SMED30001264

Overview
NameSMED30001264
Smed IDSMED30001264
Length (bp)2705
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30001264 (SMED30001264) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30001264 (SMED30001264) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001264 (SMED30001264) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001264 (SMED30001264) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001264

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30001264SMESG000049231.1 dd_Smed_v4_10048_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001264SMESG000049231.1 dd_Smed_v4_10048_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30001264SMESG000049231.1 dd_Smed_v4_10048_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30001264 vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 62.003 bits (149), Expect = 5.030e-9
Identity = 54/237 (22.78%), Postives = 100/237 (42.19%), Query Frame = 2
Query: 1196 VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            VM  K + M +    Y G+  ++  E+      KY + + P+    A  +D  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P   K+      P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+ 
Sbjct:  428 VMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA 662          
BLAST of SMED30001264 vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 62.003 bits (149), Expect = 5.030e-9
Identity = 54/237 (22.78%), Postives = 100/237 (42.19%), Query Frame = 2
Query: 1196 VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            VM  K + M +    Y G+  ++  E+      KY + + P+    A  +D  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P   K+      P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+ 
Sbjct:  428 VMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA 662          
BLAST of SMED30001264 vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 61.6178 bits (148), Expect = 5.615e-9
Identity = 54/237 (22.78%), Postives = 100/237 (42.19%), Query Frame = 2
Query: 1196 VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            VM  K + M +    Y G+  ++  E+      KY + + P+    A  +D  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P   K+      P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+ 
Sbjct:  428 VMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA 662          
BLAST of SMED30001264 vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 61.6178 bits (148), Expect = 5.615e-9
Identity = 54/237 (22.78%), Postives = 100/237 (42.19%), Query Frame = 2
Query: 1196 VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            VM  K + M +    Y G+  ++  E+      KY + + P+    A  +D  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P   K+      P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+ 
Sbjct:  428 VMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA 662          
BLAST of SMED30001264 vs. Ensembl Human
Match: GRID2 (glutamate ionotropic receptor delta type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4576])

HSP 1 Score: 58.5362 bits (140), Expect = 5.949e-8
Identity = 61/244 (25.00%), Postives = 110/244 (45.08%), Query Frame = 2
Query: 1157 LNLNNSAVTVRIGVMLSKGYFMQKS-----PGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSD--YDLLNSLIQLNQADIILIPMVIKYITP----VADFSDSVLTMSIN-MLTRSPNSILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDI 1849
            L  N   V +R+  +L + + M        P  Y GFS ++++ + N   F Y +YV P++   +   D  ++ L   +   +ADI +  + I   TP    V DF+   +  S+  +L R+  ++     L+PF  ++W  I   +LL+ L  + ++ L+PP +   +      Y     +  +Y SFV    +V     ++++     W   L +I +YTANL  +L  T    S    QD+
Sbjct:  353 LENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTI---TPDRENVVDFTTRYMDYSVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYN---SMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDL 590          
BLAST of SMED30001264 vs. Ensembl Fly
Match: PNPase (gene:FBgn0039846 transcript:FBtr0085812)

HSP 1 Score: 52.7582 bits (125), Expect = 1.325e-6
Identity = 25/73 (34.25%), Postives = 40/73 (54.79%), Query Frame = 2
Query: 2429 GKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCK 2647
            G  Y AK++ + + GV   +     P  +H S L  D R+   P  L ++ G  IQ+KYFG+DP++G+ R  +
Sbjct:  678 GGIYTAKITELRDTGVMVILYPSMPPALLHNSQL--DQRKIAHPSALNLEVGQEIQVKYFGRDPVSGFMRLSR 748          
BLAST of SMED30001264 vs. Ensembl Fly
Match: PNPase (gene:FBgn0039846 transcript:FBtr0085811)

HSP 1 Score: 52.7582 bits (125), Expect = 1.325e-6
Identity = 25/73 (34.25%), Postives = 40/73 (54.79%), Query Frame = 2
Query: 2429 GKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCK 2647
            G  Y AK++ + + GV   +     P  +H S L  D R+   P  L ++ G  IQ+KYFG+DP++G+ R  +
Sbjct:  678 GGIYTAKITELRDTGVMVILYPSMPPALLHNSQL--DQRKIAHPSALNLEVGQEIQVKYFGRDPVSGFMRLSR 748          
BLAST of SMED30001264 vs. Ensembl Fly
Match: PNPase (gene:FBgn0039846 transcript:FBtr0300881)

HSP 1 Score: 52.7582 bits (125), Expect = 1.325e-6
Identity = 25/73 (34.25%), Postives = 40/73 (54.79%), Query Frame = 2
Query: 2429 GKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCK 2647
            G  Y AK++ + + GV   +     P  +H S L  D R+   P  L ++ G  IQ+KYFG+DP++G+ R  +
Sbjct:  678 GGIYTAKITELRDTGVMVILYPSMPPALLHNSQL--DQRKIAHPSALNLEVGQEIQVKYFGRDPVSGFMRLSR 748          
BLAST of SMED30001264 vs. Ensembl Fly
Match: PNPase (gene:FBgn0039846 transcript:FBtr0334553)

HSP 1 Score: 52.7582 bits (125), Expect = 1.325e-6
Identity = 25/73 (34.25%), Postives = 40/73 (54.79%), Query Frame = 2
Query: 2429 GKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCK 2647
            G  Y AK++ + + GV   +     P  +H S L  D R+   P  L ++ G  IQ+KYFG+DP++G+ R  +
Sbjct:  678 GGIYTAKITELRDTGVMVILYPSMPPALLHNSQL--DQRKIAHPSALNLEVGQEIQVKYFGRDPVSGFMRLSR 748          
BLAST of SMED30001264 vs. Ensembl Fly
Match: Ir76b (gene:FBgn0036937 transcript:FBtr0074869)

HSP 1 Score: 51.2174 bits (121), Expect = 3.987e-6
Identity = 73/286 (25.52%), Postives = 128/286 (44.76%), Query Frame = 2
Query: 1238 VYYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL-NQADIILIPMVIKYITPVADF---SDSVLTMS--INMLTRSPNSILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIIT-YTANLVPYLMKTNATYSFGKAQDIVDNINTSSNNIYVFVKNSIDLNLIALDPTLSQLYNRSISMNPLATFVDDISSEKALETNNAILIQSSI-KNGYIY 2071
            V +G S +I++ +    NF Y  V P +    S SD+D   SLI++ N + + L    I  ++    F   S + L     I ++ R   S      L+PF + VW+ I++ +L +    +A+  L         Q    PY+ G C   +Y + +     +  +  S+++  F  W+  +TI+ + YTANL  +L  +  T  +    DI+    T + +        ++  +   + +LS L NR I  N  A F D        ETN+   +Q+ + KNGY++
Sbjct:  107 VGHGVSFQIIDFLKKKFNFTYEVVVPQDNIIGSPSDFD--RSLIEMVNSSTVDLAAAFIPSLSDQRSFVYYSTTTLDEGEWIMVMQRPRESASGSGLLAPFEFWVWILILVSLLAVGPIIYALIILRNRLTGDGQQT---PYSLGHCAWFVYGALMKQGSTLSPIADSTRLL-FATWWIFITILTSFYTANLTAFLTLSKFTLPYNTVNDIL----TKNKHFVSMRGGGVEYAIRTTNESLSML-NRMIQNN-YAVFSD--------ETNDTYNLQNYVEKNGYVF 372          
BLAST of SMED30001264 vs. Ensembl Zebrafish
Match: grid2 (glutamate receptor, ionotropic, delta 2 [Source:NCBI gene;Acc:448841])

HSP 1 Score: 65.855 bits (159), Expect = 2.169e-10
Identity = 68/284 (23.94%), Postives = 126/284 (44.37%), Query Frame = 2
Query: 1157 LNLNNSAVTVRIGVMLSKGYFMQKS-----PGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSD--YDLLNSLIQLNQADIILIPMVIKYITP----VADFSDSVLTMSINMLTRSPNSILSL-VTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTS-----SNNIYVFVKNSIDLNLIALDPTLSQLYN 1954
            L  N   V +R+  +L + + M        P  Y GFS ++++ + N   FKY +YV P++   +  +D  ++ L   +   +AD+ L  + I   TP    V DF+   +  S+ +L R     + +   L+PF  ++W  I   +LL+    + ++ L+PP +   +      Y     +  +Y SFV    +V     ++++   + W   L +I +YTANL  +L  +    S    QD+    +        + +Y  V+ S  +N    DP  SQ++ 
Sbjct:  353 LENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALANYLGFKYEIYVAPDHKYGSQQADGTWNGLIGELVFKRADVGLSALTI---TPERESVVDFTTRYMDYSVGVLLRKAERTVDMFACLAPFDLSLWACIAGTVLLVGTLVYLLNWLNPPRLPMGSVSSTTLYN---SMWFVYGSFVQQGGEVPYTTLATRMMMGVWWLFALIVISSYTANLAAFLTISRIENSIQSLQDLAKQTDLPYGTVLDSAVYDQVR-SKGMNPFERDPMYSQMWR 629          
BLAST of SMED30001264 vs. Ensembl Zebrafish
Match: grid2 (glutamate receptor, ionotropic, delta 2 [Source:NCBI gene;Acc:448841])

HSP 1 Score: 65.4698 bits (158), Expect = 2.603e-10
Identity = 68/284 (23.94%), Postives = 126/284 (44.37%), Query Frame = 2
Query: 1157 LNLNNSAVTVRIGVMLSKGYFMQKS-----PGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSD--YDLLNSLIQLNQADIILIPMVIKYITP----VADFSDSVLTMSINMLTRSPNSILSL-VTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTS-----SNNIYVFVKNSIDLNLIALDPTLSQLYN 1954
            L  N   V +R+  +L + + M        P  Y GFS ++++ + N   FKY +YV P++   +  +D  ++ L   +   +AD+ L  + I   TP    V DF+   +  S+ +L R     + +   L+PF  ++W  I   +LL+    + ++ L+PP +   +      Y     +  +Y SFV    +V     ++++   + W   L +I +YTANL  +L  +    S    QD+    +        + +Y  V+ S  +N    DP  SQ++ 
Sbjct:  382 LENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALANYLGFKYEIYVAPDHKYGSQQADGTWNGLIGELVFKRADVGLSALTI---TPERESVVDFTTRYMDYSVGVLLRKAERTVDMFACLAPFDLSLWACIAGTVLLVGTLVYLLNWLNPPRLPMGSVSSTTLYN---SMWFVYGSFVQQGGEVPYTTLATRMMMGVWWLFALIVISSYTANLAAFLTISRIENSIQSLQDLAKQTDLPYGTVLDSAVYDQVR-SKGMNPFERDPMYSQMWR 658          
BLAST of SMED30001264 vs. Ensembl Zebrafish
Match: grid2 (glutamate receptor, ionotropic, delta 2 [Source:NCBI gene;Acc:448841])

HSP 1 Score: 65.0846 bits (157), Expect = 3.147e-10
Identity = 68/284 (23.94%), Postives = 126/284 (44.37%), Query Frame = 2
Query: 1157 LNLNNSAVTVRIGVMLSKGYFMQKS-----PGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSD--YDLLNSLIQLNQADIILIPMVIKYITP----VADFSDSVLTMSINMLTRSPNSILSL-VTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTS-----SNNIYVFVKNSIDLNLIALDPTLSQLYN 1954
            L  N   V +R+  +L + + M        P  Y GFS ++++ + N   FKY +YV P++   +  +D  ++ L   +   +AD+ L  + I   TP    V DF+   +  S+ +L R     + +   L+PF  ++W  I   +LL+    + ++ L+PP +   +      Y     +  +Y SFV    +V     ++++   + W   L +I +YTANL  +L  +    S    QD+    +        + +Y  V+ S  +N    DP  SQ++ 
Sbjct:  434 LENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALANYLGFKYEIYVAPDHKYGSQQADGTWNGLIGELVFKRADVGLSALTI---TPERESVVDFTTRYMDYSVGVLLRKAERTVDMFACLAPFDLSLWACIAGTVLLVGTLVYLLNWLNPPRLPMGSVSSTTLYN---SMWFVYGSFVQQGGEVPYTTLATRMMMGVWWLFALIVISSYTANLAAFLTISRIENSIQSLQDLAKQTDLPYGTVLDSAVYDQVR-SKGMNPFERDPMYSQMWR 710          
BLAST of SMED30001264 vs. Ensembl Zebrafish
Match: gria4b (glutamate receptor, ionotropic, AMPA 4b [Source:ZFIN;Acc:ZDB-GENE-030131-8013])

HSP 1 Score: 58.9214 bits (141), Expect = 2.473e-8
Identity = 67/307 (21.82%), Postives = 125/307 (40.72%), Query Frame = 2
Query: 1034 FDKVTNKFNGTILKVIQANNFPNQIYTYTNNLSL-FNSDQVIL-----NLNNSAV---TVRIG--VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKK--------IKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNIN 1864
            FD    + N T+      +N P +I  + +   L    D  +L      + N  V   T+  G  VML K + M +    Y G+  ++  E+     FKY + + P+    A   +  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP     +  ++          P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+    +
Sbjct:  363 FDHYGRRVNYTMDVFELKSNGPRRIGYWNDADKLVLTQDHALLPNETSGMENRTVIVTTIMEGPYVMLKKNWEMYEGNEQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTD 667          
BLAST of SMED30001264 vs. Ensembl Zebrafish
Match: gria4b (glutamate receptor, ionotropic, AMPA 4b [Source:ZFIN;Acc:ZDB-GENE-030131-8013])

HSP 1 Score: 58.9214 bits (141), Expect = 2.572e-8
Identity = 67/309 (21.68%), Postives = 126/309 (40.78%), Query Frame = 2
Query: 1034 FDKVTNKFNGTILKVIQANNFPNQIYTYTNNLSL-FNSDQVIL-----NLNNSAV---TVRIG--VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKK--------IKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTS 1870
            FD    + N T+      +N P +I  + +   L    D  +L      + N  V   T+  G  VML K + M +    Y G+  ++  E+     FKY + + P+    A   +  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP     +  ++          P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+    + +
Sbjct:  363 FDHYGRRVNYTMDVFELKSNGPRRIGYWNDADKLVLTQDHALLPNETSGMENRTVIVTTIMEGPYVMLKKNWEMYEGNEQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIA 669          
BLAST of SMED30001264 vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 57.3806 bits (137), Expect = 1.173e-7
Identity = 54/224 (24.11%), Postives = 102/224 (45.54%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNS----ILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP------------PAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            + G+  ++++E+ NI  F Y      +    + +D    N +++    ++AD+ + P+ I Y+   V DFS   +T+ I++L R PN     + S   L+P + ++W+ ++L  L ++   + ++  +P              V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A D+ 
Sbjct:  440 FEGYCLDLLKELSNILGFTYEVRLVVDGKYGAQNDKGEWNGMVRELIDHKADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSF--LNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPK------ALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLA 655          
BLAST of SMED30001264 vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 57.3806 bits (137), Expect = 1.271e-7
Identity = 54/224 (24.11%), Postives = 102/224 (45.54%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNS----ILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP------------PAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            + G+  ++++E+ NI  F Y      +    + +D    N +++    ++AD+ + P+ I Y+   V DFS   +T+ I++L R PN     + S   L+P + ++W+ ++L  L ++   + ++  +P              V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A D+ 
Sbjct:  450 FEGYCLDLLKELSNILGFTYEVRLVVDGKYGAQNDKGEWNGMVRELIDHKADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSF--LNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPK------ALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLA 665          
BLAST of SMED30001264 vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 57.3806 bits (137), Expect = 1.277e-7
Identity = 54/224 (24.11%), Postives = 102/224 (45.54%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNS----ILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP------------PAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            + G+  ++++E+ NI  F Y      +    + +D    N +++    ++AD+ + P+ I Y+   V DFS   +T+ I++L R PN     + S   L+P + ++W+ ++L  L ++   + ++  +P              V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A D+ 
Sbjct:  433 FEGYCLDLLKELSNILGFTYEVRLVVDGKYGAQNDKGEWNGMVRELIDHKADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSF--LNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPK------ALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLA 648          
BLAST of SMED30001264 vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 56.9954 bits (136), Expect = 1.295e-7
Identity = 54/224 (24.11%), Postives = 102/224 (45.54%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNS----ILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP------------PAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            + G+  ++++E+ NI  F Y      +    + +D    N +++    ++AD+ + P+ I Y+   V DFS   +T+ I++L R PN     + S   L+P + ++W+ ++L  L ++   + ++  +P              V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A D+ 
Sbjct:  433 FEGYCLDLLKELSNILGFTYEVRLVVDGKYGAQNDKGEWNGMVRELIDHKADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSF--LNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPK------ALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLA 648          
BLAST of SMED30001264 vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 56.9954 bits (136), Expect = 1.408e-7
Identity = 54/224 (24.11%), Postives = 102/224 (45.54%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNS----ILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP------------PAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            + G+  ++++E+ NI  F Y      +    + +D    N +++    ++AD+ + P+ I Y+   V DFS   +T+ I++L R PN     + S   L+P + ++W+ ++L  L ++   + ++  +P              V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A D+ 
Sbjct:  389 FEGYCLDLLKELSNILGFTYEVRLVVDGKYGAQNDKGEWNGMVRELIDHKADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSF--LNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPK------ALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLA 604          
BLAST of SMED30001264 vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 62.003 bits (149), Expect = 2.885e-9
Identity = 54/237 (22.78%), Postives = 100/237 (42.19%), Query Frame = 2
Query: 1196 VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            VM  K + M +    Y G+  ++  E+      KY + + P+    A  +D  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P   K+      P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+ 
Sbjct:  428 VMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA 662          
BLAST of SMED30001264 vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 62.003 bits (149), Expect = 2.885e-9
Identity = 54/237 (22.78%), Postives = 100/237 (42.19%), Query Frame = 2
Query: 1196 VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            VM  K + M +    Y G+  ++  E+      KY + + P+    A  +D  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P   K+      P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+ 
Sbjct:  428 VMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA 662          
BLAST of SMED30001264 vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 61.6178 bits (148), Expect = 3.790e-9
Identity = 54/237 (22.78%), Postives = 100/237 (42.19%), Query Frame = 2
Query: 1196 VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            VM  K + M +    Y G+  ++  E+      KY + + P+    A  +D  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P   K+      P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+ 
Sbjct:  428 VMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA 662          
BLAST of SMED30001264 vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 58.151 bits (139), Expect = 4.654e-8
Identity = 57/225 (25.33%), Postives = 105/225 (46.67%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNS----ILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP------------PAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            + G+  ++++E+ NI  F Y V + P+    A  +D    N +++    ++AD+ + P+ I Y+   V DFS   +T+ I++L R PN     + S   L+P + ++W+ ++L  L ++   + ++  +P              V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A D+ 
Sbjct:  460 FEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSF--LNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPK------ALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLA 675          
BLAST of SMED30001264 vs. Ensembl Mouse
Match: Grik3 (glutamate receptor, ionotropic, kainate 3 [Source:MGI Symbol;Acc:MGI:95816])

HSP 1 Score: 58.151 bits (139), Expect = 4.790e-8
Identity = 53/224 (23.66%), Postives = 102/224 (45.54%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITPVA-DFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP------------PAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            + G+  ++++E+ +I  F Y      +    +  D    N +++    ++AD+ + P+ I ++   A DFS   +T+ +++L R PN    S+ S   L+P + ++W+ ++L  L ++   + ++  SP              V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A D+ 
Sbjct:  462 FEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSF--LNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKAL------STRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLA 677          
BLAST of SMED30001264 vs. UniProt/SwissProt
Match: sp|Q68Y21|GRID2_DANRE (Glutamate receptor ionotropic, delta-2 OS=Danio rerio OX=7955 GN=grid2 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.316e-9
Identity = 68/284 (23.94%), Postives = 126/284 (44.37%), Query Frame = 2
Query: 1157 LNLNNSAVTVRIGVMLSKGYFMQKS-----PGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSD--YDLLNSLIQLNQADIILIPMVIKYITP----VADFSDSVLTMSINMLTRSPNSILSL-VTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTS-----SNNIYVFVKNSIDLNLIALDPTLSQLYN 1954
            L  N   V +R+  +L + + M        P  Y GFS ++++ + N   FKY +YV P++   +  +D  ++ L   +   +AD+ L  + I   TP    V DF+   +  S+ +L R     + +   L+PF  ++W  I   +LL+    + ++ L+PP +   +      Y     +  +Y SFV    +V     ++++   + W   L +I +YTANL  +L  +    S    QD+    +        + +Y  V+ S  +N    DP  SQ++ 
Sbjct:  434 LENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALANYLGFKYEIYVAPDHKYGSQQADGTWNGLIGELVFKRADVGLSALTI---TPERESVVDFTTRYMDYSVGVLLRKAERTVDMFACLAPFDLSLWACIAGTVLLVGTLVYLLNWLNPPRLPMGSVSSTTLYN---SMWFVYGSFVQQGGEVPYTTLATRMMMGVWWLFALIVISSYTANLAAFLTISRIENSIQSLQDLAKQTDLPYGTVLDSAVYDQVR-SKGMNPFERDPMYSQMWR 710          
BLAST of SMED30001264 vs. UniProt/SwissProt
Match: sp|P19493|GRIA4_RAT (Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.901e-8
Identity = 54/237 (22.78%), Postives = 100/237 (42.19%), Query Frame = 2
Query: 1196 VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            VM  K + M +    Y G+  ++  E+      KY + + P+    A  +D  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P   K+      P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+ 
Sbjct:  428 VMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA 662          
BLAST of SMED30001264 vs. UniProt/SwissProt
Match: sp|Q38PU5|GRIA4_MACFA (Glutamate receptor 4 OS=Macaca fascicularis OX=9541 GN=GRIA4 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.198e-8
Identity = 54/237 (22.78%), Postives = 100/237 (42.19%), Query Frame = 2
Query: 1196 VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            VM  K + M +    Y G+  ++  E+      KY + + P+    A  +D  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P   K+      P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+ 
Sbjct:  428 VMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA 662          
BLAST of SMED30001264 vs. UniProt/SwissProt
Match: sp|Q9Z2W8|GRIA4_MOUSE (Glutamate receptor 4 OS=Mus musculus OX=10090 GN=Gria4 PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 2.651e-8
Identity = 54/237 (22.78%), Postives = 100/237 (42.19%), Query Frame = 2
Query: 1196 VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            VM  K + M +    Y G+  ++  E+      KY + + P+    A  +D  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P   K+      P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+ 
Sbjct:  428 VMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA 662          
BLAST of SMED30001264 vs. UniProt/SwissProt
Match: sp|P48058|GRIA4_HUMAN (Glutamate receptor 4 OS=Homo sapiens OX=9606 GN=GRIA4 PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 2.697e-8
Identity = 54/237 (22.78%), Postives = 100/237 (42.19%), Query Frame = 2
Query: 1196 VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            VM  K + M +    Y G+  ++  E+      KY + + P+    A  +D  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P   K+      P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+ 
Sbjct:  428 VMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA 662          
BLAST of SMED30001264 vs. TrEMBL
Match: A0A0X3PEC1 (Polyribonucleotide nucleotidyltransferase 1 OS=Schistocephalus solidus OX=70667 GN=PNPT1 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.855e-13
Identity = 91/420 (21.67%), Postives = 181/420 (43.10%), Query Frame = 2
Query: 1400 PMVIKYITPVADFSDSVLTMSINMLTRSPNSILSLV-TLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKI--KPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTSSNNIYVFVKNSIDLNLIALDPTLSQLYNRSISMNPLATFVDDISSEKALETNNAILIQSSIKNGYIYNSINCTSDMMRGTDTQYPMAFAINRNFKQKEEMRSLIRNLVLTGVLSGSSIIYFGKGPCARTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMLINKCCRCIKNS-NREPFIMGKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCK 2647
            P+++   +     S  VL     +L R P+     +  L PF+  VWL  +L   +  +        +P  + +  + ++  K   F    L + S+F +AKL++     SS++F   +W   + +I+ Y+ +++  L++ ++        D    I  +S N  + +KN I  + +A     + L +   ++N L     D +  K +   N +L+ S I+  Y+  +      +   + +Q  + F I+  ++  +++ + +     +GVL  +S IYF  G C                +            L+ G+    L + I    R  K+  ++   I G+ Y+A V+S++  GV  TI    +P++I  + L PD  + Y   ++ +  G  IQL +FG+   +G   FC+
Sbjct:  536 PIIVNASSLAVRSSGLVLPTDFFLLHRKPSPAPDFILILRPFSMPVWLTSVLAGAIFAVILAVYGHFTPSILKRLAEGEVDSKRSVFEVASLGVVSAFSVAKLQIIPSHLSSRMFTLFMWLFVILLIVIYSGSMMTILLRVHS--PMDSYSDPYALIAATSANDLMLIKNGIGYDTLAASLQNNSLVSGYTTVNSL-----DEAFAKLIGDENKVLLASWIETSYMSTNSCDLEAIPYPSVSQVLLTFPISSYWEFADDINAYLLGTSSSGVLEVASTIYFETGRC-----FIPSFKVAEPTVLDIGGAASLFLLLLVGLIVSFLCLGIEIAIRRFKHKRDQATLIFGQTYNATVTSLKKTGVTVTIAGLPKPFFIPNNQLHPDPLKVYNALDIGLSVGSEIQLTFFGESKKDGTSTFCR 943          
BLAST of SMED30001264 vs. TrEMBL
Match: A0A0X3NVQ4 (Polyribonucleotide nucleotidyltransferase 1 OS=Schistocephalus solidus OX=70667 GN=PNPT1 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.767e-13
Identity = 91/420 (21.67%), Postives = 181/420 (43.10%), Query Frame = 2
Query: 1400 PMVIKYITPVADFSDSVLTMSINMLTRSPNSILSLV-TLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKI--KPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTSSNNIYVFVKNSIDLNLIALDPTLSQLYNRSISMNPLATFVDDISSEKALETNNAILIQSSIKNGYIYNSINCTSDMMRGTDTQYPMAFAINRNFKQKEEMRSLIRNLVLTGVLSGSSIIYFGKGPCARTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMLINKCCRCIKNS-NREPFIMGKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCK 2647
            P+++   +     S  VL     +L R P+     +  L PF+  VWL  +L   +  +        +P  + +  + ++  K   F    L + S+F +AKL++     SS++F   +W   + +I+ Y+ +++  L++ ++        D    I  +S N  + +KN I  + +A     + L +   ++N L     D +  K +   N +L+ S I+  Y+  +      +   + +Q  + F I+  ++  +++ + +     +GVL  +S IYF  G C                +            L+ G+    L + I    R  K+  ++   I G+ Y+A V+S++  GV  TI    +P++I  + L PD  + Y   ++ +  G  IQL +FG+   +G   FC+
Sbjct:  535 PIIVNASSLAVRSSGLVLPTDFFLLHRKPSPAPDFILILRPFSMPVWLTSVLAGAIFAVILAVYGHFTPSILKRLAEGEVDSKRSVFEVASLGVVSAFSVAKLQIIPSHLSSRMFTLFMWLFVILLIVIYSGSMMTILLRVHS--PMDSYSDPYALIAATSANDLMLIKNGIGYDTLAASLQNNSLVSGYTTVNSL-----DEAFAKLIGDENKVLLASWIETSYMSTNSCDLEAIPYPSVSQVLLTFPISSYWEFADDINAYLLGTSSSGVLEVASTIYFETGRC-----FIPSFKVAEPTVLDIGGAASLFLLLLVGLIVSFLCLGIEIAIRRFKHKRDQATLIFGQTYNATVTSLKKTGVTVTIAGLPKPFFIPNNQLHPDPLKVYNALDIGLSVGSEIQLTFFGESKKDGTSTFCR 942          
BLAST of SMED30001264 vs. TrEMBL
Match: A0A267EW41 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026429g1 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.227e-11
Identity = 71/246 (28.86%), Postives = 123/246 (50.00%), Query Frame = 2
Query: 1217 FMQKSPGVYYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQLNQADIILIPMV-----IKYITPVADFSDSVLTMSINMLTRSPNSILSLVT-LSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTSSNNIY-VFVKNSIDLNLIALDP 1933
            F   SP  YYGFS       I++ N     +F  +V   +  + DLL  L++    D+I  PM      IK  + V+  S  ++  S++ +  + +  LS ++ L PF+WNVWL +++  ++L+   +++  +SP      N  +   ++    +  +YSSF+M+KL  K ++PSS++F  ILWF++L    TY  N    L+++N    F      +D +   S   Y V V+NS    ++A  P
Sbjct:   32 FTMASPTEYYGFS-------ISVLNHLSAGLFEWDVVPVA-ENGDLL-PLLRQGAGDLIANPMQMPLDNIKNDSNVSYSSWPLMYTSVSAMGYAESPKLSFLSPLFPFSWNVWLAVVVAFVILSATLYSIDKISP------NDYRRPKFSISESVFFVYSSFMMSKLSAKAIKPSSRIFILILWFASLMYCTTYGTNAFFLLIRSNRALPFTS----LDGLYNQSGRYYRVLVENSTSSGILAAQP 258          
BLAST of SMED30001264 vs. TrEMBL
Match: A0A0R3T0I6 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS331 PE=4 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 2.821e-11
Identity = 111/506 (21.94%), Postives = 219/506 (43.28%), Query Frame = 2
Query: 1181 TVRIGVMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQLNQADIILIPMV---IKYITPVADFSDSVLTMSINMLT---RSPNSILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKI--KPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTSSNNIYVFVKNSIDLNLIALDPTLSQLYNRSISMNPLATF--VDDISSE--KALETNNAILIQSSIKNGYIYNSINCTSDMMRGTDT-QYPMAFAINRNFKQKEEMRSLIRNLVLTGVLSGSSIIYFGKGPCARTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMLINKCCRCIKNSNREPFIMGKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCKDFSE 2659
            T+R+G+     +F   +     GFS  ++ ++ N     Y   F N   +  +  Y  +   I  N+ D  + PM    +K    +A  S + LT+S  +L    R P  +L  + L P    VWLG   +  +          L P  +    + ++  K   FG   L + SSF + KL++     SS++FA  +W  +  +++ Y + ++  +++     +   A D  D ++ S  +  + +KN I  + I    T SQ            TF  VD I +   + +++   +L+ +SI+  YI +S++C  + +  T+     + F  N  ++        +  +   G  S ++ +YF  GPC      N+P    L L     +++  + G++    F+  ++LI +  +   +  +   + G  Y A + S++ +G++  +  R    +I  S L     + Y   +L +  G++I+++YFGK      + FC+ + E
Sbjct:  777 TIRVGIAAYPPFFNNGT-----GFSTSVLSKLTNTAGIHYAITFYNATPDRPY--YAAMEEAIIKNEIDAGITPMPLVGVKNENMIA--SQASLTISYTLLRQHQRRPTDLL--LILRPLAMPVWLGSCFLAFIFAGLLMLFGHLKPVIMRNLAEGEMITKTDLFGVSSLGVASSFTLTKLQIIPTTLSSRLFALTMWLFSYLLLVLYASAMMTIMLRVQKPINDDIAVD--DVLHPSKCDSIIVLKNGIAYDQIVTSLTNSQ-----------RTFLTVDSIQTAYNELMKSKRTVLLATSIEASYI-SSMDCGLEQIAYTEIYDSLLVFPYNSGWEFGSAFNEYLAIIDGAGAFSKAAAVYFETGPCYHPP-YNIPLPVVLELNDAASIYIFLLIGIIVSFIFLGFELLIKRREKAKLSKEQWALVPGMRYPAIIVSMKRNGIYVKVADRPDTVFIPNSQLYSSPLKVYNAIDLGLSEGELIEVQYFGKGADQVSELFCRYYPE 1256          
BLAST of SMED30001264 vs. TrEMBL
Match: A0A564ZD62 (S1 motif domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14508 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.392e-11
Identity = 112/509 (22.00%), Postives = 208/509 (40.86%), Query Frame = 2
Query: 1172 SAVTVRIGVMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQLNQADIILIPMVIKYITPVADFSDSVLTMSINMLT----------RSPNSILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKI--KPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTSSNNIYVFVKNSIDLNLIALDPTLSQLYNRSISMNPLATFVDDISSE--KALETNNAILIQSSIKNGYIYNSINCTSDMMRGTDT-QYPMAFAINRNFKQKEEMRSLIRNLVLTGVLSGSSIIYFGKGPCARTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMLINKCCRCIKNSNREPFIM--GKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCK 2647
            S   +R+G+     +F         GFS  I+ ++       Y   F N   +  +  Y  +   I  N+ D  L PM      P+    +  +T S   LT          R P+  L  + L P    VWL    +  +          L P  +    + ++  K   FG   L + SSF + KL++     SS++FA I+W  +  +++ Y + ++  L++     +     D  D ++ +  +  + +KN      IA D  ++ L     S  P    VDDI +   + +++   +L+ SSI+  YI + ++C  + +  T+   + + F  N  ++        +  +   GV S ++ +YF  GPC          +      +  I   L VG LV  +   +   L +   R     ++E  I+  G+ Y A + S++ +G++  +       +I  S L PD  + Y   +L +  G+ I++ YFGK+     + FC+
Sbjct:  463 SGRIIRVGITKYPPFFNNGD-----GFSVPILSKLATAAGIHYTTTFYNATPDKPY--YAAMEEAIIKNEIDAGLTPM------PMVAVQNGNVTASHGSLTISYILLRQRQRRPSDYL--LILRPLAMPVWLASCFLAFIFAGLLMLFGHLKPVIMRNLAEGEMITKTDLFGVSSLGVASSFSLTKLQIIPTTLSSRIFALIMWLFSYLLLVLYASAMMTILLRIQKPINDDITVD--DVLHPTKCDSLIVLKNG-----IAYDQIVTFLTESQRSFTP----VDDIQTAYNELMKSQKTVLLASSIEASYI-SVMDCELEKIPYTEAYDFLVVFPYNSGWEFGSAFNDYLTKMDDGGVFSNAAAVYFETGPCYHPPYKVPLPAVLELGDTTSIYIFLLVGILVSFIFLGIELFLKH---RKDNKLSKEHGILVPGRHYPATIVSMKRNGIYVKVANWPDTVFIPNSQLHPDPLKVYNALDLGLSEGEPIEVVYFGKNADQVTELFCR 941          
BLAST of SMED30001264 vs. Ensembl Cavefish
Match: grid2 (glutamate receptor, ionotropic, delta 2 [Source:NCBI gene;Acc:448841])

HSP 1 Score: 62.3882 bits (150), Expect = 2.118e-9
Identity = 62/249 (24.90%), Postives = 115/249 (46.18%), Query Frame = 2
Query: 1142 SDQVILNLNNSAVTVRIGVMLSKGYFMQKS-----PGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSD--YDLLNSLIQLNQADIILIPMVIKYITP----VADFSDSVLTMSINMLTRSPNSILSL-VTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDI 1849
            SD+ + N N   V +RI  +L + + M        P  Y GFS ++++ + N   FKY +YV P++   +  +D  ++ L   +   +AD+ L  + I   TP    V DF+   +  S+ +L +     + +   L+PF  ++W  I   +LL+    + ++ L+PP +   +      Y     +  +Y SFV    +V     ++++   + W   L +I +YTANL  +L  +    S    QD+
Sbjct:  367 SDRKLEN-NMRGVVLRIVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALANYLGFKYEIYVAPDHKYGSQQADGTWNGLIGELVFKRADVGLSALTI---TPERESVVDFTTRYMDYSVGVLLKKAERTMDMFACLAPFDLSLWACIAGTVLLVGTLVYLLNWLNPPRLPMGSVSSTTLYN---SMWFVYGSFVQQGGEVPYTTLATRMMMGVWWLFALIVISSYTANLAAFLTISRIENSIQSLQDL 608          
BLAST of SMED30001264 vs. Ensembl Cavefish
Match: grik1a (glutamate receptor ionotropic, kainate 1 [Source:NCBI gene;Acc:103038234])

HSP 1 Score: 59.6918 bits (143), Expect = 1.211e-8
Identity = 76/320 (23.75%), Postives = 138/320 (43.12%), Query Frame = 2
Query:  998 NMTNGQLSPYSSFDKVTNKFNGTILKVIQANNFPNQIYTYTN------NLSLFNSDQVILNLNNSAV--TVRIGVMLSKGYFM-QKSPGVYYG------FSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNS----ILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP------------PAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            N T+G    +   D ++ K +GT  +V+       +++T          L+L    +   N+ +S    T+ +  +L   Y M +KS  V YG      +  ++++E+ NI  F Y      +    + +D    N +++    + AD+ + P+ I Y+   V DFS   +T+ I++L R PN     + S   L+P T ++W+ ++L  L ++   + ++  +P              V + N   +    FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A D+ 
Sbjct:  379 NKTDGLRKDFD-LDLISLKEDGTAKRVVDGAARRTKLWTKIGVWNSYSGLNLTEKKENNKNVTDSLANRTLIVTTILENPYVMYKKSDKVLYGNDRFEGYCLDLLKELSNILGFNYEVKLVTDGKYGAQNDKGEWNGMVRELIDHIADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSF--LNPLTPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNASSDVMENNFTLLNSLWFGVAALMRQGSELMPK------ALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDAPIDSADDLA 689          
BLAST of SMED30001264 vs. Ensembl Cavefish
Match: grik1a (glutamate receptor ionotropic, kainate 1 [Source:NCBI gene;Acc:103038234])

HSP 1 Score: 59.6918 bits (143), Expect = 1.339e-8
Identity = 76/320 (23.75%), Postives = 138/320 (43.12%), Query Frame = 2
Query:  998 NMTNGQLSPYSSFDKVTNKFNGTILKVIQANNFPNQIYTYTN------NLSLFNSDQVILNLNNSAV--TVRIGVMLSKGYFM-QKSPGVYYG------FSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNS----ILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP------------PAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            N T+G    +   D ++ K +GT  +V+       +++T          L+L    +   N+ +S    T+ +  +L   Y M +KS  V YG      +  ++++E+ NI  F Y      +    + +D    N +++    + AD+ + P+ I Y+   V DFS   +T+ I++L R PN     + S   L+P T ++W+ ++L  L ++   + ++  +P              V + N   +    FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A D+ 
Sbjct:  379 NKTDGLRKDFD-LDLISLKEDGTAKRVVDGAARRTKLWTKIGVWNSYSGLNLTEKKENNKNVTDSLANRTLIVTTILENPYVMYKKSDKVLYGNDRFEGYCLDLLKELSNILGFNYEVKLVTDGKYGAQNDKGEWNGMVRELIDHIADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSF--LNPLTPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNASSDVMENNFTLLNSLWFGVAALMRQGSELMPK------ALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDAPIDSADDLA 689          
BLAST of SMED30001264 vs. Ensembl Cavefish
Match: gria4b (glutamate receptor 4 [Source:NCBI gene;Acc:103035012])

HSP 1 Score: 59.3066 bits (142), Expect = 1.908e-8
Identity = 68/309 (22.01%), Postives = 126/309 (40.78%), Query Frame = 2
Query: 1034 FDKVTNKFNGTILKVIQANNFPNQIYTYTNNLSL-FNSDQVIL-----NLNNSAV---TVRIG--VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKK--------IKPYTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTS 1870
            FD    + N T+      NN P +I  + +   L    DQ +L      + N  V   T+  G  VML K + M +    Y G+  ++  E+      KY + + P+    A   +  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP     +  ++          P  FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+    + +
Sbjct:  363 FDHYGRRVNYTMDVFELKNNGPRRIGYWNDADKLVLIQDQALLPNETSGMENRTVVVTTIMEGPYVMLKKNWEMYEGNDRYEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGPPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIA 669          
BLAST of SMED30001264 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 57.7658 bits (138), Expect = 5.234e-8
Identity = 59/225 (26.22%), Postives = 102/225 (45.33%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNS----ILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PA-----VSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            + GF  +++ E+ +I  F Y V +  +    A        N L++    ++AD+ + P+ I Y+   V DFS   +T+ I++L R PN     + S   L+P + ++W+ I+L  L ++   + ++  SP       P      V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A D+ 
Sbjct:  460 FEGFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSF--LNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPK------ALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLA 676          
BLAST of SMED30001264 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 5.869e-7
Identity = 49/176 (27.84%), Postives = 81/176 (46.02%), Query Frame = 2
Query: 1376 NQADIILIPMVIKYITPVA-DFSDSVLTMSINMLTRSPNS----ILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP------------PAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            ++AD+ + P+ I Y+   A DFS   +T+ I++L R PN     I S   L+P + ++W+ I+L  L ++   + ++  SP              V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A D+ 
Sbjct:    8 HKADLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGTNPGIFSF--LNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKAL------STRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLA 175          
BLAST of SMED30001264 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009904.1 (pep scaffold:Pmarinus_7.0:GL476672:16428:36105:1 gene:ENSPMAG00000008932.1 transcript:ENSPMAT00000009904.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 9.982e-7
Identity = 27/94 (28.72%), Postives = 44/94 (46.81%), Query Frame = 2
Query: 2366 KMLINKCCRCIKNSNREPFIMGKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCK 2647
            +  I+  C   K+   +    G  Y A ++ + + GV   +     P  +H S L  D RR   P  L ++ G  +Q+KYFG+DP +G  R  +
Sbjct:  611 REFIDNIC---KDDQEQRLEFGAVYTATIAEIRDSGVMVKLYPNMTPVLLHNSQL--DQRRIQHPSALNLEVGQQLQVKYFGRDPTDGRMRLSR 699          
BLAST of SMED30001264 vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 52.373 bits (124), Expect = 5.507e-7
Identity = 54/206 (26.21%), Postives = 83/206 (40.29%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSD---YDLLNSLIQLNQADIILIPMVI-KYITPVADFSDSVLTMSINMLTRSP--NSILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPA----VSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYS 1828
            Y GFS +++E +    NF+Y        S  S  +     L+  L++  +ADI L P+ I      V DFS   L   I M+ + P    +     L PF   +WL  + ++ L++L  W +   SP        K  + +   ++    L    +S +           S +V A   W  TL +I TYTANL  Y        S
Sbjct:   27 YRGFSKDLMELLSRKLNFRYEICISKESSYGSKVEGQWQGLIGELVR-EEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSPQGYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRS 231          
BLAST of SMED30001264 vs. Ensembl Medaka
Match: grid2 (glutamate ionotropic receptor delta type subunit 2 [Source:NCBI gene;Acc:105357943])

HSP 1 Score: 63.5438 bits (153), Expect = 7.663e-10
Identity = 65/249 (26.10%), Postives = 116/249 (46.59%), Query Frame = 2
Query: 1142 SDQVILNLNNSAVTVRIGVMLSKGYFMQKS-----PGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSD--YDLLNSLIQLNQADIILIPMVIKYITP----VADFSDSVLTMSINMLTRSPNSILSL-VTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDI 1849
            SD+ + N N   V +R+  +L + + M        P  Y GFS +I++ + N   FKY +YV P++   +  +D  ++ L   +   +AD+ L  + I   TP    V DF+   +  S+ +L R     + +   L+PF  ++W  I   +LL+ +  + ++ L+PP +   +      Y     +  +Y SFV    +V     ++++   I W   L +I +YTANL  +L  T    S    QD+
Sbjct:  346 SDRKLEN-NMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDILDALSNYLGFKYEIYVAPDHKYGSLQADGQWNGLMGELVFKRADVGLSALTI---TPERESVVDFTTRYMDYSVGVLLRKAERTVDMFACLAPFDLSLWACIAGTVLLVGILVYLLNWLNPPRLPMGSVSSTTLYN---SMWFVYGSFVQQGGEVPYTTLATRMMMGIWWMFALIVISSYTANLAAFLTITRIENSIQSLQDL 587          
BLAST of SMED30001264 vs. Ensembl Medaka
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:NCBI gene;Acc:101170790])

HSP 1 Score: 59.6918 bits (143), Expect = 1.304e-8
Identity = 60/222 (27.03%), Postives = 99/222 (44.59%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNSILS--LVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP----------PA--VSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            + GF  ++++E+  +  F Y      +    S  D    N +I+    ++AD+ + P+ I Y      DFS   ++M I++L R PNS  S     L+P T ++W+ I+L  L ++   + ++  SP          P   V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A DI 
Sbjct:  460 FEGFCIDLLKELAGLLGFTYEIRLVPDGKYGSQDDKGQWNGMIRELIEHRADLAVAPLTITYTREKFIDFSKPFMSMGISILYRKPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSDVVENNFTLLNSFWFGVSSLMQQGSELMPKAL------STRIIGGIWWFFTLIIISSYTANLAAFLTVERMDTPVDSADDIA 675          
BLAST of SMED30001264 vs. Ensembl Medaka
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:NCBI gene;Acc:101170790])

HSP 1 Score: 59.3066 bits (142), Expect = 1.955e-8
Identity = 60/222 (27.03%), Postives = 99/222 (44.59%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNSILS--LVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP----------PA--VSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            + GF  ++++E+  +  F Y      +    S  D    N +I+    ++AD+ + P+ I Y      DFS   ++M I++L R PNS  S     L+P T ++W+ I+L  L ++   + ++  SP          P   V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A DI 
Sbjct:  460 FEGFCIDLLKELAGLLGFTYEIRLVPDGKYGSQDDKGQWNGMIRELIEHRADLAVAPLTITYTREKFIDFSKPFMSMGISILYRKPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSDVVENNFTLLNSFWFGVSSLMQQGSELMPK------ALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDTPVDSADDIA 675          
BLAST of SMED30001264 vs. Ensembl Medaka
Match: gria4b (glutamate receptor 4 [Source:NCBI gene;Acc:101175340])

HSP 1 Score: 58.9214 bits (141), Expect = 2.100e-8
Identity = 69/307 (22.48%), Postives = 125/307 (40.72%), Query Frame = 2
Query: 1034 FDKVTNKFNGTILKVIQANNFPNQI--YTYTNNLSLFNSDQVILN----LNNSAV---TVRIG--VMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVIKYI-TPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP-------PAVSKKNQKKIKP-YTFGF--CLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNIN 1864
            FD    + N T+      NN P +I  +   + L L     ++ N    + N  V   T+  G  VML K + M +    Y G+  ++  E+      KY + + P+    A   +  + N ++      +A+I + P+ I  +   V DFS   +++ I+++ + P      + S   L P  + +W+ I+   + +++  + VS  SP       P      Q   +P   FG    L     +F+     +     S ++   + WF TL II +YTANL  +L           A+D+    +
Sbjct:  301 FDHYGRRVNYTMDVFELKNNGPRRIGYWNDADKLVLIQDSPLLPNDTTGIENRTVIVTTIMEGPYVMLKKNWEMYEGNDQYEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF--LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGQPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTD 605          
BLAST of SMED30001264 vs. Ensembl Medaka
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:NCBI gene;Acc:101170790])

HSP 1 Score: 58.9214 bits (141), Expect = 2.342e-8
Identity = 60/222 (27.03%), Postives = 99/222 (44.59%), Query Frame = 2
Query: 1241 YYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQL---NQADIILIPMVIKYITP-VADFSDSVLTMSINMLTRSPNSILS--LVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSP----------PA--VSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIV 1852
            + GF  ++++E+  +  F Y      +    S  D    N +I+    ++AD+ + P+ I Y      DFS   ++M I++L R PNS  S     L+P T ++W+ I+L  L ++   + ++  SP          P   V + N   +  + FG   L+   S +M K        S+++   I WF TL II +YTANL  +L           A DI 
Sbjct:  422 FEGFCIDLLKELAGLLGFTYEIRLVPDGKYGSQDDKGQWNGMIRELIEHRADLAVAPLTITYTREKFIDFSKPFMSMGISILYRKPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSDVVENNFTLLNSFWFGVSSLMQQGSELMPK------ALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDTPVDSADDIA 637          
BLAST of SMED30001264 vs. Planmine SMEST
Match: SMESG000049231.1 (SMESG000049231.1)

HSP 1 Score: 1564.28 bits (4049), Expect = 0.000e+0
Identity = 837/843 (99.29%), Postives = 838/843 (99.41%), Query Frame = 2
Query:  134 MELFLVQIFLLISFPFNNGQTLTYIIAVQLPYASSLPTNLPSSLQIVNLTLPPMNSLSEMTSTTNSANYDYIVANYSKQWVMWTNQNNIPYLVIPDVVSDIPLPSNVFFATSILQQTLECTNALLTALNASSVVFLDYAPNPQFKNLIMFNNFTQTLIMISNTTTMTDLFVKTLQYNVESFYVVAIPLTETSIIQSLMAEAMVKGQLNPGKNWIFIDSSLNEINSKTLFSPYVNVRGIIYGYNITFVNQSGSSPYLNMLVNDYVLLINSSIFGLSAKPTNKSAQLASANMTNGQLSPYSSFDKVTNKFNGTILKVIQANNFPNQIYTYTNNLSLFNSDQVILNLNNSAVTVRIGVMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQLNQADIILIPMVIKYITPVADFSDSVLTMSINMLTRSPNSILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTSSNNIYVFVKNSIDLNLIALDPTLSQLYNRSISMNPLATFVDDISSEKALETNNAILIQSSIKNGYIYNSINCTSDMMRGTDTQYPMAFAINRNFKQKEEMRSLIRNLVLTGVLSGSSIIYFGKGPCARTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMLINKCCRCIKNSNREPFIMGKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCKDFSEA 2662
            MELFLVQIFLLISFPFNNGQTLTYIIAVQ PYASSLPTNLPSSLQIVNLTLPPMNSLSEMTSTTNSANYDYIVANYSKQWVMWTNQNNIPYLVI DVVSDIPLPSNVFFATSILQQTLECTNALLTALNASSVVFLDYAPNPQFKNLIMFNNFTQTLIMISNTTTMTDLFVKTLQYNVESFYVVAIPLTETSIIQSLMAEAMVKGQL PGKNWIFIDSSLNEINSKTLFSPYVNVRGIIYGYNITFVNQSGSSPYLNMLVNDYVLLINSSIFGLSAKPTNKSAQLASANMTNGQLSPYSSFDKVTNKFNGTILKVIQANNFPNQIYTYTNNLSLFNSDQVILNLNNSAVTVRIGVMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQLNQADIILIPMVIKYITPVADFSDSVLTMSINMLTRS NSILSLVTLSPFTWNVWLGIILIILLLTLGFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTSSNNIYVFVKNSIDLNLIALDPTLSQLYNRSISMNPL TF+DDISSEKALETNNAILIQSSIKNGYIYNSINCTSDMMRGTDTQYPMAFAINRNFKQKEEMRSLIRNLVLTGVLSGSSIIYFGKGPCARTALTNLPSSKPLNLLSLYILFLLPVGGLVFGVGFVVLKMLINKCCRCIKNSNREPFIMGKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCKDFSEA
Sbjct:    1 MELFLVQIFLLISFPFNNGQTLTYIIAVQSPYASSLPTNLPSSLQIVNLTLPPMNSLSEMTSTTNSANYDYIVANYSKQWVMWTNQNNIPYLVISDVVSDIPLPSNVFFATSILQQTLECTNALLTALNASSVVFLDYAPNPQFKNLIMFNNFTQTLIMISNTTTMTDLFVKTLQYNVESFYVVAIPLTETSIIQSLMAEAMVKGQLIPGKNWIFIDSSLNEINSKTLFSPYVNVRGIIYGYNITFVNQSGSSPYLNMLVNDYVLLINSSIFGLSAKPTNKSAQLASANMTNGQLSPYSSFDKVTNKFNGTILKVIQANNFPNQIYTYTNNLSLFNSDQVILNLNNSAVTVRIGVMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKYVYVFPNNVSNASFSDYDLLNSLIQLNQADIILIPMVIKYITPVADFSDSVLTMSINMLTRSSNSILSLVTLSPFTWNVWLGIILIILLLTLGFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVDNINTSSNNIYVFVKNSIDLNLIALDPTLSQLYNRSISMNPLTTFIDDISSEKALETNNAILIQSSIKNGYIYNSINCTSDMMRGTDTQYPMAFAINRNFKQKEEMRSLIRNLVLTGVLSGSSIIYFGKGPCARTALTNLPSSKPLNLLSLYILFLLPVGGLVFGVGFVVLKMLINKCCRCIKNSNREPFIMGKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCKDFSEA 843          
BLAST of SMED30001264 vs. Planmine SMEST
Match: SMESG000043379.1 (SMESG000043379.1)

HSP 1 Score: 62.003 bits (149), Expect = 1.796e-9
Identity = 108/452 (23.89%), Postives = 196/452 (43.36%), Query Frame = 2
Query: 1367 IQLNQADIILIPMVIK--YITPVADFSDSVLTMSINMLTRSPNSILSLVTLS-PFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDI----VDNINTSSNNIYVFVKNSIDLNLIALD------PTLSQLYNRSI-SMNPLATFVDDISSEKALETNNAILIQSSIKNGYIYNSINCTSDMMRGTDTQYPMAFAINRNFKQKEEMRSLIRNLVLTGVLSGSSIIYFGKGPCARTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMLINKCCRCIKNSNREPFIMGKPYDAKVSSVENDGVWATINQ--------RDRPYYIHTSNL---QPDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCK 2647
            + +N +D+I IP++ +  Y+     +S  +  +  ++L +     L+L  L+ PF+  VWL II+ I+ L++  W ++ +SP  ++   QK     T    + ++  SF+MAK+ VK    S+Q+F  ++W  TL +I  Y ANL       + + +F KAQ I    +D + +  N  + F+++S   N + LD       TL  +Y  ++ +   L+   +  +  + L  N    I +   +   Y+  NC+   M        +A+     FK + ++   I  L  TG +      YF  G C+ T                 I  L+ VG +      V+  +L     +C + +       G+ Y AKV+ ++ +GV   I +          R YY+    L   +   R    P +  I  G  + LKY G +P++  + F +
Sbjct:  421 LNMNASDMIGIPVLFEPSYLNRFI-YSQKIFVVPYSILMKQSTKGLNLPRLAEPFSPIVWLVIIVTIIFLSIILWLINLISP-NIADPTQK----LTVSNSIFMVIGSFLMAKMLVKPNMISTQIFYLLIWLITLLLISAYVANL-------SVSIAFQKAQIIKFITIDQLWSEKNIKWTFIQDSYLYNRVMLDMDNNLNTTLVSMYRYAVFNWLNLSVLNESTNIPQFLFNNPDFGILNDAYHNMYYSLRNCSLITMNDASNNISLAYIAQPGFKYQTQLYQQIITLQQTGTIDNLQNKYFYVGQCSSTNPIISSIQPLDIYDMGGIFVLIAVGIIAAFPAAVIEYLLNKSKLQCQRKTTGNSLRFGQVYRAKVTGLDRNGVTVDIGRLNLFSTTNEGRIYYVPKKYLGIKKKGEREILAPTDQGIMIGTKLLLKYMGNNPVDSKRIFVQ 859          
BLAST of SMED30001264 vs. Planmine SMEST
Match: SMESG000013939.1 (SMESG000013939.1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.547e-7
Identity = 91/384 (23.70%), Postives = 158/384 (41.15%), Query Frame = 2
Query: 1181 TVRIGVMLSKGYFMQKSPGV---------YYGFSPEIVEEMINITNFKYVYVFPNNVS-----NASFSDYDLLNSLIQ--LN-QADIILIPMVIKY-ITPVADFSDSVLTMSINMLTRSPN----SILSLVTLSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKN-----QKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVD--------NINTSSNNIYVFVKNSIDLNLIALDPTLSQLYNRSISMNPLATFVDDISSEKALETNNAILIQSSIKNGYIYNSINCTSDMMRGT---DTQY----PMAFAINRN-------FKQKEEMRSLIR 2185
            TVR+  +  K +   K+P           Y GF  +++    +   FKY     N+ S       + +  ++ N LI   LN  AD+++ P+ I      V  FS+  LT  ++++ + P      I S     P ++ VW       L+++ G + ++ +SP   +  N     QK  + +TF  C+    ++FV   + V    P +++ + + WF TL +I  YTANL  +L  +          D+V          IN+ S   +    N      + L   + Q  N  +    +   V  + S K    N A L++S + N Y  N   C + MM GT   D  Y    P  +++N N        ++K+E+  L +
Sbjct:  455 TVRVVTIALKPFLQLKTPKENEKLEGNERYEGFCVDLLNLTASFLGFKYEIHLVNDNSFGVKIGQNPNGTEIWNGLIGEILNGTADMVVAPLTISLSRARVVHFSEPFLTFGLSVIIKKPGKKKAGIFSF--FRPLSYPVWGCYFAACLVVSCGLYIIARMSPYEWNINNPYDPHQKITRDFTFFNCVWFSIAAFVQQGVDVAPKSPGARILSSVWWFFTLIMIAYYTANLAAFLTISLMIPPINDWPDLVSPGVGIEYGTINSGSTKNFFMTTNLEPFRTMGL--FMKQ--NPHVFRKTIEEGVKKVRSSKG---NYAFLLESRM-NEYFNNRYPCDT-MMVGTPYGDNGYGIATPKNYSLNENITDAILKLREKQELTKLYK 827          
BLAST of SMED30001264 vs. Planmine SMEST
Match: SMESG000069665.1 (SMESG000069665.1)

HSP 1 Score: 53.1434 bits (126), Expect = 9.812e-7
Identity = 61/291 (20.96%), Postives = 126/291 (43.30%), Query Frame = 2
Query: 1043 VTNKFNGTILKVIQANNFPNQIYTYTNNLSLFNSDQVILNLNNSAVTVRIGVMLSKGYFMQKSPGVYY---------GFSPEIVEEMINITNFKY-VYVFPNNVSNASFSDYDLLNSLIQ---LNQADIILIPMVI-----KYITPVADFSDSVLTMSINMLTRSPNSILSLVT--LSPFTWNVWXXXXXXXXXXXXXFWAVSTLSPPAVSKKNQKKIKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYTANLVPYLMKTNATYSFGKAQDIVD 1855
            +  KFNG     I A + P++ +    N +  N ++  ++L N +  +R+  +L+  + M  S              G+  ++ EE+  + N  Y +++  +N+  A   + D  N ++       ADI++ P+ +     K+I     F++  +T  ++++ + P      V   + P + NVW+      L + +G   ++ +SP        K+ + +  G      +++ V    ++    P +++ A I W  +L  I  YTANL  +L   N      K  D+V+
Sbjct:  378 ILTKFNGQGGGEIIAKSNPDETWDIMLN-NEKNPNEESIHLKNRSHVIRVVTILANPFVMLASDSSKSSKIGKKNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIA----FTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISP-----YEWKRDEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVE 658          
The following BLAST results are available for this feature:
BLAST of SMED30001264 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIA45.030e-922.78glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA45.030e-922.78glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA45.615e-922.78glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA45.615e-922.78glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRID25.949e-825.00glutamate ionotropic receptor delta type subunit 2... [more]
back to top
BLAST of SMED30001264 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001264 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PNPase1.325e-634.25gene:FBgn0039846 transcript:FBtr0085812[more]
PNPase1.325e-634.25gene:FBgn0039846 transcript:FBtr0085811[more]
PNPase1.325e-634.25gene:FBgn0039846 transcript:FBtr0300881[more]
PNPase1.325e-634.25gene:FBgn0039846 transcript:FBtr0334553[more]
Ir76b3.987e-625.52gene:FBgn0036937 transcript:FBtr0074869[more]
back to top
BLAST of SMED30001264 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grid22.169e-1023.94glutamate receptor, ionotropic, delta 2 [Source:NC... [more]
grid22.603e-1023.94glutamate receptor, ionotropic, delta 2 [Source:NC... [more]
grid23.147e-1023.94glutamate receptor, ionotropic, delta 2 [Source:NC... [more]
gria4b2.473e-821.82glutamate receptor, ionotropic, AMPA 4b [Source:ZF... [more]
gria4b2.572e-821.68glutamate receptor, ionotropic, AMPA 4b [Source:ZF... [more]
back to top
BLAST of SMED30001264 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK11.173e-724.11glutamate receptor, ionotropic, kainate 1 [Source:... [more]
GRIK11.271e-724.11glutamate receptor, ionotropic, kainate 1 [Source:... [more]
GRIK11.277e-724.11glutamate receptor, ionotropic, kainate 1 [Source:... [more]
GRIK11.295e-724.11glutamate receptor, ionotropic, kainate 1 [Source:... [more]
GRIK11.408e-724.11glutamate receptor, ionotropic, kainate 1 [Source:... [more]
back to top
BLAST of SMED30001264 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gria42.885e-922.78glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria42.885e-922.78glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria43.790e-922.78glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Grik14.654e-825.33glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik34.790e-823.66glutamate receptor, ionotropic, kainate 3 [Source:... [more]
back to top
BLAST of SMED30001264 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q68Y21|GRID2_DANRE2.316e-923.94Glutamate receptor ionotropic, delta-2 OS=Danio re... [more]
sp|P19493|GRIA4_RAT1.901e-822.78Glutamate receptor 4 OS=Rattus norvegicus OX=10116... [more]
sp|Q38PU5|GRIA4_MACFA2.198e-822.78Glutamate receptor 4 OS=Macaca fascicularis OX=954... [more]
sp|Q9Z2W8|GRIA4_MOUSE2.651e-822.78Glutamate receptor 4 OS=Mus musculus OX=10090 GN=G... [more]
sp|P48058|GRIA4_HUMAN2.697e-822.78Glutamate receptor 4 OS=Homo sapiens OX=9606 GN=GR... [more]
back to top
BLAST of SMED30001264 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PEC15.855e-1321.67Polyribonucleotide nucleotidyltransferase 1 OS=Sch... [more]
A0A0X3NVQ46.767e-1321.67Polyribonucleotide nucleotidyltransferase 1 OS=Sch... [more]
A0A267EW412.227e-1128.86Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A0R3T0I62.821e-1121.94Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A564ZD623.392e-1122.00S1 motif domain-containing protein OS=Hymenolepis ... [more]
back to top
BLAST of SMED30001264 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grid22.118e-924.90glutamate receptor, ionotropic, delta 2 [Source:NC... [more]
grik1a1.211e-823.75glutamate receptor ionotropic, kainate 1 [Source:N... [more]
grik1a1.339e-823.75glutamate receptor ionotropic, kainate 1 [Source:N... [more]
gria4b1.908e-822.01glutamate receptor 4 [Source:NCBI gene;Acc:1030350... [more]
GRIK25.234e-826.22glutamate receptor ionotropic, kainate 2 [Source:N... [more]
back to top
BLAST of SMED30001264 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005084.15.869e-727.84pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000009904.19.982e-728.72pep scaffold:Pmarinus_7.0:GL476672:16428:36105:1 g... [more]
back to top
BLAST of SMED30001264 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001264 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO412915.507e-726.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30001264 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grid27.663e-1026.10glutamate ionotropic receptor delta type subunit 2... [more]
GRIK31.304e-827.03glutamate ionotropic receptor kainate type subunit... [more]
GRIK31.955e-827.03glutamate ionotropic receptor kainate type subunit... [more]
gria4b2.100e-822.48glutamate receptor 4 [Source:NCBI gene;Acc:1011753... [more]
GRIK32.342e-827.03glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of SMED30001264 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000049231.10.000e+099.29SMESG000049231.1[more]
SMESG000043379.11.796e-923.89SMESG000043379.1[more]
SMESG000013939.11.547e-723.70SMESG000013939.1[more]
SMESG000069665.19.812e-720.96SMESG000069665.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001264 ID=SMED30001264|Name=SMED30001264|organism=Schmidtea mediterranea sexual|type=transcript|length=2705bp
CAATGTTTAAGTGTTTCTGTTTTGTGTTTATTGATGCGTTACATCTGATA
TGCTTCCAAGAGCACTGTGCTATTTTCATTATTGTCAGATTATTGATTTC
TCTGTGATCATTTTATTTATCGGAGTTTTTTAGATGGAATTATTTCTTGT
TCAGATATTTTTACTTATCAGTTTTCCATTTAATAATGGACAAACTTTAA
CCTATATAATCGCAGTTCAATTACCTTACGCAAGCAGTTTACCAACTAAT
TTACCGAGCTCTTTGCAGATAGTGAATCTTACATTGCCTCCAATGAACTC
CTTGTCAGAAATGACTTCAACAACCAATTCAGCCAACTACGACTACATAG
TGGCAAATTACAGCAAGCAATGGGTAATGTGGACAAACCAGAATAATATA
CCTTACCTAGTGATCCCTGATGTAGTAAGTGACATTCCATTGCCGTCAAA
TGTGTTTTTTGCTACCTCAATTCTTCAACAAACGTTAGAGTGCACCAATG
CTCTACTGACTGCTTTGAACGCTTCCTCAGTCGTCTTTTTGGATTATGCT
CCAAATCCTCAATTCAAAAATCTAATTATGTTTAATAACTTTACTCAAAC
CTTAATTATGATCTCTAACACAACAACGATGACCGACCTGTTTGTGAAGA
CTCTTCAATATAATGTAGAAAGCTTTTATGTCGTTGCGATTCCTTTGACT
GAAACAAGTATAATTCAAAGTCTGATGGCAGAAGCAATGGTTAAGGGGCA
GCTGAACCCGGGAAAAAACTGGATATTTATAGACTCGAGCTTAAACGAAA
TAAATTCCAAAACTTTGTTTTCACCATATGTCAACGTACGTGGAATAATC
TATGGATACAACATAACATTTGTAAACCAGTCTGGGTCATCACCTTATCT
CAACATGTTAGTCAATGATTACGTCCTATTAATTAACAGTAGTATATTTG
GATTGAGCGCCAAACCAACCAATAAATCTGCTCAGTTAGCAAGCGCAAAT
ATGACCAATGGGCAATTATCACCGTATTCCAGTTTTGACAAAGTAACCAA
CAAATTCAACGGAACAATTTTGAAAGTCATTCAAGCAAACAATTTCCCTA
ATCAGATTTATACTTATACCAATAATTTGAGTTTGTTTAACTCTGATCAA
GTTATTTTAAATTTAAATAATTCGGCGGTCACGGTCAGGATCGGCGTTAT
GTTGTCTAAAGGATATTTCATGCAAAAGTCACCAGGTGTATATTATGGGT
TTTCACCCGAAATTGTTGAAGAAATGATTAATATCACAAATTTTAAATAT
GTTTATGTTTTTCCAAACAATGTTTCAAACGCGAGTTTTTCTGACTACGA
TCTGTTGAATTCTCTGATCCAGTTGAATCAAGCTGATATCATCTTAATCC
CAATGGTCATCAAGTATATTACTCCGGTTGCCGATTTCAGCGATTCGGTG
TTAACAATGTCAATAAATATGTTAACTAGATCTCCAAACTCAATTCTTTC
ATTGGTAACGTTATCTCCTTTTACGTGGAACGTATGGCTTGGAATTATTC
TTATTATACTTTTGTTAACACTTGGATTTTGGGCTGTTAGTACTTTGAGT
CCTCCAGCAGTAAGCAAAAAAAATCAGAAGAAAATCAAACCATACACATT
TGGATTTTGTTTGTTGGTTATTTATTCCTCGTTTGTCATGGCAAAGTTGA
AAGTTAAATTGCTCCAACCTTCTTCTCAAGTGTTTGCTTTTATTTTGTGG
TTTTCTACGTTGACAATAATTATAACTTACACCGCAAATCTCGTGCCATA
TTTGATGAAAACAAATGCAACCTACAGTTTTGGGAAAGCTCAAGATATTG
TTGACAATATCAATACTTCGAGTAATAATATATATGTGTTCGTGAAGAAT
AGTATAGATCTAAATCTGATCGCCCTTGATCCAACCCTATCACAATTATA
CAATCGGTCAATATCCATGAACCCTTTAGCAACGTTTGTTGATGATATTT
CTTCTGAAAAAGCTCTTGAAACGAATAACGCTATTCTAATTCAAAGTTCT
ATCAAAAATGGATACATTTATAACTCAATTAATTGCACTTCAGACATGAT
GAGAGGGACCGACACCCAATACCCGATGGCATTTGCAATAAACCGAAATT
TTAAACAAAAGGAAGAAATGAGAAGTTTGATAAGGAACCTAGTACTGACC
GGAGTGTTGAGTGGATCATCAATAATATATTTCGGTAAAGGTCCTTGTGC
TAGAACGGCCTTGACCAATCTCCCATCGTCCAAACCATTGAATTTGTTGA
GTTTATATATCTTATTCCTTCTTCCTGTCGGAGGACTTGTTTTCGGAGTT
GGATTTGTCGTACTGAAAATGTTGATTAATAAATGCTGTAGGTGTATCAA
AAATAGTAATCGAGAGCCCTTCATTATGGGAAAACCATACGATGCCAAAG
TTTCAAGCGTTGAAAATGATGGAGTTTGGGCAACCATCAATCAAAGGGAC
AGGCCCTATTACATCCACACAAGCAATTTGCAGCCAGATCTAAGGAGGAA
ATACACTCCAAAGGAATTACAAATTAAAAGCGGTGACGTGATTCAGTTGA
AATATTTCGGCAAAGATCCTATCAACGGATACAAGAGATTTTGTAAAGAC
TTTTCTGAAGCATAAATAATGTATTTCATCCATTAAACCTTCTACTTTCA
ACTAC
back to top

protein sequence of SMED30001264-orf-1

>SMED30001264-orf-1 ID=SMED30001264-orf-1|Name=SMED30001264-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=844bp
MELFLVQIFLLISFPFNNGQTLTYIIAVQLPYASSLPTNLPSSLQIVNLT
LPPMNSLSEMTSTTNSANYDYIVANYSKQWVMWTNQNNIPYLVIPDVVSD
IPLPSNVFFATSILQQTLECTNALLTALNASSVVFLDYAPNPQFKNLIMF
NNFTQTLIMISNTTTMTDLFVKTLQYNVESFYVVAIPLTETSIIQSLMAE
AMVKGQLNPGKNWIFIDSSLNEINSKTLFSPYVNVRGIIYGYNITFVNQS
GSSPYLNMLVNDYVLLINSSIFGLSAKPTNKSAQLASANMTNGQLSPYSS
FDKVTNKFNGTILKVIQANNFPNQIYTYTNNLSLFNSDQVILNLNNSAVT
VRIGVMLSKGYFMQKSPGVYYGFSPEIVEEMINITNFKYVYVFPNNVSNA
SFSDYDLLNSLIQLNQADIILIPMVIKYITPVADFSDSVLTMSINMLTRS
PNSILSLVTLSPFTWNVWLGIILIILLLTLGFWAVSTLSPPAVSKKNQKK
IKPYTFGFCLLVIYSSFVMAKLKVKLLQPSSQVFAFILWFSTLTIIITYT
ANLVPYLMKTNATYSFGKAQDIVDNINTSSNNIYVFVKNSIDLNLIALDP
TLSQLYNRSISMNPLATFVDDISSEKALETNNAILIQSSIKNGYIYNSIN
CTSDMMRGTDTQYPMAFAINRNFKQKEEMRSLIRNLVLTGVLSGSSIIYF
GKGPCARTALTNLPSSKPLNLLSLYILFLLPVGGLVFGVGFVVLKMLINK
CCRCIKNSNREPFIMGKPYDAKVSSVENDGVWATINQRDRPYYIHTSNLQ
PDLRRKYTPKELQIKSGDVIQLKYFGKDPINGYKRFCKDFSEA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0004970ionotropic glutamate receptor activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0005515protein binding
GO:0008144drug binding
GO:0015277kainate selective glutamate receptor activity
GO:0016595glutamate binding
GO:0022843voltage-gated cation channel activity
GO:0042803protein homodimerization activity
Vocabulary: INTERPRO
TermDefinition
IPR001320Iontro_rcpt
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0008328ionotropic glutamate receptor complex
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030425dendrite
GO:0043025neuronal cell body
GO:0043195terminal bouton
GO:0043235receptor complex
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0007268chemical synaptic transmission
GO:0007399nervous system development
GO:0032229negative regulation of synaptic transmission, GABAergic
GO:0032230positive regulation of synaptic transmission, GABAergic
GO:0034220ion transmembrane transport
GO:0034765regulation of ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0035725sodium ion transmembrane transport
GO:0048167regulation of synaptic plasticity
GO:0048172regulation of short-term neuronal synaptic plasticity
GO:0051967negative regulation of synaptic transmission, glutamatergic
GO:0060079excitatory postsynaptic potential
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 443..665
e-value: 7.2E-33
score: 115.8
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 370..717
e-value: 7.2E-33
score: 115.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 453..743
e-value: 7.2E-33
score: 115.8
NoneNo IPR availablePANTHERPTHR42643:SF13IONOTROPIC RECEPTOR 40A-RELATEDcoord: 307..753
NoneNo IPR availablePANTHERPTHR42643FAMILY NOT NAMEDcoord: 307..753
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.674
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 350..694
NoneNo IPR availableTMHMMTMhelixcoord: 503..520
NoneNo IPR availableTMHMMTMhelixcoord: 721..743
NoneNo IPR availableTMHMMTMhelixcoord: 464..486
NoneNo IPR availableTMHMMTMhelixcoord: 682..701
NoneNo IPR availableTMHMMTMhelixcoord: 535..557
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 465..734
e-value: 6.2E-13
score: 48.8