1133.33methyltransferase like 27 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Methyltransf_25 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8N6F8|MET27_HUMAN1.406e-1130.28Methyltransferase-like protein 27 OS=Homo sapiens ... [more]
back to top
BLAST of Methyltransf_25 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IBM42.976e-3438.60MTS domain-containing protein OS=Macrostomum ligna... [more]
A0A267DEP57.959e-3438.12Methyltransf_25 domain-containing protein OS=Macro... [more]
A0A267EL551.129e-3338.57Methyltransf_25 domain-containing protein OS=Macro... [more]
A0A267DED22.729e-3338.12Methyltransf_25 domain-containing protein OS=Macro... [more]
A0A267FYP08.170e-3335.81MTS domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl276.446e-1128.17methyltransferase like 27 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO459051.881e-1632.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421501.075e-1435.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355836.386e-1330.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298651.039e-834.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Methyltransf_25 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mettl273.394e-925.14methyltransferase like 27 [Source:NCBI gene;Acc:10... [more]
mettl273.394e-925.14methyltransferase like 27 [Source:NCBI gene;Acc:10... [more]
mettl273.405e-925.14methyltransferase like 27 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Methyltransf_25 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018708.12.513e-13297.69SMESG000018708.1[more]
SMESG000018166.14.147e-2134.81SMESG000018166.1[more]
SMESG000018162.11.771e-1935.04SMESG000018162.1[more]
SMESG000070491.14.857e-1631.43SMESG000070491.1[more]
SMESG000070472.11.371e-1333.33SMESG000070472.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001279 ID=SMED30001279|Name=Methyltransf_25 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1475bp
CAACAGCTATGAGATAATTTATTACATCATAATTGTTAACTGAATTCGTA
TTTTTAAAAATAATTTTGTTATCGTGTCATATTTCAATGGAAAAACAATC
AAAAATCGAAAGTTTTTTAACGGATAATTTTAAAAATGATGAATACGTTT
CTAAATTTTACAACAATTGGGCAGCATCTTATGAACAAGATTTGGCTAAT
ATAGAAGGAGGATATCATGCTCACGAATTACTAATTTCAGCATTGTTGCC
AAATCTGGAAATGTTTGATAATAAAATACGAATAATTGACATTGGGTCTG
GATCTGGTTTATTGGGCAATGAAATCAAAAAATTAGGATTTCTGAATATT
GACGCTCTTGATGGTAGTTCTTCAATGCTAGAAGAAGCTAGATCTAAAAA
TATTTATGTTAATTATTTCCATGAAACAGTTGGATTGGAAAAGCTTGTGT
CAATTGAAGATGAATCATACAGTTGTTTAGTTTCATCCGGAACATTCGTA
CCAAGCCATTTAACTTCAAAACATTTACCAACTTTAATTAGAACGGTTAA
GAAAGGTGGAATCATCGGAATAATAATGCGTGAGGAATTCCTGTCCACTT
GTCTGGAGCTCCGAGATTTTCAGCCGGCTTTGCAAAAAATGAGTAGTGAG
AATGAAATTGAAATAATTACCGAAAATTTAGTCGAAAATTACTACAATAA
AAAACCTGGGAAAATATTTATTTTTAAACGACTTTGATGGAATATTAGTT
GTTTTAATTGATAATTAACATAATTTAGATATTAATAATACATTTACAAA
AATATTTTTAAAATTTTAAGTGACCCTGAAAGAAGGTAGTTAAAGTTCAA
TAACTCCTCTGTGACAGTTCTCCATACTGCTGGAAATACCTTAATGAGTG
ATACAGCATCACTGATGCTTAATCTTATCGCTTTGGTCTGTTCCTTCTTT
ATGTTTGTCCCGGTATGATTTATCAACTCCTTGATCTATCTCTCAATTAC
TGTCTTTTACTTTATACAATCCATTCGACAGAGCAATCTCCACTATATAA
ATTATAGATTAAAATTACCTCTCACCCTTTCCAACTCGAGAAATATCGAT
TTCTTTAATAAATCTTGAACTCAATTAATTAATGTTTAATTGTTGATTAA
TTGAATTCAAGGTGAGTAAATCGATATATTGAGATCTGTAGAGAATCGAT
ATAGACAAGATCAGTTTGGAATAAGAACTGAGTTATTTATGACTTAATAT
TTGTGCTCGAGAACTGTAAAAAGTTTAGCTGATAAAAATGGGGTAGTCAA
GGGTTTCCTTGGCAACGGGTGCGTAAATCGACCCGTCGCCCCATGGTTAC
CTTCTAGGACAATGAAATGTTACGGTTTGTTTGTACCTGGAAATCCTGTC
CTCCAATTTAGTATTGATTAATCGGAAAATATGCCGATTGTAATGCAGGG
GATAATCGGTATGCTTATATTACAG
back to top

protein sequence of SMED30001279-orf-1

>SMED30001279-orf-1 ID=SMED30001279-orf-1|Name=SMED30001279-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=217bp
MEKQSKIESFLTDNFKNDEYVSKFYNNWAASYEQDLANIEGGYHAHELLI
SALLPNLEMFDNKIRIIDIGSGSGLLGNEIKKLGFLNIDALDGSSSMLEE
ARSKNIYVNYFHETVGLEKLVSIEDESYSCLVSSGTFVPSHLTSKHLPTL
IRTVKKGGIIGIIMREEFLSTCLELRDFQPALQKMSSENEIEIITENLVE
NYYNKKPGKIFIFKRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR029063SAM-dependent_MTases
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane