Fibroblast growth factor receptor 1

Overview
NameFibroblast growth factor receptor 1
Smed IDSMED30001259
Length (bp)3876
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fibroblast growth factor receptor 1 (SMED30001259) t-SNE clustered cells

Violin plots show distribution of expression levels for Fibroblast growth factor receptor 1 (SMED30001259) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fibroblast growth factor receptor 1 (SMED30001259) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fibroblast growth factor receptor 1 (SMED30001259) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001259

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30001259SMESG000022746.1 dd_Smed_v4_5615_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Human
Match: FLT1 (fms related tyrosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:3763])

HSP 1 Score: 123.25 bits (308), Expect = 1.523e-27
Identity = 99/370 (26.76%), Postives = 159/370 (42.97%), Query Frame = 1
Query: 2554 FDCDSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENG-------------VENYDTTK--------------EPTTLLI---LEYYSNRSLNEFLLAHSVEFSPYTKLRKFS---QQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
             D D + L       P D  +W  +  R+K+   +G+G +G++ +         +  F   K P       K  +           M E+KIL+ +    N++ ++G    + G             + NY  +K              EP    +   LE      L+    + S   S + + +  S   ++ D +G    E IT+ DL   +  +A G+E+LS    IHRDLA RNILL EN V KICDFGLA     D + +  Y +   +  LP K +APE +  K +  KSD+WS+G+LLW++F+L   + +P  +   D    +R  +        +  P+ +   I+ I+  CW   P  RP
Sbjct:  799 MDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGKVVQ---------ASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTKQGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTSSESFASSGFQEDKSLSDVEEEEDSDGF-YKEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLA----RDIYKNPDY-VRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSL-GGSPYPGVQMDEDFCSRLREGM-------RMRAPEYSTPEIYQIMLDCWHRDPKERP 1145          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Human
Match: FGFR3 (fibroblast growth factor receptor 3 [Source:HGNC Symbol;Acc:HGNC:3690])

HSP 1 Score: 118.242 bits (295), Expect = 2.051e-26
Identity = 95/327 (29.05%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELET-DNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D K W +S +R+ +   +G+G +G++   + I  D +  ++      + +  + T+K          L   ++E++++  +    NII ++G            T   P  +L+ EY +  +L EFL A       Y+          F+  K  EE +T  DL   A  +A G+EYL+    IHRDLA RN+L+ E+ V KI DFGLA ++   D +  TT      N  LP K +APE L  + +  +SD+WSFG+LLW++F L   + +P    P++ L     +L     R  +  P      ++ I++ CW   P  RP+
Sbjct:  348 PADPK-WELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDK---------DLSDLVSEMEMMKMIGKHKNIINLLGAC----------TQGGPLYVLV-EYAAKGNLREFLRARRPPGLDYS----------FDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTT------NGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTL-GGSPYPGI--PVEEL----FKLLKEGHR--MDKPANCTHDLYMIMRECWHAAPSQRPT 628          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Human
Match: FGFR3 (fibroblast growth factor receptor 3 [Source:HGNC Symbol;Acc:HGNC:3690])

HSP 1 Score: 118.242 bits (295), Expect = 2.051e-26
Identity = 95/327 (29.05%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELET-DNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D K W +S +R+ +   +G+G +G++   + I  D +  ++      + +  + T+K          L   ++E++++  +    NII ++G            T   P  +L+ EY +  +L EFL A       Y+          F+  K  EE +T  DL   A  +A G+EYL+    IHRDLA RN+L+ E+ V KI DFGLA ++   D +  TT      N  LP K +APE L  + +  +SD+WSFG+LLW++F L   + +P    P++ L     +L     R  +  P      ++ I++ CW   P  RP+
Sbjct:  348 PADPK-WELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDK---------DLSDLVSEMEMMKMIGKHKNIINLLGAC----------TQGGPLYVLV-EYAAKGNLREFLRARRPPGLDYS----------FDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTT------NGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTL-GGSPYPGI--PVEEL----FKLLKEGHR--MDKPANCTHDLYMIMRECWHAAPSQRPT 628          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Human
Match: FGFR3 (fibroblast growth factor receptor 3 [Source:HGNC Symbol;Acc:HGNC:3690])

HSP 1 Score: 118.627 bits (296), Expect = 2.716e-26
Identity = 95/329 (28.88%), Postives = 156/329 (47.42%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELET-DNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPI-DLLKYIR-SRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D K W +S +R+ +   +G+G +G++   + I  D +  ++      + +  + T+K          L   ++E++++  +    NII ++G            T   P  +L+ EY +  +L EFL A       Y+          F+  K  EE +T  DL   A  +A G+EYL+    IHRDLA RN+L+ E+ V KI DFGLA ++   D +  TT      N  LP K +APE L  + +  +SD+WSFG+LLW++F L   + +P    P+ +L K ++     D         P      ++ I++ CW   P  RP+
Sbjct:  460 PADPK-WELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDK---------DLSDLVSEMEMMKMIGKHKNIINLLGAC----------TQGGPLYVLV-EYAAKGNLREFLRARRPPGLDYS----------FDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTT------NGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTL-GGSPYPGI--PVEELFKLLKEGHRMDK--------PANCTHDLYMIMRECWHAAPSQRPT 740          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Human
Match: FGFR3 (fibroblast growth factor receptor 3 [Source:HGNC Symbol;Acc:HGNC:3690])

HSP 1 Score: 118.242 bits (295), Expect = 2.872e-26
Identity = 95/327 (29.05%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELET-DNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D K W +S +R+ +   +G+G +G++   + I  D +  ++      + +  + T+K          L   ++E++++  +    NII ++G            T   P  +L+ EY +  +L EFL A       Y+          F+  K  EE +T  DL   A  +A G+EYL+    IHRDLA RN+L+ E+ V KI DFGLA ++   D +  TT      N  LP K +APE L  + +  +SD+WSFG+LLW++F L   + +P    P++ L     +L     R  +  P      ++ I++ CW   P  RP+
Sbjct:  462 PADPK-WELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDK---------DLSDLVSEMEMMKMIGKHKNIINLLGAC----------TQGGPLYVLV-EYAAKGNLREFLRARRPPGLDYS----------FDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTT------NGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTL-GGSPYPGI--PVEEL----FKLLKEGHR--MDKPANCTHDLYMIMRECWHAAPSQRPT 742          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Celegans
Match: R09D1.12 (pep chromosome:WBcel235:II:9450028:9452263:-1 gene:WBGene00011168.1 transcript:R09D1.12.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R09D1.12)

HSP 1 Score: 117.857 bits (294), Expect = 1.604e-27
Identity = 96/319 (30.09%), Postives = 152/319 (47.65%), Query Frame = 1
Query: 2647 NTEIGKGNYGRIFKGILT----DFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFL----LAHSVEFSPYTKLRKFSQQPDFNGIKLDEE----ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVL-ESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            N ++GKG +G I KG+LT      N   Q  VA+K+ +      + K I+          +EIK++  +    N++ ++G            T KE  +    EY  N++++EF+    L   +  SPYT   + + +    G  +D E    I+  DL   A  IANG+EYL+    +HRDLA RN+ + +NK+ +I DFGLA      ++    Y   T    LP   LAPE   +  SF   +D+WS+G+ L+++F+L       +F+N  D + Y+ + L   E    L  PK   S I++ +  CW      RP
Sbjct:  129 NRKLGKGKFGIINKGLLTLRICKTNEVVQVNVAVKKMVDPTDEKQDKLIY----------DEIKLMCAIGKHPNVLAIVGAI----------TKKEKVSGR--EY--NQAVSEFIEGGDLRSVLRNSPYTFQDEITSRERTGGQNVDAEVFDTISTSDLFSFAYQIANGMEYLASLPCVHRDLALRNVFVKKNKIIRIGDFGLARHNGDKDYYKVKYSPET---PLPIFWLAPECFDDGTSFTEMTDVWSYGVCLFELFSLGASPYLEEFQNFFDPIYYVVAFL---ESGKRLSSPKYCRSDIYNFMLECWNSDAKQRP 417          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Celegans
Match: old-1 (Tyrosine-protein kinase receptor old-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17833])

HSP 1 Score: 115.161 bits (287), Expect = 2.717e-26
Identity = 89/323 (27.55%), Postives = 156/323 (48.30%), Query Frame = 1
Query: 2632 SRVKINTE---------IGKGNYGRIFKGILTDFNSTSQQ-----FVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPID------LLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCW 3540
            + V+IN E         +G G +G I KG L   NS +++      VA+K P+  N+ N        QI  +   +E+K++  +    NI+ ++G   F               +++ E+  N  L  FL  + + F+      +  Q          + ++++DL   A  IA G+EYL     +HRDLA RN+L+ +N++ +I DFGLA   +  ++    Y+  + +  LP   +APE ++   F  KSD+WS+G+ L+++F+L +      +EN I         KY+ S L + +    L  P  AD+ I++++K+CW
Sbjct:  164 AEVEINEEDLDISKGRPLGSGEFGIIRKGFLRSKNSKNEEKESRLEVAVKLPL--NEYN--------QIQQELIYDELKVMCAVGKHPNILALVGGITFGE-----------RKMIVSEFVENGDLLSFLRDNRIYFTNDQWTLETEQ----------DSLSLVDLLSFAFQIAKGMEYLIHVPCVHRDLALRNVLIKKNRIIRIADFGLARRHKNKDY----YKTQSVDTPLPIHWMAPESIDKLLFTQKSDVWSYGVCLYELFSLGKSP----YENVIKYDQRDFYWKYVLSYLNEGKR---LAQPAHADAEIYNVMKLCW 444          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Celegans
Match: W04G5.10 (pep chromosome:WBcel235:I:11638482:11640414:-1 gene:WBGene00012270.1 transcript:W04G5.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W04G5.10)

HSP 1 Score: 110.538 bits (275), Expect = 2.897e-25
Identity = 94/325 (28.92%), Postives = 151/325 (46.46%), Query Frame = 1
Query: 2623 ISPSRVKINTE--IGKGNYGRIFKGILTDFNSTSQ-QFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESK----SFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELR--DFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            I P  +KI+TE  IG G +G +++  L      S    VA+K+P   +   + K +H           E+ ++  +    NI+ ++G     N             +++ EY  +  L +FL           +  KF    D + +KLDE+ +   DL      IANG++YL     +HRDLA RN+L+  N V KI DFGLA   +  ++    Y+  T + ALP K LAPE  E +     F  KSD+WS+G+ L+++F+L +        N +D   +   ++  + LR  + L  P+     ++  +K CW   P  RPS
Sbjct:   93 IDPENLKISTENYIGSGFFGTVYRAELRRERRNSNFMIVAVKEPSNIHNIRQKKILH----------EELNVMCSMEKHPNILSLVGVVTQRN------------VMIVTEYVEDGDLLKFL-----------RKCKF----DKDSVKLDEKSLCKADLFSFTFQIANGMQYLERVPCVHRDLALRNVLIKNNGVLKIADFGLARRHDKKDY----YRTKTTDTALPIKWLAPECFEEEEEKIRFDSKSDVWSYGVCLYEIFSLGESPY-----NELDSNNFAFLQVLADFLRKGNTLSEPEHCAPKMYYFMKSCWNLIPEERPS 371          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Celegans
Match: old-2 (Overexpression Longevity Determinant [Source:UniProtKB/TrEMBL;Acc:Q23677])

HSP 1 Score: 110.153 bits (274), Expect = 8.667e-25
Identity = 90/328 (27.44%), Postives = 157/328 (47.87%), Query Frame = 1
Query: 2605 DRKRWTISPSRVKINTE---------IGKGNYGRIFKGILTDFNSTSQQF-----VAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETL--FPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCW 3540
            DR ++    + V+IN E         +G G +G I KG L   NS +++      VA+K P+  N+ N         I  +   +E+K++  +    NI+ ++G      G+     T     ++I E   N  L  FL  +   F+    + + + +P+   + L      +DL   A  IA G+EYL     +HRDLA RN+L+  N V +I DFGLA   +  ++    Y+  + +  LP   +APE ++   F  KSD+WS+G+ L+++F+L +        ++      KY+ + L + +    L  P  AD+ I++++K+CW
Sbjct:  151 DRIKYLHYYAEVEINEEDLDISKGRPLGSGEFGIIRKGFLRSKNSKNKETESRLEVAVKSPL--NEYN--------HIQQELIYDELKVMCAVGKHPNILALVG------GI-----TIGEKRMIISELVENGDLLSFLRKNRRNFT----IDQLAFEPEKPSLGL------VDLVSFAFQIAKGMEYLIHVPCVHRDLALRNVLIKGNMVIRIADFGLARRHKNKDY----YKTQSVDTPLPIHWMAPESIDKLLFTQKSDVWSYGVCLYELFSLGKSPYKNVIKYDERDSYCKYVLAYLNEGKR---LAQPAHADAEIYNVMKLCW 440          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Celegans
Match: kin-15 (Receptor-like tyrosine-protein kinase kin-15 [Source:UniProtKB/Swiss-Prot;Acc:P34891])

HSP 1 Score: 109.383 bits (272), Expect = 8.894e-25
Identity = 93/341 (27.27%), Postives = 161/341 (47.21%), Query Frame = 1
Query: 2614 RWTISPSRVKINTE-IGKGNYGRIFKGIL------TDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFS------------PYTKLRK---FSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELR-DFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            R+ I  ++++I+ + +G G +G +  G+L      T+ ++  +  VA+KQ     Q N+ K I           +E K++  +    NI+ +IG     +G            LLI+E+     L +FL      F             P +  RK   F++  D    +  + +   DL   +  IA G+EYL+    +HRDLA RN+LL++NK  +I DFGLA + + D +   T  + T    +P + +APEV+       KSD+WS+G+ L++MF+L  E  + +  N         S +F++ ++ + L +P+     ++D +K  W F    RPS
Sbjct:   75 RFEIDQAKLEISEDKLGSGFFGEVCYGLLSMRTSNTETDTLQKLSVAVKQSNDPTQENQEKMIE----------DETKLMCAIGRNPNILAIIGAVTANSG--------SARNLLIVEFVECGDLLKFLEEKKSIFKDELVYEKNGYLLPKSIRRKTYMFNENEDDVIEESLDSLCTSDLLSFSYQIAEGMEYLASIPCVHRDLALRNVLLNKNKTIRIADFGLARKYQVDGYYRITKGVGT---PMPARWMAPEVMREGKCTEKSDVWSYGVSLYEMFSL-GELPYSNVSN---------SDVFEHVVQGNQLPMPQYCHPKMYDRMKQFWNFDATFRPS 384          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083550)

HSP 1 Score: 119.783 bits (299), Expect = 4.712e-27
Identity = 93/327 (28.44%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-----ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            PLD   W +  S + +   +G+G +GR+   ++ + N+     VA+K  +    T+           +   + E++++  +    NII ++GC   +NG             +I+EY  + +L +FL           K R F +  D +  +         IT  DL K A  IA G++YL+    IHRDLA RN+L+ ++ V KI DFGLA +++     ST Y     N  LP K +APE L+ K +  KSD+WS+G+LLW++    Q+  +P   +  +L  Y+ S          +  P     +I+ +++ CW F+  +RP
Sbjct:  404 PLD-SNWELPRSHLVLGATLGEGAFGRV---VMAEVNNA---IVAVKM-VKEGHTDD---------DIASLVREMEVMKIIGRHINIINLLGCCS-QNG----------PLYVIVEYAPHGNLKDFLY----------KNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQ-----STDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQP-YPTIMSAEELYTYLMS-------GQRMEKPAKCSMNIYILMRQCWHFNADDRP 679          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083549)

HSP 1 Score: 119.783 bits (299), Expect = 4.712e-27
Identity = 93/327 (28.44%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-----ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            PLD   W +  S + +   +G+G +GR+   ++ + N+     VA+K  +    T+           +   + E++++  +    NII ++GC   +NG             +I+EY  + +L +FL           K R F +  D +  +         IT  DL K A  IA G++YL+    IHRDLA RN+L+ ++ V KI DFGLA +++     ST Y     N  LP K +APE L+ K +  KSD+WS+G+LLW++    Q+  +P   +  +L  Y+ S          +  P     +I+ +++ CW F+  +RP
Sbjct:  404 PLD-SNWELPRSHLVLGATLGEGAFGRV---VMAEVNNA---IVAVKM-VKEGHTDD---------DIASLVREMEVMKIIGRHINIINLLGCCS-QNG----------PLYVIVEYAPHGNLKDFLY----------KNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQ-----STDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQP-YPTIMSAEELYTYLMS-------GQRMEKPAKCSMNIYILMRQCWHFNADDRP 679          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083548)

HSP 1 Score: 119.783 bits (299), Expect = 4.712e-27
Identity = 93/327 (28.44%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-----ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            PLD   W +  S + +   +G+G +GR+   ++ + N+     VA+K  +    T+           +   + E++++  +    NII ++GC   +NG             +I+EY  + +L +FL           K R F +  D +  +         IT  DL K A  IA G++YL+    IHRDLA RN+L+ ++ V KI DFGLA +++     ST Y     N  LP K +APE L+ K +  KSD+WS+G+LLW++    Q+  +P   +  +L  Y+ S          +  P     +I+ +++ CW F+  +RP
Sbjct:  404 PLD-SNWELPRSHLVLGATLGEGAFGRV---VMAEVNNA---IVAVKM-VKEGHTDD---------DIASLVREMEVMKIIGRHINIINLLGCCS-QNG----------PLYVIVEYAPHGNLKDFLY----------KNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQ-----STDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQP-YPTIMSAEELYTYLMS-------GQRMEKPAKCSMNIYILMRQCWHFNADDRP 679          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Fly
Match: Ret (gene:FBgn0011829 transcript:FBtr0081493)

HSP 1 Score: 117.857 bits (294), Expect = 3.558e-26
Identity = 83/323 (25.70%), Postives = 153/323 (47.37%), Query Frame = 1
Query: 2614 RWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQ-QFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKI---AMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIEL-ETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            +W     +++++T +G+G +G++ KG  T+         VA+K  +L   +N         +     ++E ++L +++   N+IK++G             T     LLI+EY    SL  +L              + S++ +  G+   + +  +++K +   A  I  G+ YLS   ++HRDLA RN+LL + K+ KI DFGL  ++ E D ++  +   +      P K +APE L    +  KSD+WSFG+L W++  L   + +P    P +L   +++    +        P+    +++ I++ CWA  P  RPS
Sbjct:  763 KWEFPREKLQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVK--MLKKGSNS--------VEYMALLSEFQLLQEVSH-PNVIKLLGAC-----------TSSEAPLLIIEYARYGSLRSYL--------------RLSRKIECAGVDFADGVEPVNVKMVLTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRV------PVKWMAPESLADHVYTSKSDVWSFGVLCWELITL-GASPYPGIA-PQNLWSLLKTGYRMDR-------PENCSEAVYSIVRTCWADEPNGRPS 1034          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Fly
Match: Ret (gene:FBgn0011829 transcript:FBtr0081494)

HSP 1 Score: 117.857 bits (294), Expect = 3.558e-26
Identity = 83/323 (25.70%), Postives = 153/323 (47.37%), Query Frame = 1
Query: 2614 RWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQ-QFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKI---AMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIEL-ETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            +W     +++++T +G+G +G++ KG  T+         VA+K  +L   +N         +     ++E ++L +++   N+IK++G             T     LLI+EY    SL  +L              + S++ +  G+   + +  +++K +   A  I  G+ YLS   ++HRDLA RN+LL + K+ KI DFGL  ++ E D ++  +   +      P K +APE L    +  KSD+WSFG+L W++  L   + +P    P +L   +++    +        P+    +++ I++ CWA  P  RPS
Sbjct:  763 KWEFPREKLQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVK--MLKKGSNS--------VEYMALLSEFQLLQEVSH-PNVIKLLGAC-----------TSSEAPLLIIEYARYGSLRSYL--------------RLSRKIECAGVDFADGVEPVNVKMVLTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRV------PVKWMAPESLADHVYTSKSDVWSFGVLCWELITL-GASPYPGIA-PQNLWSLLKTGYRMDR-------PENCSEAVYSIVRTCWADEPNGRPS 1034          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Zebrafish
Match: flt4 (fms-related tyrosine kinase 4 [Source:NCBI gene;Acc:30121])

HSP 1 Score: 134.42 bits (337), Expect = 4.421e-31
Identity = 102/350 (29.14%), Postives = 162/350 (46.29%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKG-ILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPY--------TKLRKF---------SQQPDFNG-----IKLDE----EITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D  +W IS  R+++   +G G +G++ +  I      +S   VA+K        ++ K +          M+E+KIL  +    N++ ++G     NG            ++I+EY    +L+ FL A    F PY        +++R+            QP  +      + +D+     +T+ DL   +  +A G+E+L+    IHRDLA RNILL EN V KICDFGLA ++  D        +   N  LP K +APE +  K +  +SD+WSFG+LLW++F+L   + +P  +   D  K    RL D      +  P  A   I+ I+  CW   P  RP+
Sbjct:  853 PYDSSQWEISRDRLRLGKVLGHGAFGKVIEASIFGHDKKSSANTVAVKMLKEGATASEHKAL----------MSELKILIHIGNHLNVVNLLGACTKPNG----------PLMVIVEYCKYGNLSNFLRAKREFFLPYRDRSPKTQSQVRRMIEAGQASQSEHQPSTSSTNPPRVTVDDLWKTPLTIEDLICYSFQVARGMEFLASRKCIHRDLAARNILLSENNVVKICDFGLARDIYKD-----PDYVRKGNARLPLKWMAPESIFDKVYTSQSDVWSFGVLLWEIFSL-GASPYPGIQIDEDFCK----RLKDGTR---MRAPDNASPEIYGIMLACWQGEPRERPT 1169          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Zebrafish
Match: flt4 (fms-related tyrosine kinase 4 [Source:NCBI gene;Acc:30121])

HSP 1 Score: 134.035 bits (336), Expect = 5.467e-31
Identity = 102/350 (29.14%), Postives = 162/350 (46.29%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKG-ILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPY--------TKLRKF---------SQQPDFNG-----IKLDE----EITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D  +W IS  R+++   +G G +G++ +  I      +S   VA+K        ++ K +          M+E+KIL  +    N++ ++G     NG            ++I+EY    +L+ FL A    F PY        +++R+            QP  +      + +D+     +T+ DL   +  +A G+E+L+    IHRDLA RNILL EN V KICDFGLA ++  D        +   N  LP K +APE +  K +  +SD+WSFG+LLW++F+L   + +P  +   D  K    RL D      +  P  A   I+ I+  CW   P  RP+
Sbjct:  809 PYDSSQWEISRDRLRLGKVLGHGAFGKVIEASIFGHDKKSSANTVAVKMLKEGATASEHKAL----------MSELKILIHIGNHLNVVNLLGACTKPNG----------PLMVIVEYCKYGNLSNFLRAKREFFLPYRDRSPKTQSQVRRMIEAGQASQSEHQPSTSSTNPPRVTVDDLWKTPLTIEDLICYSFQVARGMEFLASRKCIHRDLAARNILLSENNVVKICDFGLARDIYKD-----PDYVRKGNARLPLKWMAPESIFDKVYTSQSDVWSFGVLLWEIFSL-GASPYPGIQIDEDFCK----RLKDGTR---MRAPDNASPEIYGIMLACWQGEPRERPT 1125          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Zebrafish
Match: kitb (KIT proto-oncogene, receptor tyrosine kinase b [Source:ZFIN;Acc:ZDB-GENE-050916-2])

HSP 1 Score: 121.709 bits (304), Expect = 2.113e-27
Identity = 101/380 (26.58%), Postives = 169/380 (44.47%), Query Frame = 1
Query: 2518 PIIQIQNSMYKSFDCDSIQLL--THLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNST-SQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAH-----------------------SVE-----FSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            P  +I   +  SFD ++   +  T L  DP    +W     R++    +G G +G++         S  +   VA+K    S  + +           +  M+E+K+LS +    NI+ ++G            T   P TL+I EY     L  FL                          S+E     + P    +K S Q ++   K D  +   DL   +  +A G+++L+  + IHRDLA RN+LL + +V KICDFGLA ++  D     +  ++  N  LP K ++PE L +  +  +SD+WS+G+LLW++F+L   T +P         K I+     +E       P+ A S I+++++ CW+  P+ RP
Sbjct:  545 PKYEIHWKVIDSFDGNNYTYIDPTQLPYDP----KWEFPRERLRFGKILGSGAFGKVVAATAYGLCSADTVTTVAVKMLKPSAHSTEK----------EALMSELKVLSYIGNHINIVNLLGAC----------TVGGP-TLVITEYCCYGDLLNFLRRKRDAFFSSKTGDGYYKNLLSQTQPSIEGTDNGYMPMRSYQKRSNQTEWCDDKDDLSLDTEDLLSFSYQVAKGMDFLTSKNCIHRDLAARNVLLTQGRVAKICDFGLARDITRD-----SNYVLRGNARLPVKWMSPESLFACVYTFESDVWSYGILLWEIFSL-GNTPYPGIPVGSTFYKMIQDGYRMSE-------PEFAPSEIYEVMRWCWSADPLKRP 886          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Zebrafish
Match: kitb (KIT proto-oncogene, receptor tyrosine kinase b [Source:ZFIN;Acc:ZDB-GENE-050916-2])

HSP 1 Score: 121.709 bits (304), Expect = 2.395e-27
Identity = 101/380 (26.58%), Postives = 169/380 (44.47%), Query Frame = 1
Query: 2518 PIIQIQNSMYKSFDCDSIQLL--THLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNST-SQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAH-----------------------SVE-----FSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            P  +I   +  SFD ++   +  T L  DP    +W     R++    +G G +G++         S  +   VA+K    S  + +           +  M+E+K+LS +    NI+ ++G            T   P TL+I EY     L  FL                          S+E     + P    +K S Q ++   K D  +   DL   +  +A G+++L+  + IHRDLA RN+LL + +V KICDFGLA ++  D     +  ++  N  LP K ++PE L +  +  +SD+WS+G+LLW++F+L   T +P         K I+     +E       P+ A S I+++++ CW+  P+ RP
Sbjct:  545 PKYEIHWKVIDSFDGNNYTYIDPTQLPYDP----KWEFPRERLRFGKILGSGAFGKVVAATAYGLCSADTVTTVAVKMLKPSAHSTEK----------EALMSELKVLSYIGNHINIVNLLGAC----------TVGGP-TLVITEYCCYGDLLNFLRRKRDAFFSSKTGDGYYKNLLSQTQPSIEGTDNGYMPMRSYQKRSNQTEWCDDKDDLSLDTEDLLSFSYQVAKGMDFLTSKNCIHRDLAARNVLLTQGRVAKICDFGLARDITRD-----SNYVLRGNARLPVKWMSPESLFACVYTFESDVWSYGILLWEIFSL-GNTPYPGIPVGSTFYKMIQDGYRMSE-------PEFAPSEIYEVMRWCWSADPLKRP 886          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Zebrafish
Match: kitb (KIT proto-oncogene, receptor tyrosine kinase b [Source:ZFIN;Acc:ZDB-GENE-050916-2])

HSP 1 Score: 121.709 bits (304), Expect = 2.395e-27
Identity = 101/380 (26.58%), Postives = 169/380 (44.47%), Query Frame = 1
Query: 2518 PIIQIQNSMYKSFDCDSIQLL--THLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNST-SQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAH-----------------------SVE-----FSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            P  +I   +  SFD ++   +  T L  DP    +W     R++    +G G +G++         S  +   VA+K    S  + +           +  M+E+K+LS +    NI+ ++G            T   P TL+I EY     L  FL                          S+E     + P    +K S Q ++   K D  +   DL   +  +A G+++L+  + IHRDLA RN+LL + +V KICDFGLA ++  D     +  ++  N  LP K ++PE L +  +  +SD+WS+G+LLW++F+L   T +P         K I+     +E       P+ A S I+++++ CW+  P+ RP
Sbjct:  545 PKYEIHWKVIDSFDGNNYTYIDPTQLPYDP----KWEFPRERLRFGKILGSGAFGKVVAATAYGLCSADTVTTVAVKMLKPSAHSTEK----------EALMSELKVLSYIGNHINIVNLLGAC----------TVGGP-TLVITEYCCYGDLLNFLRRKRDAFFSSKTGDGYYKNLLSQTQPSIEGTDNGYMPMRSYQKRSNQTEWCDDKDDLSLDTEDLLSFSYQVAKGMDFLTSKNCIHRDLAARNVLLTQGRVAKICDFGLARDITRD-----SNYVLRGNARLPVKWMSPESLFACVYTFESDVWSYGILLWEIFSL-GNTPYPGIPVGSTFYKMIQDGYRMSE-------PEFAPSEIYEVMRWCWSADPLKRP 886          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Xenopus
Match: tgm6 (transglutaminase 6 [Source:Xenbase;Acc:XB-GENE-5878274])

HSP 1 Score: 125.946 bits (315), Expect = 1.802e-28
Identity = 90/326 (27.61%), Postives = 154/326 (47.24%), Query Frame = 1
Query: 2605 DRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFN-STSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-----ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            D  +W     R+K+   +G+G +G++ +      + S S + VA+K       T++   +          M+E+KILS +    N++ ++G      G            ++I+EY  N +L+ +L +   EF  Y K+         +   + E+     + + DL   +  +A G+EY++    IHRDLA RNILL EN V KICDFGLA ++  D        +   +  LP K +APE +  + +  +SD+WSFG+LLW++F+L   + +P  +   D  + ++       +R     P+ A   I+  +  CW   P  RP
Sbjct:  724 DASKWEFPRDRLKLGKPLGRGAFGQVLEADAFGIDKSGSCKTVAVKMLKEGATTSEHSAL----------MSELKILSHIGHHLNVVNLLGACTKPGG----------PLMVIVEYCKNGNLSAYLRSKRSEFVLY-KVHYLMSLAALSSCIVSEDTCKSSLCMEDLISYSFQVAKGMEYMASRKCIHRDLAARNILLAENNVVKICDFGLARDIYKD-----PDYVRKGDARLPLKWMAPETIFDRVYTTQSDVWSFGVLLWEIFSL-GASPYPGVQIDEDFCRRLKE---GTRMR----APEYATVEIYQTMLDCWHGDPQQRP 1015          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Xenopus
Match: trpm1 (transient receptor potential cation channel subfamily M member 1 [Source:Xenbase;Acc:XB-GENE-492528])

HSP 1 Score: 122.094 bits (305), Expect = 2.233e-27
Identity = 94/329 (28.57%), Postives = 155/329 (47.11%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFN-STSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIK-----LDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D  +W     R+++   +G G +G++ +      + S+S + VA+K        ++ K +          M+E+KIL  +    N++ ++G     NG            L I E      L       + +F    ++  FSQQ DF+  K     L   +T+ DL   +  +A G+E+L+    IHRDLA RNILL EN V KICDFGLA ++  D        +   +  LP K +APE +  K +  +SD+WSFG+LLW++F+L   + +P  +   +  + ++       +R     P+ A + I+ I+  CW   P  RP+
Sbjct:  588 PYDSTKWEFPRDRLRLGKVLGHGAFGKVVEASAFGMSKSSSCETVAVKMLKEGATASEHKAL----------MSELKILIHIGNHLNVVNLLGACTKSNG----------ECLSITELIICNPLKTGFDILTDKFD--REVVHFSQQKDFSEQKDAVHPLRSPLTMEDLICYSFQVARGMEFLASRKCIHRDLAARNILLSENNVVKICDFGLARDIYKD-----PDYVRKGSARLPLKWMAPESIFDKVYTTQSDVWSFGVLLWEIFSL-GASPYPGVQINEEFCQRLKE---GTRMR----APEYATAEIYRIMLSCWHGDPKERPT 881          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Xenopus
Match: csf1r (colony stimulating factor 1 receptor [Source:NCBI gene;Acc:493543])

HSP 1 Score: 120.553 bits (301), Expect = 2.798e-27
Identity = 97/391 (24.81%), Postives = 168/391 (42.97%), Query Frame = 1
Query: 2494 CERSGYAVPIIQIQNSMYKSFDC-DSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDF-NSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCA-------------------------------VFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            C +  Y +    IQ +   ++ C D  QL       P + K W    + ++    +G G +G++ +       N  S   VA+K    S  T++          ++  M+E+KILS L    NI+ ++G                                 +F   +E   +T      + +E+   +S + FL   +  +     +   S Q   + + LD    + DL   +  ++ G+ +LS  + IHRD+A RN+L+   +V KICDFGLA ++E D     +  ++  N  LP K +APE +    + ++SD+WS+G+LLW+MF+L + + +P         K I+           +  P  A   I+ I+K CW   P  RP+
Sbjct:  229 CTKPKYEIRWQIIQPAEGNNYTCIDPTQL-------PYNDK-WEFPRTNLQFGKTLGAGAFGKVMEATAVGLGNEDSAVTVAVKMLKPSAHTDE----------VEALMSELKILSHLGNHKNIVNLLGACTHGGPILVITEYCHYGDLLNFLRKKAQIMNEMFSASLEEQSSTSSDYKNMTIEHKYIKSDSGFLSKGTDSYVEMKPVSSLSSQDTDDMLPLD----LYDLLSFSFQVSQGMSFLSAKNCIHRDVAARNVLVSHGRVVKICDFGLARDIEND-----SNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEMFSLGR-SPYPGIMVNRKFYKMIKEGY-------KMDCPDYAPLEIYRIMKTCWDLEPTQRPT 584          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Xenopus
Match: tgm6 (transglutaminase 6 [Source:Xenbase;Acc:XB-GENE-5878274])

HSP 1 Score: 122.094 bits (305), Expect = 3.203e-27
Identity = 92/345 (26.67%), Postives = 158/345 (45.80%), Query Frame = 1
Query: 2605 DRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFN-STSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPY-TKLRKFSQQ------------------PDFNGIKLDEE-----ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            D  +W     R+K+   +G+G +G++ +      + S S + VA+K       T++   +          M+E+KILS +    N++ ++G      G            ++I+EY  N +L+ +L +   EF  Y TK  ++ +Q                     +   + E+     + + DL   +  +A G+EY++    IHRDLA RNILL EN V KICDFGLA ++  D        +   +  LP K +APE +  + +  +SD+WSFG+LLW++F+L   + +P  +   D  + ++       +R     P+ A   I+  +  CW   P  RP
Sbjct:  738 DASKWEFPRDRLKLGKPLGRGAFGQVLEADAFGIDKSGSCKTVAVKMLKEGATTSEHSAL----------MSELKILSHIGHHLNVVNLLGACTKPGG----------PLMVIVEYCKNGNLSAYLRSKRSEFVLYKTKTPRYRKQHYVEVSRDLKRRLDSIASTALSSCIVSEDTCKSSLCMEDLISYSFQVAKGMEYMASRKCIHRDLAARNILLAENNVVKICDFGLARDIYKDPDY-----VRKGDARLPLKWMAPETIFDRVYTTQSDVWSFGVLLWEIFSL-GASPYPGVQIDEDFCRRLKE---GTRMR----APEYATVEIYQTMLDCWHGDPQQRP 1049          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Xenopus
Match: csf1r (colony stimulating factor 1 receptor [Source:NCBI gene;Acc:493543])

HSP 1 Score: 119.783 bits (299), Expect = 5.824e-27
Identity = 87/352 (24.72%), Postives = 157/352 (44.60%), Query Frame = 1
Query: 2614 RWTISPSRVKINTEIGKGNYGRIFKGILTDF-NSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCA-------------------------------VFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDF--LLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            +W    + ++    +G G +G++ +       N  S   VA+K    S  T++          ++  M+E+KILS L    NI+ ++G                                 +F   +E   +T      + +E+   +S + FL   +  +     +   S Q   + + LD    + DL   +  ++ G+ +LS  + IHRD+A RN+L+   +V KICDFGLA ++E D     +  ++  N  LP K +APE +    + ++SD+WS+G+LLW+MF+L + + +P           + +R F   +++   +  P  A   I+ I+K CW   P  RP+
Sbjct:  284 KWEFPRTNLQFGKTLGAGAFGKVMEATAVGLGNEDSAVTVAVKMLKPSAHTDE----------VEALMSELKILSHLGNHKNIVNLLGACTHGGPILVITEYCHYGDLLNFLRKKAQIMNEMFSASLEEQSSTSSDYKNMTIEHKYIKSDSGFLSKGTDSYVEMKPVSSLSSQDTDDMLPLD----LYDLLSFSFQVSQGMSFLSAKNCIHRDVAARNVLVSHGRVVKICDFGLARDIEND-----SNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEMFSLGR-SPYPGI---------MVNRKFYKMIKEGYKMDCPDYAPLEIYRIMKTCWDLEPTQRPT 606          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Mouse
Match: Flt1 (FMS-like tyrosine kinase 1 [Source:MGI Symbol;Acc:MGI:95558])

HSP 1 Score: 125.176 bits (313), Expect = 2.771e-28
Identity = 127/563 (22.56%), Postives = 231/563 (41.03%), Query Frame = 1
Query: 2014 SGTYICEQKD-SIGNSVIKSYLIIKILQGIIPHIYQHNSEWKYIPGQNIHVSFQIVSFPPAKVEYFQLLSNDKKELFFQNRSDIRSHKFSNLTHSTFSIKFINIGQNDSGEYVLESSNIFGKNSTKFFLKFIISKGSSTI-YYTISGACXXXXXXXXXXX---KFCERSGYAVPIIQIQNSMYKSFDCDSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEF------SPYTKLRKFSQQPDF---------------------------NGIKLDEE--------ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            SGTY C  ++   G  +++   ++ +     PH+ Q+ S+++     +  +  Q    P  ++ +F+            N   I+      L     ++    + + D G Y   ++N  G   +  +L    +   S +   T++  C+   +  +LL    +  +RS   V    +   M    D D + L       P D  +W  +  R+K+   +G+G +G++ +         +  F   K P       K  +           M E+KIL+ +    N++ ++G    + G            ++I+EY    +L+ +L +    F      + + +L+K S +P                             + ++ DE+        +T+ DL   +  +A G+E+LS    IHRDLA RNILL EN V KICDFGLA     D + +  Y +   +  LP K +APE +  K +  KSD+WS+G+LLW++F+L   + +P  +   D    ++  +        +  P+ A   I+ I+  CW   P  RP
Sbjct:  632 SGTYACRARNIYTGEDILRKTEVL-VRDSEAPHLLQNLSDYEVSISGSTTLDCQARGVPAPQITWFK------------NNHKIQQEPGIILGPGNSTLFIERVTEEDEGVYRCRATNQKGAVESAAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFIRKLKRSSSEVKTDYLSIIM----DPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGKVVQ---------ASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTKQGG----------PLMVIVEYCKYGNLSNYLKSKRDLFCLNKDAALHMELKKESLEPGLEQGQKPRLDSVSSSSVTSSSFPEDRSVSDVEGDEDYSEISKQPLTMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLA----RDIYKNPDY-VRRGDTRLPLKWMAPESIFDKVYSTKSDVWSYGVLLWEIFSL-GGSPYPGVQMDEDFCSRLKEGM-------RMRTPEYATPEIYQIMLDCWHKDPKERP 1145          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 123.635 bits (309), Expect = 3.960e-28
Identity = 96/329 (29.18%), Postives = 158/329 (48.02%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELET-DNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPI-DLLKYIR-SRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D K W +S +R+ +   +G+G +G++   + I  D + T++      + +  + T+K          L   ++E++++  +    NII ++G            T   P  +L+ EY +  +L EFL A       Y+          F+  +L EE +T  DL   A  +A G+EYL+    IHRDLA RN+L+ E+ V KI DFGLA ++   D +  TT      N  LP K +APE L  + +  +SD+WSFG+LLW++F L   + +P    P+ +L K ++     D         P      ++ I++ CW   P  RP+
Sbjct:  436 PADPK-WELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDK---------DLSDLVSEMEMMKMIGKHKNIINLLGAC----------TQGGPLYVLV-EYAAKGNLREFLRARRPPGMDYS----------FDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTT------NGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTL-GGSPYPGI--PVEELFKLLKEGHRMDK--------PASCTHDLYMIMRECWHAVPSQRPT 716          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 123.635 bits (309), Expect = 3.960e-28
Identity = 96/329 (29.18%), Postives = 158/329 (48.02%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELET-DNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPI-DLLKYIR-SRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D K W +S +R+ +   +G+G +G++   + I  D + T++      + +  + T+K          L   ++E++++  +    NII ++G            T   P  +L+ EY +  +L EFL A       Y+          F+  +L EE +T  DL   A  +A G+EYL+    IHRDLA RN+L+ E+ V KI DFGLA ++   D +  TT      N  LP K +APE L  + +  +SD+WSFG+LLW++F L   + +P    P+ +L K ++     D         P      ++ I++ CW   P  RP+
Sbjct:  436 PADPK-WELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDK---------DLSDLVSEMEMMKMIGKHKNIINLLGAC----------TQGGPLYVLV-EYAAKGNLREFLRARRPPGMDYS----------FDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTT------NGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTL-GGSPYPGI--PVEELFKLLKEGHRMDK--------PASCTHDLYMIMRECWHAVPSQRPT 716          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 123.635 bits (309), Expect = 4.039e-28
Identity = 96/327 (29.36%), Postives = 158/327 (48.32%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELET-DNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D K W +S +R+ +   +G+G +G++   + I  D + T++      + +  + T+K          L   ++E++++  +    NII ++G            T   P  +L+ EY +  +L EFL A       Y+          F+  +L EE +T  DL   A  +A G+EYL+    IHRDLA RN+L+ E+ V KI DFGLA ++   D +  TT      N  LP K +APE L  + +  +SD+WSFG+LLW++F L   + +P    P++ L     +L     R  +  P      ++ I++ CW   P  RP+
Sbjct:  456 PADPK-WELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDK---------DLSDLVSEMEMMKMIGKHKNIINLLGAC----------TQGGPLYVLV-EYAAKGNLREFLRARRPPGMDYS----------FDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTT------NGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTL-GGSPYPGI--PVEEL----FKLLKEGHR--MDKPASCTHDLYMIMRECWHAVPSQRPT 736          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 123.635 bits (309), Expect = 4.039e-28
Identity = 96/327 (29.36%), Postives = 158/327 (48.32%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELET-DNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D K W +S +R+ +   +G+G +G++   + I  D + T++      + +  + T+K          L   ++E++++  +    NII ++G            T   P  +L+ EY +  +L EFL A       Y+          F+  +L EE +T  DL   A  +A G+EYL+    IHRDLA RN+L+ E+ V KI DFGLA ++   D +  TT      N  LP K +APE L  + +  +SD+WSFG+LLW++F L   + +P    P++ L     +L     R  +  P      ++ I++ CW   P  RP+
Sbjct:  456 PADPK-WELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDK---------DLSDLVSEMEMMKMIGKHKNIINLLGAC----------TQGGPLYVLV-EYAAKGNLREFLRARRPPGMDYS----------FDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTT------NGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTL-GGSPYPGI--PVEEL----FKLLKEGHR--MDKPASCTHDLYMIMRECWHAVPSQRPT 736          
BLAST of Fibroblast growth factor receptor 1 vs. UniProt/SwissProt
Match: sp|Q5MD89|VGFR3_DANRE (Vascular endothelial growth factor receptor 3 OS=Danio rerio OX=7955 GN=flt4 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 3.673e-30
Identity = 102/350 (29.14%), Postives = 162/350 (46.29%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKG-ILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPY--------TKLRKF---------SQQPDFNG-----IKLDE----EITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D  +W IS  R+++   +G G +G++ +  I      +S   VA+K        ++ K +          M+E+KIL  +    N++ ++G     NG            ++I+EY    +L+ FL A    F PY        +++R+            QP  +      + +D+     +T+ DL   +  +A G+E+L+    IHRDLA RNILL EN V KICDFGLA ++  D        +   N  LP K +APE +  K +  +SD+WSFG+LLW++F+L   + +P  +   D  K    RL D      +  P  A   I+ I+  CW   P  RP+
Sbjct:  853 PYDSSQWEISRDRLRLGKVLGHGAFGKVIEASIFGHDKKSSANTVAVKMLKEGATASEHKAL----------MSELKILIHIGNHLNVVNLLGACTKPNG----------PLMVIVEYCKYGNLSNFLRAKREFFLPYRDRSPKTQSQVRRMIEAGQASQSEHQPSTSSTNPPRVTVDDLWKTPLTIEDLICYSFQVARGMEFLASRKCIHRDLAARNILLSENNVVKICDFGLARDIYKD-----PDYVRKGNARLPLKWMAPESIFDKVYTSQSDVWSFGVLLWEIFSL-GASPYPGIQIDEDFCK----RLKDGTR---MRAPDNASPEIYGIMLACWQGEPRERPT 1169          
BLAST of Fibroblast growth factor receptor 1 vs. UniProt/SwissProt
Match: sp|Q61851|FGFR3_MOUSE (Fibroblast growth factor receptor 3 OS=Mus musculus OX=10090 GN=Fgfr3 PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 7.977e-28
Identity = 95/327 (29.05%), Postives = 157/327 (48.01%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELET-DNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D K W +S +R+ +   +G+G +G++   + I  D + T++      + +  + T+K          L   ++E++++  +    NII ++G            T   P  +L+ EY +  +L EFL A       Y+          F+  +L EE +T  DL   A  +A G+EYL+    IHRDLA RN+L+ E+ V KI DFGLA ++   D +  TT      N  LP K +APE L  + +  +SD+WSFG+LLW++F     + +P    P++ L     +L     R  +  P      ++ I++ CW   P  RP+
Sbjct:  454 PADPK-WELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDK---------DLSDLVSEMEMMKMIGKHKNIINLLGAC----------TQGGPLYVLV-EYAAKGNLREFLRARRPPGMDYS----------FDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTT------NGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTPGGPSPYPGI--PVEEL----FKLLKEGHR--MDKPASCTHDLYMIMRECWHAVPSQRPT 735          
BLAST of Fibroblast growth factor receptor 1 vs. UniProt/SwissProt
Match: sp|P35969|VGFR1_MOUSE (Vascular endothelial growth factor receptor 1 OS=Mus musculus OX=10090 GN=Flt1 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.989e-27
Identity = 127/563 (22.56%), Postives = 231/563 (41.03%), Query Frame = 1
Query: 2014 SGTYICEQKD-SIGNSVIKSYLIIKILQGIIPHIYQHNSEWKYIPGQNIHVSFQIVSFPPAKVEYFQLLSNDKKELFFQNRSDIRSHKFSNLTHSTFSIKFINIGQNDSGEYVLESSNIFGKNSTKFFLKFIISKGSSTI-YYTISGACXXXXXXXXXXX---KFCERSGYAVPIIQIQNSMYKSFDCDSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEF------SPYTKLRKFSQQPDF---------------------------NGIKLDEE--------ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            SGTY C  ++   G  +++   ++ +     PH+ Q+ S+++     +  +  Q    P  ++ +F+            N   I+      L     ++    + + D G Y   ++N  G   +  +L    +   S +   T++  C+   +  +LL    +  +RS   V    +   M    D D + L       P D  +W  +  R+K+   +G+G +G++ +         +  F   K P       K  +           M E+KIL+ +    N++ ++G    + G            ++I+EY    +L+ +L +    F      + + +L+K S +P                             + ++ DE+        +T+ DL   +  +A G+E+LS    IHRDLA RNILL EN V KICDFGLA     D + +  Y +   +  LP K +APE +  K +  KSD+WS+G+LLW++F+L   + +P  +   D    ++  +        +  P+ A   I+ I+  CW   P  RP
Sbjct:  632 SGTYACRARNIYTGEDILRKTEVL-VRDSEAPHLLQNLSDYEVSISGSTTLDCQARGVPAPQITWFK------------NNHKIQQEPGIILGPGNSTLFIERVTEEDEGVYRCRATNQKGAVESAAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFIRKLKRSSSEVKTDYLSIIM----DPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGKVVQ---------ASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTKQGG----------PLMVIVEYCKYGNLSNYLKSKRDLFCLNKDAALHMELKKESLEPGLEQGQKPRLDSVSSSSVTSSSFPEDRSVSDVEGDEDYSEISKQPLTMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLA----RDIYKNPDY-VRRGDTRLPLKWMAPESIFDKVYSTKSDVWSYGVLLWEIFSL-GGSPYPGVQMDEDFCSRLKEGM-------RMRTPEYATPEIYQIMLDCWHKDPKERP 1145          
BLAST of Fibroblast growth factor receptor 1 vs. UniProt/SwissProt
Match: sp|P18460|FGFR3_CHICK (Fibroblast growth factor receptor 3 OS=Gallus gallus OX=9031 GN=FGFR3 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.103e-27
Identity = 93/330 (28.18%), Postives = 158/330 (47.88%), Query Frame = 1
Query: 2587 LWPDPLDRKRWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEE-ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            L PDP    +W ++ SR+ +   +G+G +G++   + I  D +  ++      + +  + T+K          L   ++E++++  +    NII ++G             T++    +++EY S  +L E+L A       Y+          F+  KL EE +T  DL   A  +A G+EYL+    IHRDLA RN+L+ E+ V KI DFGLA ++   ++        T N  LP K +APE L  + +  +SD+WSFG+LLW++F L     +P    P++ L     +L     R  +  P      ++ I++ CW   P  RP+
Sbjct:  453 LPPDP----KWELARSRLTLGKPLGEGCFGQVVMAEAIGIDKDKPNKAITVAVKMLKDDATDK---------DLSDLVSEMEMMKMIGKHKNIINLLGAC-----------TQDGPLYVLVEYASKGNLREYLRARRPPGMDYS----------FDTCKLPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKK-----TTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSP-YPGI--PVEEL----FKLLKEGHR--MDKPANCTHDLYMIMRECWHAVPSQRPT 734          
BLAST of Fibroblast growth factor receptor 1 vs. UniProt/SwissProt
Match: sp|P17948|VGFR1_HUMAN (Vascular endothelial growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FLT1 PE=1 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 7.315e-27
Identity = 99/370 (26.76%), Postives = 159/370 (42.97%), Query Frame = 1
Query: 2554 FDCDSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENG-------------VENYDTTK--------------EPTTLLI---LEYYSNRSLNEFLLAHSVEFSPYTKLRKFS---QQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
             D D + L       P D  +W  +  R+K+   +G+G +G++ +         +  F   K P       K  +           M E+KIL+ +    N++ ++G    + G             + NY  +K              EP    +   LE      L+    + S   S + + +  S   ++ D +G    E IT+ DL   +  +A G+E+LS    IHRDLA RNILL EN V KICDFGLA     D + +  Y +   +  LP K +APE +  K +  KSD+WS+G+LLW++F+L   + +P  +   D    +R  +        +  P+ +   I+ I+  CW   P  RP
Sbjct:  799 MDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGKVVQ---------ASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTKQGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTSSESFASSGFQEDKSLSDVEEEEDSDGF-YKEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLA----RDIYKNPDY-VRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSL-GGSPYPGVQMDEDFCSRLREGM-------RMRAPEYSTPEIYQIMLDCWHRDPKERP 1145          
BLAST of Fibroblast growth factor receptor 1 vs. TrEMBL
Match: A0A504YAX2 (Macrophage colony-stimulating factor 1 receptor OS=Fasciola gigantica OX=46835 GN=FGIG_05267 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.091e-38
Identity = 113/365 (30.96%), Postives = 171/365 (46.85%), Query Frame = 1
Query: 2614 RWTISPSRVKI-NTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEF-SPYTKLRKFSQQP------DFNGIKLDEE------------------------------ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIEL---ETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLL----KYIRSRLFDNELRDFLLIPKCA-DSSIWDIIKMCWAFHPVNRPSA 3570
            RW I    V++  T +G G+YGR+ KG   + +  +   V I   I +              S  C  NEI+ILS LT   N+ +M+G  V        D +    T L+LEY  +RSL EF+  H+       T+ +K S           NG  L  E                              +T   L ++A GIANG+++L+   IIHRDLATRN+L+D + +P+ICDFGLA+ +   + +     +Y+I ++ K LPF+IL  E L  ++F L SD+W  GLL WQ+F+LE +  F    +  DL+     + R      +    L+ P+   D  +W+++   W   P  RP+A
Sbjct:   72 RWHIPADYVELTGTRLGLGHYGRVIKGWYVESHVAAHTAVRIPVAIKTASEEMS--------SSQCLRNEIQILSGLTDGPNVARMLGLIVGSR----RDLSD---TYLVLEYCEHRSLAEFVRKHASHLIGTDTRAQKTSIHSCDSGVYSMNGTDLGTERTSPKDTPPVDVVTSIPAKLATAELNLTYRLTQQTLYELAWGIANGVDFLARSGIIHRDLATRNVLVDVHYIPRICDFGLAVRVVRTDAETIRDDSYRITSFQKQLPFRILPLEALREQTFYLASDVWEMGLLFWQLFHLESKKPFMHARSAEDLVLQLELHFRVNQNPTQAPVALVRPRLVQDDDLWNMMCRAWQADPKQRPAA 421          
BLAST of Fibroblast growth factor receptor 1 vs. TrEMBL
Match: A0A2H1C7G0 (Protein tyrosine kinase OS=Fasciola hepatica OX=6192 GN=D915_09569 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.434e-35
Identity = 114/365 (31.23%), Postives = 171/365 (46.85%), Query Frame = 1
Query: 2614 RWTISPSRVKI-NTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEF-SPYTKLRKFSQQP------DFNGIKLDEE------------------------------ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIEL---ETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRS--RLFDNELRD--FLLIPK-CADSSIWDIIKMCWAFHPVNRPSA 3570
            RW I    V++  T +G G+YGR+ KG   + +  +   V I   I +              S  C  NEI+ILS LT   N+ +M+G  V        D +    T L+LEY  +RSL EF+  H+       T+ +K S           NG  L  E                              +T   L ++A GIANG+++L+   IIHRDLATRN+L+D +  P+ICDFGLA+ +   + +     +Y+I ++ K LPF+IL  E L  ++F L SD+W  GLL WQ+F+LE +  F    +  DL+  +    R+  N  +    L+ P+   D  +W ++   W   P  RP+A
Sbjct:  717 RWHIPADYVELTGTRLGLGHYGRVIKGWYVESHVAAHTAVRIPVAIKTASEEMS--------SSQCLRNEIQILSGLTDGPNVARMLGLIVGSR----RDLSD---TYLVLEYCEHRSLAEFVRKHASHLIGTDTRAQKTSIHSYDSGVYSMNGTDLGTERTSPKDVPPVDVITSIPTKLATAELNLTYRLTQQTLYELAWGIANGVDFLARSGIIHRDLATRNVLVDVHYTPRICDFGLAVRVVRTDAETIRDDSYRITSFQKQLPFRILPLEALREQTFYLASDVWEMGLLFWQLFHLESKKPFMHARSAEDLVLQLELHFRINQNPTQAPVALVRPRLVQDDDLWHMMCRAWQADPKQRPAA 1066          
BLAST of Fibroblast growth factor receptor 1 vs. TrEMBL
Match: A0A4E0R3Y7 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_006326 PE=3 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 3.232e-35
Identity = 113/365 (30.96%), Postives = 174/365 (47.67%), Query Frame = 1
Query: 2614 RWTISPSRVKI-NTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEF-SPYTKLRKFSQQP------DFNGIKLDEE------------------------------ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIEL---ETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKY--IRSRLFDNELRD--FLLIPK-CADSSIWDIIKMCWAFHPVNRPSA 3570
            RW I    V++  T +G G+YGR+ KG   + +  +    A++ P+     ++         S  C  NEI+ILS LT   N+ +M+G  V        D +    T L+LEY  +RSL EF+  H+       T+ +K S           NG  L  E                              +T   L ++A GIANG+++L+   IIHRDLATRN+L+D +  P+ICDFGLA+ +   + +     +Y+I ++ K LPF+IL  E L  ++F L SD+W  GLL WQ+F+LE +  F    +  DL+    +  R+  N  +    L+ P+   D  +W ++   W   P  RP+A
Sbjct: 1066 RWHIPADYVELTGTRLGLGHYGRVIKGWYVESHVAAH--TAVRIPVAIKTASEEMS------SSQCLRNEIQILSGLTDGPNVARMLGLIVGSR----RDLSD---TYLVLEYCEHRSLAEFVRKHASHLIGTDTRAQKTSIHSYDSGVYSMNGTDLGTERTSPKDVPPVDVITSIPTKLATAELNLTYRLTQQTLYELAWGIANGVDFLARSGIIHRDLATRNVLVDVHYTPRICDFGLAVRVVRTDAETIRDDSYRITSFQKQLPFRILPLEALREQTFYLASDVWEMGLLFWQLFHLESKKPFMHARSAEDLVLQLELHFRINQNPTQAPVALVRPRLVQDDDLWHMMCRAWQADPKQRPAA 1415          
BLAST of Fibroblast growth factor receptor 1 vs. TrEMBL
Match: A0A183ADI3 (Protein kinase domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5018 PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.547e-35
Identity = 111/384 (28.91%), Postives = 179/384 (46.61%), Query Frame = 1
Query: 2554 FDCDSIQLLTHLWPDPLDRKRWTISPSRVKINT-EIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPT-TLLILEYYSNRSLNEFLLAHSVEFSPY-TKLRKFSQQP------DFNGIKLDEE----------------------------ITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIEL---ETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFD-----NELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPSA 3570
             + D+++ L +L        RW I    V++    +G G+YGR+ KG  T+        V +   I +              S  C  NEI+IL  L+  +NI +M+G  V         T ++ + T L+LEY  +RSL EF+  H+ + +    + +K S           NG  L  +                            +T   L ++A GIANG+++L+   IIHRDLATRN+L+D    P+ICDFGLA+ +   +++     +Y+I ++ K LPF+IL  E L  ++F L SD+W  GLL WQ+F+LE +  F    +  DL+  ++    +      +    L+ P+  D  +W ++   W   P  RP+A
Sbjct:  691 IESDAVRELVYLLGSVEQLFRWHIPKDCVEVTGLHLGLGHYGRVIKGWYTEPQVAPHSPVRVPVAIKTASEELS--------SSQCLRNEIQILPGLSEGANIARMLGLIV--------GTRRDLSDTYLVLEYCEHRSLAEFVRKHASQLTGTDNRAQKTSIHSCDSGVYSMNGTDLGTDPTIPKEAVSVDFTNAPHSCMTESNPSYRLTYQTLYELAWGIANGVDFLARSGIIHRDLATRNVLVDACHTPRICDFGLAVRIVRTDSETIRDESYRITSFQKQLPFRILPLEALREQTFYLASDVWELGLLFWQLFHLESKKPFVHVRSAEDLVLQLQIHFRNCTNTTAQAPPALVRPRLVDDELWYMMCRAWQADPKRRPTA 1058          
BLAST of Fibroblast growth factor receptor 1 vs. TrEMBL
Match: H2KS89 (Macrophage colony-stimulating factor 1 receptor OS=Clonorchis sinensis OX=79923 GN=CLF_108497 PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 5.138e-35
Identity = 123/360 (34.17%), Postives = 175/360 (48.61%), Query Frame = 1
Query: 2653 EIGKGNYGRIFKGILTD-FNSTSQQFVAIKQPILSNQTNKGKQIHFCQ---ISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFS-----------------QQPDF-----------NGIK---------------LDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELE-----TDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRD--FLLIPKCADSSIWDIIKMCWAFHPVNRPSA 3570
             IG G+YG+I KG L+  F  T +QF  +   I S+ T     I        SL C +NE+ +LS L+   N+ +MIG  +   G +    T    TLLILEY S++SLNEFL   + +   + + +K S                  +PD             G+K                ++ IT+ DL   A GIA+G+ YL+   +IHRDLATRNIL+D+   PKI DFGLA+ +      T    S +Y+II+  K LPF+IL PE L  + F L SDIW F LLLWQMF+LE +  F       +LL+ I +    +  +    L  P+     +W+++   W      RP+A
Sbjct: 1063 RIGLGHYGQISKGWLSPAFLKTYRQFGNM---ITSDDTLVAVAIKSASEEASSLTCLLNEMSVLSNLSQNKNVAQMIGILI---GTQ----TDLSDTLLILEYCSHKSLNEFLRESADQLKNHERRQKSSINSYDSGVHSLTEADVGGRPDSENGESKIPRHDGGLKSPKILSDWRTVSTGRTEQHITLFDLYCFAHGIASGVVYLAVEGVIHRDLATRNILVDQFLTPKISDFGLAVRINASTTTTVGQQSDSYRIISPRKQLPFRILPPEALGEQMFYLASDIWEFSLLLWQMFHLEVKQPFSQVNTATELLELITTDSNSSYPKHPPSLDRPRLVHDELWNLMCQAWEVDYRLRPTA 1412          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Cavefish
Match: flt4 (fms-related tyrosine kinase 4 [Source:NCBI gene;Acc:30121])

HSP 1 Score: 125.561 bits (314), Expect = 1.873e-28
Identity = 101/353 (28.61%), Postives = 163/353 (46.18%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKG-ILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEY--YSN-----RSLNEFLLAHSVEFSPYTK-------------LRKFSQQPDFNG---IKLDE----EITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLI--PKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D  +W I   R+++   +G G +G++ +  I       S   VA+K        ++ K +          M+E+KIL  +    N++ ++G     +G            ++++EY  Y N     R+  EF L +  + SP T+             LR      + N    +++D+     +T+ DL   +  +A G+E+L+    IHRDLA RNILL EN V KICDFGLA ++  D        +   N  LP K +APE +  K +  +SD+WSFG+LLW++F+L   + +P  +   D         F N+L+D   +  P  A   I+ I+  CW   P  RP+
Sbjct:  817 PYDSSQWEIQRDRLRLGKVLGHGAFGKVIEASIYGSDKKCSFGTVAVKMLKEGATASEHKAL----------MSELKILIHIGNHLNVVNLLGACTKPSG----------PLMVVVEYCKYGNLSNYLRTKREFFLPYR-DRSPKTQSQVRRMIEAGQMELRDRQTHSNINSTKNLRVDDLWKTPLTIEDLICYSFQVARGMEFLASRKCIHRDLAARNILLSENNVVKICDFGLARDIYKD-----PDYVRKGNARLPLKWMAPESIFDKVYTSQSDVWSFGVLLWEIFSL-GASPYPGVQIDED---------FCNQLKDGTRMRSPDTASPEIYGIMLACWQGEPRERPT 1133          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Cavefish
Match: CSF1R (colony stimulating factor 1 receptor [Source:HGNC Symbol;Acc:HGNC:2433])

HSP 1 Score: 123.25 bits (308), Expect = 3.652e-28
Identity = 95/359 (26.46%), Postives = 166/359 (46.24%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQ-QFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHS---------------------VEFSPYTKLRKFSQQ-----------PDFNGIKLDEEITVLDLK---KIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            P + ++W     R+     +G G +G++ +  +   +       VA+K  +L +  +  ++        +  M+E+KILS L   +NI+ ++G             T+    LLI EY S+  L  FL   +                     V  SP  ++   S Q            +F G   D    +LDL    + +  +A GL++L+  + IHRD+A RN+L+ E+ V KICDFGLA ++     M+ +  ++  N  LP K ++PE +    + ++SD+WS+G+LLW++F+L + + +PD        K I++          +  P  A   I+ I+KMCW+  P +RP+
Sbjct:  360 PYNSRKWEFPRDRLTFGQVLGAGAFGKVVEATVYGLDKDDHVTKVAVK--MLKSSAHSEEK--------EALMSELKILSHLGPHANIVNLLGAC-----------TQGGPVLLITEYCSHGDLLNFLRRRAEVFLNSVLQECDLNSSYKNLPVHQSPDKRISNISYQDMSGRRGRDGSQEFCGEGQDNSW-MLDLDHLLRFSSQVAQGLDFLAAKNCIHRDVAARNVLVTEDWVVKICDFGLARDI-----MNDSNYVVRGNARLPVKWMSPESIFECIYTVQSDVWSYGILLWEIFSLGR-SPYPDVAVNARFYKMIKAGY-------HMTQPDFAPLEIYTIMKMCWSLEPTSRPT 683          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Cavefish
Match: kitb (KIT proto-oncogene, receptor tyrosine kinase b [Source:ZFIN;Acc:ZDB-GENE-050916-2])

HSP 1 Score: 122.479 bits (306), Expect = 9.817e-28
Identity = 95/367 (25.89%), Postives = 169/367 (46.05%), Query Frame = 1
Query: 2563 DSIQLLTHLWPDPLD---RKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNST-SQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEY--------YSNRSLNEFLLAHSVE--------------------FSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            DSI   ++ + DP       +W     R++    +G G +G++         S  +   VA+K    S  + +           +  M+E+K+LS L    NI+ ++G            T + PT L+I EY        +  R  + F  + + +                    + P    +K S Q ++   K D  +   DL   +  +A G+++L+  + IHRDLA RN+LL   +V KICDFGLA ++  D     +  ++  N  LP K ++PE L S  +  +SD+WS+G+LLW++F+L   + +P    P+  + Y   ++  +  R  +  P+ A S I+++++ CW+  P+ RP+
Sbjct:  555 DSIHGNSYTYIDPTQLPYDPKWEFPRERLRFGKILGSGAFGKVVAATAYGLCSPDTVTTVAVKMLKPSAHSTEK----------EALMSELKVLSYLGNHMNIVNLLGAC----------TVRGPT-LVITEYCCYGDLLNFLRRKRDAFFSSKTGDGYYKNLLSQTQPSREGTDNGYMPMRSYQKRSNQTEWIDDKDDLSLDTEDLLSFSYQVAKGMDFLTSKNCIHRDLAARNVLLTHGRVAKICDFGLARDITKD-----SNYVLRGNARLPVKWMSPESLFSCVYTFESDVWSYGILLWEIFSL-GNSPYPGV--PVGSMFY---KMIQDGYR--MSEPEFAPSEIYEVMRWCWSADPLKRPT 887          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Cavefish
Match: flt4 (fms-related tyrosine kinase 4 [Source:NCBI gene;Acc:30121])

HSP 1 Score: 120.939 bits (302), Expect = 3.981e-27
Identity = 102/366 (27.87%), Postives = 162/366 (44.26%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKG-ILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEY--YSN-----RSLNEFLLAHSVEFSPYTK-------------LRKFSQQPDFNGIK----------------LDE----EITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLI--PKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D  +W I   R+++   +G G +G++ +  I       S   VA+K        ++ K +          M+E+KIL  +    N++ ++G     +G            ++++EY  Y N     R+  EF L +  + SP T+             LR      + N  K                +D+     +T+ DL   +  +A G+E+L+    IHRDLA RNILL EN V KICDFGLA ++  D        +   N  LP K +APE +  K +  +SD+WSFG+LLW++F+L   + +P  +   D         F N+L+D   +  P  A   I+ I+  CW   P  RP+
Sbjct:  849 PYDSSQWEIQRDRLRLGKVLGHGAFGKVIEASIYGSDKKCSFGTVAVKMLKEGATASEHKAL----------MSELKILIHIGNHLNVVNLLGACTKPSG----------PLMVVVEYCKYGNLSNYLRTKREFFLPYR-DRSPKTQSQVRRMIEAGQMELRDRQTHSNINSTKNLRGKTSPSSPPSEEKMDDLWKTPLTIEDLICYSFQVARGMEFLASRKCIHRDLAARNILLSENNVVKICDFGLARDIYKD-----PDYVRKGNARLPLKWMAPESIFDKVYTSQSDVWSFGVLLWEIFSL-GASPYPGVQIDED---------FCNQLKDGTRMRSPDTASPEIYGIMLACWQGEPRERPT 1178          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Cavefish
Match: flt4 (fms-related tyrosine kinase 4 [Source:NCBI gene;Acc:30121])

HSP 1 Score: 120.939 bits (302), Expect = 4.842e-27
Identity = 102/366 (27.87%), Postives = 162/366 (44.26%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKG-ILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEY--YSN-----RSLNEFLLAHSVEFSPYTK-------------LRKFSQQPDFNGIK----------------LDE----EITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLI--PKCADSSIWDIIKMCWAFHPVNRPS 3567
            P D  +W I   R+++   +G G +G++ +  I       S   VA+K        ++ K +          M+E+KIL  +    N++ ++G     +G            ++++EY  Y N     R+  EF L +  + SP T+             LR      + N  K                +D+     +T+ DL   +  +A G+E+L+    IHRDLA RNILL EN V KICDFGLA ++  D        +   N  LP K +APE +  K +  +SD+WSFG+LLW++F+L   + +P  +   D         F N+L+D   +  P  A   I+ I+  CW   P  RP+
Sbjct:  805 PYDSSQWEIQRDRLRLGKVLGHGAFGKVIEASIYGSDKKCSFGTVAVKMLKEGATASEHKAL----------MSELKILIHIGNHLNVVNLLGACTKPSG----------PLMVVVEYCKYGNLSNYLRTKREFFLPYR-DRSPKTQSQVRRMIEAGQMELRDRQTHSNINSTKNLRGKTSPSSPPSEEKMDDLWKTPLTIEDLICYSFQVARGMEFLASRKCIHRDLAARNILLSENNVVKICDFGLARDIYKD-----PDYVRKGNARLPLKWMAPESIFDKVYTSQSDVWSFGVLLWEIFSL-GASPYPGVQIDED---------FCNQLKDGTRMRSPDTASPEIYGIMLACWQGEPRERPT 1134          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009485.1 (pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 1.451e-26
Identity = 78/318 (24.53%), Postives = 149/318 (46.86%), Query Frame = 1
Query: 2617 WTISPSRVKINTEIGKGNYGRIFKGILTDF-NSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            W +   +VK+  E+G+G +G +++G+         +  VAIK     N+T   ++ +        F+NE  ++     C ++++++G             ++    L+I+E  +   L  +L +   +   +T+     ++P      L E      + ++A  IA+G+ YL+    +HRDLA RN ++ E+   KI DFG+     T +   T Y        LP + ++PE L+   F   SD+WSFG++LW++   + E  +    N   +LK++     D  L   L++P      + ++I+ CW ++P  RP+
Sbjct:    6 WEVERDKVKMMRELGQGTFGMVYEGLARGIVKGEDETRVAIKT---VNETATMRERY-------EFLNEASVMKSFN-CHHVVRLLGV-----------VSQAQPILVIMELMTRGDLKSYLRSLRPDAEDFTETIVLEKKPTRPPSSLPE------MLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGM-----TRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIAT-QAEQPYQGLSNE-QVLKFV----MDGGL---LVLPPACPERLQELIRKCWQYNPRMRPT 281          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Sea Lamprey
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 113.62 bits (283), Expect = 5.284e-26
Identity = 93/356 (26.12%), Postives = 171/356 (48.03%), Query Frame = 1
Query: 2512 AVPIIQIQNSMYKSFDCDSIQLLTH--LWPDPLDRKRWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            +VP++ ++   + S D  ++  ++   L  DP    RW  S   + +   +G+G +G++   + +  D    ++      + +  + T+K          L   ++E++++  +    NII ++G             T+     +I+E+ +  +L EFL A     + YT    F       G    E++++ +L      +A G+EYL+    IHRDLA RN+L+ ++ V KI DFGLA ++   N++   Y   T N  LP K +APE L  + +  +SD+WSFG+LLW++F L   + +P    P++ L     +L     R  +  P    + ++ ++K CWA  P +RP+
Sbjct:  237 SVPLV-MRGGRFSSGDSPTLAGVSEYELTEDP----RWEFSREWLTLGKPLGEGCFGQVVMAEALGIDKEKPNRSLRVAVKMLKEDATDK---------DLYDLVSEMEMMKNIGKHKNIINLLGAC-----------TQGGPLYVIVEFAAKGNLREFLRARRPPGTEYT----FEGAAAAQG----EQLSIKELVSFTYQVARGMEYLASKKCIHRDLAARNVLVTDDNVMKIADFGLARDV---NYID--YYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTL-GGSPYPGI--PVEEL----FKLLKEGHR--MDRPALCSTELYMMMKDCWAAVPSHRPT 545          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004131.1 (pep scaffold:Pmarinus_7.0:GL490249:322:4273:1 gene:ENSPMAG00000003774.1 transcript:ENSPMAT00000004131.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 1.476e-25
Identity = 83/321 (25.86%), Postives = 137/321 (42.68%), Query Frame = 1
Query: 2617 WTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLA---IELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDF--ENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            W +  S +K+   +G+GN+G +++G   D    + + V         +TN          S D FM E+K +                  EN ++ Y   KE     I+                 E  PY  +  +         +   E++ ++   +A GIA+G+ YLS    IH DLA RNIL+ ++ + K+ DFGL+    E++T+ +   T  ++      PF+ +APEVL    F  KSD+WSFG+LL+++F   +     D   +   DL+K              L  P    + ++ I++ CW F    RP
Sbjct:   10 WHVPRSSIKMGNLLGRGNFGEVYEGRWNDTTDVAIKIV---------RTNS---------SFDTFMKEVKTMISFK-------------HENVLQIYAVCKEKWPYWIV----------------TELVPYGNMLHYLG-------RFGHELSEVERLYMAFGIASGMAYLSKKRCIHCDLAGRNILMGQHNICKVADFGLSHKLKEMDTEEYYDATGHVV------PFQWMAPEVLIQLKFTRKSDVWSFGVLLYELFTDGKRPYAGDLGAQQVQDLIK----------CGGRLKRPDACPNVVYHIMQRCWNFEHRKRP 260          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Sea Lamprey
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 111.694 bits (278), Expect = 1.970e-25
Identity = 77/265 (29.06%), Postives = 127/265 (47.92%), Query Frame = 1
Query: 2614 RWTISPSRVKINTEIGKGNYGRIF--KGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLD---EEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELET-DNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNL 3390
            RW     R+ +   +G+G +G++    G+  D    ++      + +  + T+K          L   ++E++++  +    NII ++G             T++    +I+EY S  +L E+L A       Y+          F+ I      E++T  DL   A  +A G+EYL+    IHRDLA RN+L+ E+ V KI DFGLA ++   D +  TT      N  LP K +APE L  + +  + D+WSFG+LLW++F L
Sbjct:  324 RWEFPRDRLTLGKPLGEGCFGQVVMADGLGVDKEKPNKPATVAVKMLKDDATDK---------ELSDLVSEMEVMKMIGKHKNIINLLGAC-----------TQDGPLYVIVEYASKGNLREYLRARRPPGVGYS----------FDPIGYSDPSEQLTFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTT------NGRLPVKWMAPEALFDRVYTHQCDVWSFGVLLWEIFTL 552          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004129.1 (pep scaffold:Pmarinus_7.0:GL490249:304:4500:1 gene:ENSPMAG00000003774.1 transcript:ENSPMAT00000004129.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 2.181e-25
Identity = 85/317 (26.81%), Postives = 138/317 (43.53%), Query Frame = 1
Query: 2617 WTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENP-IDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            W +  S +K+   +G+GN+G +++G   D    + + V         +TN          S D FM E+K +                  EN ++ Y   KE     I+                 E  PY  +  +         +   E++ ++   +A GIA+G+ YLS    IH DLA RNIL+ ++ + K+ DFGL+ +L+ + + +T +        +PF+ +APEVL    F  KSD+WSFG+LL++        LF D + P  D+ K     L     R  L  P    + ++ I++ CW F    RP
Sbjct:   16 WHVPRSSIKMGNLLGRGNFGEVYEGRWNDTTDVAIKIV---------RTNS---------SFDTFMKEVKTMISFK-------------HENVLQIYAVCKEKWPYWIV----------------TELVPYGNMLHYLG-------RFGHELSEVERLYMAFGIASGMAYLSKKRCIHCDLAGRNILMGQHNICKVADFGLSHKLKEEYYDATGH-------VVPFQWMAPEVLIQLKFTRKSDVWSFGVLLYE--------LFTDGKRPYADMDKQQVQDLIKCGGR--LKRPDACPNVVYHIMQRCWNFEHRKRP 261          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 73.9442 bits (180), Expect = 6.443e-14
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 1
Query: 3049 GIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFN----LEQETLFPDFENPIDLLKYIRSRLFDNELRD 3480
            G ++ E++    L KIA  +  GL YL    +IHRD+  +NILL+EN   K+CDFG  +  E  N ++TT+   ++        +APE ++ + + + SD+WS GL + ++ N       E +  +   P +LL +I +  F  EL+D
Sbjct:  318 GGRISEKV----LGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFG--VSGEAVNSLATTFTGTSF-------YMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCSSEKMAANIA-PFELLMWILT--FTPELKD 449          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Yeast
Match: STE7 (Signal transducing MAP kinase kinase; involved in pheromone response where it phosphorylates Fus3p; involved in the pseudohyphal/invasive growth pathway where it phosphorylates of Kss1p; phosphorylated by Ste11p; degraded by ubiquitin pathway [Source:SGD;Acc:S000002318])

HSP 1 Score: 72.4034 bits (176), Expect = 2.049e-13
Identity = 73/296 (24.66%), Postives = 136/296 (45.95%), Query Frame = 1
Query: 2653 EIGKGNYGRIFKGI-LTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYL-SGFSIIHRDLATRNILLDENKVPKICDFGLAIEL---ETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQM----FNLEQETLFPDFENPIDLLKYI---------RSRLFDNELRDFL 3486
            +IG GN G + K + + D    +++ + ++Q   +N T            ++  + E+ I+  +    NII   G A +   + N         ++++EY    SL++ L  +          ++F Q+   +  K       L + KIA G+ NGL++L   + IIHRD+   N+L++     K+CDFG++ +L     D F+ T+    TY        ++PE ++   + +K D+WS GL++ ++    F L      PD    +DLL+ I         + R++  E+ DF+
Sbjct:  196 KIGAGNSGTVVKALHVPDSKIVAKKTIPVEQ---NNST-----------IINQLVRELSIVKNVKPHENIITFYG-AYYNQHINN-------EIIILMEYSDCGSLDKILSVY----------KRFVQRGTVSSKKT--WFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSIADTFVGTS----TY--------MSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPD--GILDLLQRIVNEPSPRLPKDRIYSKEMTDFV 443          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 70.8626 bits (172), Expect = 1.036e-12
Identity = 80/289 (27.68%), Postives = 112/289 (38.75%), Query Frame = 1
Query: 2656 IGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMF-------NLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKC 3501
            IG+G+YG ++K I    N  + Q VAIK+ +  N              L+  M EI +L  L   +NI+K  G        E Y         ++LEY +N SL   +   S   S        +Q             T+L           GL+YL G  +IHRD+   NILL  +   K+ DFG          +ST         A     +APE+L ++     SDIWS G  + +M        NL    ++   EN      Y     F   L+DFL   KC
Sbjct:   31 IGRGSYGVVYKAI----NKHTDQVVAIKEVVYENDE-----------ELNDIMAEISLLKNLNH-NNIVKYHG--FIRKSYELY---------ILLEYCANGSLRRLISRSSTGLSENESKTYVTQ-------------TLL-----------GLKYLHGEGVIHRDIKAANILLSADNTVKLADFG----------VSTIVNSSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEND----TYYPPSSFSEPLKDFL--SKC 252          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 68.1662 bits (165), Expect = 5.027e-12
Identity = 51/178 (28.65%), Postives = 84/178 (47.19%), Query Frame = 1
Query: 3046 NGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQM----FNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            N +K    I+   + KIA  +  GL YL    +IHRD+  +NILL+E    K+CDFG  +  E  N ++ T+   ++        +APE ++ + + +  D+WS GL L ++    F  E + +  +   PI+LL  I +  F  +L+D   +      +    I  C       RPS
Sbjct:  306 NLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFG--VSGEAVNSLAMTFTGTSF-------YMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVA-PIELLTMILT--FSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPS 471          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 66.2402 bits (160), Expect = 3.130e-11
Identity = 62/244 (25.41%), Postives = 113/244 (46.31%), Query Frame = 1
Query: 2656 IGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESK-SFCLKSDIWSFGLLLWQMF 3384
            IGKG++G ++  +    N T+ + +A+KQ  +   +++ + I     +L   ++ +K L  L    NI++ +G   FEN    Y         L LEY +  S+   +  +                      + DE +    +K +   +  GL YL    I+HRD+   N+LLD++ + KI DFG  I  ++ +  S +   +   +   F  +APE++++K  +  K DIWS G ++ +MF
Sbjct: 1181 IGKGSFGAVYLCL----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHL----NIVQYLG---FENKNNIYS--------LFLEYVAGGSVGSLIRMYG---------------------RFDEPL----IKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFG--ISRKSKDIYSNSDMTM---RGTVF-WMAPEMVDTKQGYSAKVDIWSLGCIVLEMF 1374          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Nematostella
Match: EDO38078 (Predicted protein; Ret-like protein [Source:UniProtKB/TrEMBL;Acc:A7SE14])

HSP 1 Score: 121.324 bits (303), Expect = 5.352e-30
Identity = 91/321 (28.35%), Postives = 150/321 (46.73%), Query Frame = 1
Query: 2614 RWTISPSRVKINTEIGKGNYGRIFKGILTDF--NSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVL-ESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            +WT+   R+ I   IG G +G++ KG +     NS     VAIK P       + + +          M E ++L +L    ++IK++GC              +   L+I+EY  +  L  +L     E   Y         PD   IK    ++   L + A  +A+G++YLS   IIHRDLA RNIL+ E +V K+ DFG+A +++ ++       I T    LP K  A E L     +  +SD+WSFG++L+++  +  E  +P      D+ +Y+       E    +  P   D+++++I+  CWA  P  RP+
Sbjct:    4 QWTVPRERIHIMKVIGNGAFGQVHKGRVHGLGTNSPGWTLVAIKSPYADASDAETRDL----------MKEFELLKRLKSHPHVIKLLGCG-----------EDDGRPLVIIEYVPHGDLLGYLRKSRGEEDSY--------YPDPE-IKPKTSLSSQQLVRFAWQVADGMQYLSSQKIIHRDLAARNILVGEGEVCKVTDFGMAKDVQNEDIY-----IRTTEGRLPVKWTAIEALIGGGEYTTQSDVWSFGVVLYEICTIGGEP-YPGIAGK-DIPEYL-------EAGYRMSCPTHLDATLYEIMASCWATCPDMRPT 280          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Nematostella
Match: EDO47652 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7RLS3])

HSP 1 Score: 119.398 bits (298), Expect = 1.870e-29
Identity = 91/322 (28.26%), Postives = 157/322 (48.76%), Query Frame = 1
Query: 2617 WTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQF-VAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEI-TVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPK---CADSSIWDIIKMCWAFHPVNRPS 3567
            W +   ++K+  E+G G++G +++G  TD      +  VA+K   +S   +   +I F Q        E  I+ K   C+++++++G  V  +G        +PT L+++E   N  L  FL +H  E +                ++ DE   T+  + ++A  IA+G+ YL+    +HRDLA RN +++ N   KI DFG+     T +   T Y        LP + +APE L+   F   SD+WSFG+++W+M  L  +  +P   N  ++LKY+          D  ++PK   C D  ++D++ +CW F P  RP+
Sbjct:   11 WEVPREKIKLIRELGNGSFGMVYEGEATDIVPNKPKCKVAVK--TVSENASIRDRIEFLQ--------EASIM-KAFQCNHVVRLLG--VVSDG--------QPT-LVVMELMDNGDLKNFLRSHRPEVT----------------MESDEPPPTLQQMLQMAGEIADGMAYLAARKFVHRDLAARNCMVNANLTVKIGDFGM-----TRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTSPSDVWSFGVVMWEMATLASQP-YPGKSNE-EVLKYV---------VDGGVMPKPDDCPD-RLFDLMTLCWQFSPKARPT 277          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Nematostella
Match: EDO35594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL46])

HSP 1 Score: 116.701 bits (291), Expect = 5.233e-29
Identity = 82/253 (32.41%), Postives = 128/253 (50.59%), Query Frame = 1
Query: 2809 FMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            F+ EI ++ KL    NI+  + C+          T KEP  +L++E+     L ++L             R  S+Q D  G + DE IT  DL   +  IA G+EYLS    +HRDLA RN+L+ +NK  K+ DFGL  +L    +  + YQ  + N+ LP K ++PE +  + F  +SD+WS+G++LW++  L     +P      D+   +RS  +  E  D      C+D  ++ I+K CW   P  RP+
Sbjct:   14 FLKEISLMKKLGSHKNIVNFLCCS----------TVKEPF-MLVVEFLPKGDLLDYLR------------RNRSKQNDETGEQEDEMITPQDLLSFSYQIAAGMEYLSKKGFVHRDLAARNVLVADNKQVKVADFGLTRDL----YEESAYQGHS-NRKLPIKWMSPEAIYDQIFTTESDVWSYGVVLWEIATLGGAP-YPTISTR-DVFVMLRSG-YRMEKPDI-----CSD-EVYTIMKHCWEDQPKKRPT 229          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Nematostella
Match: EDO36551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI91])

HSP 1 Score: 114.39 bits (285), Expect = 4.273e-28
Identity = 77/280 (27.50%), Postives = 135/280 (48.21%), Query Frame = 1
Query: 2617 WTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEI-TVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRS 3453
            W +   ++    E+G+G YG++F+G + +               +S  +N        ++  D F+ EI+++ ++    NI+ M+GC           T  EP   LI+EY     L  +L           K R  S   D   +K ++++ T  DL   A  +A G+EYLS    +HRDLA RN+L+ +NKV K+ DFGL   +  D +   T      ++ LP K ++ E +  ++F  +SD+W++G+ LW++  +   T +P   N  +LL+ ++ 
Sbjct:    5 WEVPEQKIIRVEELGEGAYGKVFRGYILEVPEQ-----------VSKSSNFTNNTSVTELRAD-FLKEIQLMKEVGSHRNIVNMLGCC----------TLTEPM-FLIVEYLPYGDLLHYL----------RKRRGKSIDMDVMSVKEEDDVLTSGDLMAFAWQVAQGMEYLSKRGFVHRDLAARNVLVGDNKVAKVADFGLTRHMYEDLYQGKT------SRKLPLKWMSIEAIFDQAFTSQSDVWAYGIFLWELVTM-GGTPYPAINNR-ELLRLLKE 243          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Nematostella
Match: EDO41796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S358])

HSP 1 Score: 112.849 bits (281), Expect = 1.628e-27
Identity = 94/308 (30.52%), Postives = 147/308 (47.73%), Query Frame = 1
Query: 2650 TEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTL-LILEYYSNRSLNEFLL-AHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            T+IG+G +  +  G     N   +QFVAIK       + KG   +F +  L+  + E   +  L    NII++ G A+         T+K P  + L+ EY    SL+E L   +  EF   T+LRKFS Q                       IA+G+EYL+   ++HRDLA RN+L+ E ++ +I DFGLA  L+         Q IT  + +     APEVL+ +    K D+WS+G+LLW+M++  +    P    PI  +  I ++  + +L      PK   S +++++  CW   P +RP 
Sbjct:   11 TDIGEGFFANVALGKWIGPNK-REQFVAIK-------SIKG---NFLEDHLEDVLREADTMMSLDH-RNIIRLYGIALI--------TSKTPMGIKLVTEYAVFGSLSEILKNPNKPEFLQVTRLRKFSLQ-----------------------IADGMEYLANRHLVHRDLAARNVLVVEPELVRISDFGLAKALDQG-------QEITAGREMAIAWCAPEVLKGREVHPKCDVWSYGVLLWEMYSFGKR---PWDGIPIMQVMKIVTQQPEKKLEQ----PKACPSELYELMLHCWVHEPQDRPG 261          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Medaka
Match: flt4 (fms related tyrosine kinase 4 [Source:NCBI gene;Acc:100335137])

HSP 1 Score: 128.642 bits (322), Expect = 2.066e-29
Identity = 100/365 (27.40%), Postives = 165/365 (45.21%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFN-STSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPY--------TKLRKF----------------------------SQQPDFNGI--KLDE----EITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            P D  +W IS  R+++   +G G +G++ +      + S+S   VA+K  +L +     +            M+E+KIL  +    N++ ++G     NG            ++I+EY    +L+ FL A    F PY        +++R+                             S+ PD N    K+++     +T+ DL   +  +A G+E+L+    IHRDLA RNILL EN + KICDFGLA ++  D        +   N  LP K +APE +  K +  +SD+WSFG+LLW++F+L   + +P  +   D  K ++  +        +  P+ A   I+ I+  CW   P  RP
Sbjct:  862 PYDSSQWEISRDRLRLGKVLGHGAFGKVIEASFCGISKSSSLDTVAVK--MLKDGATASEH--------KALMSELKILIHIGNHLNVVNLLGACTKPNG----------PLMVIVEYCKYGNLSNFLRAKREFFLPYRDRSPKTQSQVRRLIEAGQTDQRARQPLPVPSSPPGSPQSASSKAPDQNCAVEKMEDLWKTPLTIEDLICYSFQVARGMEFLASRKCIHRDLAARNILLSENNIVKICDFGLARDIYKDPDY-----VRKGNARLPLKWMAPESIFDKVYTSQSDVWSFGVLLWEIFSL-GASPYPGVQIDEDFCKRLKDGV-------RMRAPETASPEIYGIMLGCWQGEPKERP 1193          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Medaka
Match: flt4 (fms related tyrosine kinase 4 [Source:NCBI gene;Acc:100335137])

HSP 1 Score: 128.642 bits (322), Expect = 2.066e-29
Identity = 100/365 (27.40%), Postives = 165/365 (45.21%), Query Frame = 1
Query: 2599 PLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFN-STSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPY--------TKLRKF----------------------------SQQPDFNGI--KLDE----EITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            P D  +W IS  R+++   +G G +G++ +      + S+S   VA+K  +L +     +            M+E+KIL  +    N++ ++G     NG            ++I+EY    +L+ FL A    F PY        +++R+                             S+ PD N    K+++     +T+ DL   +  +A G+E+L+    IHRDLA RNILL EN + KICDFGLA ++  D        +   N  LP K +APE +  K +  +SD+WSFG+LLW++F+L   + +P  +   D  K ++  +        +  P+ A   I+ I+  CW   P  RP
Sbjct:  862 PYDSSQWEISRDRLRLGKVLGHGAFGKVIEASFCGISKSSSLDTVAVK--MLKDGATASEH--------KALMSELKILIHIGNHLNVVNLLGACTKPNG----------PLMVIVEYCKYGNLSNFLRAKREFFLPYRDRSPKTQSQVRRLIEAGQTDQRARQPLPVPSSPPGSPQSASSKAPDQNCAVEKMEDLWKTPLTIEDLICYSFQVARGMEFLASRKCIHRDLAARNILLSENNIVKICDFGLARDIYKDPDY-----VRKGNARLPLKWMAPESIFDKVYTSQSDVWSFGVLLWEIFSL-GASPYPGVQIDEDFCKRLKDGV-------RMRAPETASPEIYGIMLGCWQGEPKERP 1193          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Medaka
Match: ENSORLT00000016041.2 (macrophage colony-stimulating factor 1 receptor 2-like [Source:NCBI gene;Acc:111948643])

HSP 1 Score: 127.872 bits (320), Expect = 2.323e-29
Identity = 96/358 (26.82%), Postives = 168/358 (46.93%), Query Frame = 1
Query: 2614 RWTISPSRVKINTEIGKGNYGRIFK----GILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYT---------------------KLRKFS----------QQPDFNGIKLD-----EEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            +W     ++++   +G G +G++ +    G+ TD  +T    VA+K    S  + +           D  M+E+KILS L   +NI+ ++G             T+     +I EY S+  L  FL  H+ +F   T                     +LR  S           QP  +  K       E +++ DL + +  +A GL++LS  + IHRD+A RN+LL +  V KICDFGLA ++  D+    +Y I+  N  LP K +APE +    + L+SD+WS+G+LLW++F+L + + +P+     +  + I+           +  P  A + ++ ++ +CW+  P +RP+
Sbjct:  630 KWEFPRDKLRLGAVLGSGAFGKVVEATAYGLGTDNKATR---VAVKMLKPSAHSEE----------RDALMSELKILSHLGYHNNIVNLLGAC-----------TQGGPMWMITEYCSHGDLLNFLRVHAQDFVASTMLTAEDGGGEPCYKNMAVQKSRLRSDSGISCCSEYQEMQPILSPGKTQMGLHTEGLSLCDLMRFSYQVARGLDFLSTRNCIHRDVAARNVLLTDQHVAKICDFGLARDIRNDD----SY-IVQGNARLPVKWMAPESIFQCIYTLQSDVWSYGVLLWEIFSLGK-SPYPNVAVDANFYRRIKD-------GHHMEAPAFAPAEMYRLMTLCWSLEPTHRPN 950          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Medaka
Match: flt1 (fms related tyrosine kinase 1 [Source:NCBI gene;Acc:101172940])

HSP 1 Score: 121.324 bits (303), Expect = 3.751e-27
Identity = 98/360 (27.22%), Postives = 161/360 (44.72%), Query Frame = 1
Query: 2560 CDSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQ-QFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLL--------------AH-------SVEFSP-YTKLRKFSQQPDF-NGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            C+ +Q   H W  P +          +K+   +G+G +G++ +      +S S  + VA+K  +L       +Q           M E+KIL+ +    N++ ++G      G            ++I+EY    +L+ FL               AH       SV  +P  TK    S   D  +  K    + + DL   +  +A G+E+L+    IHRDLA RN+LL ENKV KICDFGLA ++  D        +   +  LP K ++PE +  K F  +SD+WS+G+LLW++F+L   + +P      D    ++       +R     P+ +   I+ I+  CW  HP +RP+
Sbjct:  798 CERLQYDPHQWEFPREH---------LKLGKSLGRGAFGKVMQASAFGIDSASSCRTVAVK--MLKEGATASEQ--------KALMTELKILNHIGNHLNVVNLLGACTKPGG----------PLMVIVEYCRFGNLSAFLRKKRDVYIHNQLHERAHDRSGFGGSVSGNPNCTKTLSESDSKDISHEPKSASSLFLEDLISFSFQVARGMEFLASRKCIHRDLAARNVLLSENKVVKICDFGLARDIYKD-----PDYVRKGDARLPLKWMSPESIFDKIFTTQSDVWSYGILLWEIFSL-GASPYPGLHMDEDFCLRLKR---GTRMR----APEYSTPEIYSIMLACWEGHPTDRPT 1115          
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Medaka
Match: MUSK (muscle associated receptor tyrosine kinase [Source:NCBI gene;Acc:101164489])

HSP 1 Score: 117.857 bits (294), Expect = 1.708e-26
Identity = 88/316 (27.85%), Postives = 154/316 (48.73%), Query Frame = 1
Query: 2653 EIGKGNYGRIFK----GILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIG-CAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFS------PYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPS 3567
            +IG+G +GR+F+    G+L +     + F  +   +L  + +   Q        + F  E  ++++     NI+K++G CAV            +P  LL  EY +N  LNEFL  HS   S      P    R FS   +   +   ++++      I+  IA G+ YLS    +HRDLATRN L+ E  V KI DFGL     + N  S  Y     N A+P + + PE +    + ++SD+W++G++LW++F+   +  +       +++ Y+R    D ++   L  P+     +++++++CW+  P +RPS
Sbjct:  406 DIGEGAFGRVFQARAPGLLQN-----KPFTMVAVKMLKEEASPDMQ--------NDFQREAALMAEFDH-PNIVKLLGVCAV-----------GKPMCLL-FEYMANGDLNEFLRRHSPTQSMHTLSCPSISNRSFSSDMEAGSLSCVQQLS------ISKQIAAGMAYLSERKFVHRDLATRNCLVGEEMVVKIADFGL-----SRNIYSADYYKANENDAIPIRWMPPESIFYNRYTIESDVWAYGVVLWEIFSHGMQPYYGMGHE--EVIYYVR----DGQI---LACPENCPLELYNLMRLCWSTQPSDRPS 675          
BLAST of Fibroblast growth factor receptor 1 vs. Planmine SMEST
Match: SMESG000022746.1 (SMESG000022746.1)

HSP 1 Score: 2350.09 bits (6089), Expect = 0.000e+0
Identity = 1223/1232 (99.27%), Postives = 1228/1232 (99.68%), Query Frame = 1
Query:  106 MNXXXXXXXXXHFECHLSDLVDKEIIVDFNETTIEIDLNKPSGKLLFVCMENCKLVISKRNYFKPKISIKENNFTVTIDQEKLEFNAELSFCKNNPLTSYFVDYVDLPSCCPCCSGYVQVKCERFSSQFQQCSKFILYFDTIISYFRFIVVYDKVNHFLPCKMPQSGMRDSLRIYNEEKDETYFNSSGYLLENSHYYPSGGLCFNTSVFDEDIQVRCYYYDKSKEVMLSIKKINFIRVEITGSLFFIENSSSHHSFXXXXXXXXXXXXXVTIGCSGKVSAETYFPMICMRFNRSDFVLIEDLDCEETSKYIKNLTINTKDLKGLTRFVCHIDNPSKTDLKTIGFSVEIVNEESLEIVNAHELDKKKFKIFEHQSFQLNVSYNSVPINANNRCKLIDIKTNQSSNCEIHFIGFCTCQVDYDILYANKVTSQYSIVISNEKFQRSVTIYLQPIYISSPNVSGLTSKFENQKTLTCDVHSSSLSNVLWYLTFNGYDKYYLNQSKTEVVIPMNDSINSICASCKITNELGSMNSKSICKNITDIDFDDDQKYLQIFLVNATIWNSKLNRTEKFEYISLKQNPISVLNDRPIEILCAGKXXXXXXXXXXXXSSLNQTIFKTKYTVRSLIKLPIEPDKTEDFSGTYICEQKDSIGNSVIKSYLIIKILQGIIPHIYQHNSEWKYIPGQNIHVSFQIVSFPPAKVEYFQLLSNDKKELFFQNRSDIRSHKFSNLTHSTFSIKFINIGQNDSGEYVLESSNIFGKNSTKFFLKFIISKGSSTIYYTISGACXXXXXXXXXXXKFCERSGYAVPIIQIQNSMYKSFDCDSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPSAXXXXXXXXXXXXXXXXXXXHVDGFYQSDTQGTTSRDSIGSSKYLSSRTSIVTLNFPPTIPTTNLLHQNPYFFDESPM 3801
            MNFLLLFILILHFECHLSDLVDKEIIVDFNETTIEIDLNKPSGKLLFVCMENCKLVISKRNYFKPKISIKENNFTVTIDQEKLEFNAELSFCKNNPLTSYFVDYVDLPSCCPCCSGYVQVKCERFSSQFQQCSKFILYFDTIISYFRFIVVYDKVNHFLPCKMPQSGMRDSLRIYNEEKDETYFNSSGYLLENSHYYPSGGLCFNTSVFDEDIQVRCYYYDKSKEVMLSIKKINFIRVEITGSLFFIENSSSHHSFLNNTNLQLLNNHLVTIGCSGKVSAETYFPMICMRFNRSD+VLIEDLDCEETSKYIKNLTINTKDLKGLTRFVCHIDNPSKTDLKTIGFSVEIVNEESLEIVN HELDKKKFKIFEHQSFQLNV+YNSVPINANNRCKLIDIKTNQSSNCEIHFIGFCTCQVDYDILYANKVTSQYSIVISNEKFQRSVTIYLQPIYISSPN+SGLTSKFE QKTLTCDVHSSSLSNVLWYLTFNGYDKYYLNQSKTEVVIPMNDSINSICASCKITNELGSMNSKSICKNITDIDFDDDQKYLQIFLVNATIWNSKLNRTEKFEYISLKQNPISVLNDRPIEILCAGKIRNRPINIRFNNSSLNQTIFKTKYTVRSLIKLPIEPDKTEDFSGTYICEQKDSIGNSVIKSYLIIKILQGIIPHIYQHNSEWKYIPGQNIHVSFQIVSFPPAKVEYFQLLSNDKKELFF+NRSDIRSHKFSNLTHSTFSIKFINIGQNDSGEYVLESSNIFGKNSTKFFLKFIISKGSSTIYYTISGACIIVIVILIL+IKFCERSGYAVPIIQIQNSMYKSFDCDSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQ PDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFL IPKCADSSIWDIIKMCWAFHPVNRPSASLLKTKLIEIISKSSIEEIHVDGFYQSDTQGTTSRDSIGSSKYLSSRTSIVTLNFPPTIPTTNLLHQNPYFFDESPM
Sbjct:    1 MNFLLLFILILHFECHLSDLVDKEIIVDFNETTIEIDLNKPSGKLLFVCMENCKLVISKRNYFKPKISIKENNFTVTIDQEKLEFNAELSFCKNNPLTSYFVDYVDLPSCCPCCSGYVQVKCERFSSQFQQCSKFILYFDTIISYFRFIVVYDKVNHFLPCKMPQSGMRDSLRIYNEEKDETYFNSSGYLLENSHYYPSGGLCFNTSVFDEDIQVRCYYYDKSKEVMLSIKKINFIRVEITGSLFFIENSSSHHSFLNNTNLQLLNNHLVTIGCSGKVSAETYFPMICMRFNRSDYVLIEDLDCEETSKYIKNLTINTKDLKGLTRFVCHIDNPSKTDLKTIGFSVEIVNEESLEIVNTHELDKKKFKIFEHQSFQLNVAYNSVPINANNRCKLIDIKTNQSSNCEIHFIGFCTCQVDYDILYANKVTSQYSIVISNEKFQRSVTIYLQPIYISSPNISGLTSKFEIQKTLTCDVHSSSLSNVLWYLTFNGYDKYYLNQSKTEVVIPMNDSINSICASCKITNELGSMNSKSICKNITDIDFDDDQKYLQIFLVNATIWNSKLNRTEKFEYISLKQNPISVLNDRPIEILCAGKIRNRPINIRFNNSSLNQTIFKTKYTVRSLIKLPIEPDKTEDFSGTYICEQKDSIGNSVIKSYLIIKILQGIIPHIYQHNSEWKYIPGQNIHVSFQIVSFPPAKVEYFQLLSNDKKELFFRNRSDIRSHKFSNLTHSTFSIKFINIGQNDSGEYVLESSNIFGKNSTKFFLKFIISKGSSTIYYTISGACIIVIVILILMIKFCERSGYAVPIIQIQNSMYKSFDCDSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQPPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLFIPKCADSSIWDIIKMCWAFHPVNRPSASLLKTKLIEIISKSSIEEIHVDGFYQSDTQGTTSRDSIGSSKYLSSRTSIVTLNFPPTIPTTNLLHQNPYFFDESPM 1232          
BLAST of Fibroblast growth factor receptor 1 vs. Planmine SMEST
Match: SMESG000022746.1 (SMESG000022746.1)

HSP 1 Score: 2271.89 bits (5886), Expect = 0.000e+0
Identity = 1174/1183 (99.24%), Postives = 1179/1183 (99.66%), Query Frame = 1
Query:  253 MENCKLVISKRNYFKPKISIKENNFTVTIDQEKLEFNAELSFCKNNPLTSYFVDYVDLPSCCPCCSGYVQVKCERFSSQFQQCSKFILYFDTIISYFRFIVVYDKVNHFLPCKMPQSGMRDSLRIYNEEKDETYFNSSGYLLENSHYYPSGGLCFNTSVFDEDIQVRCYYYDKSKEVMLSIKKINFIRVEITGSLFFIENSSSHHSFXXXXXXXXXXXXXVTIGCSGKVSAETYFPMICMRFNRSDFVLIEDLDCEETSKYIKNLTINTKDLKGLTRFVCHIDNPSKTDLKTIGFSVEIVNEESLEIVNAHELDKKKFKIFEHQSFQLNVSYNSVPINANNRCKLIDIKTNQSSNCEIHFIGFCTCQVDYDILYANKVTSQYSIVISNEKFQRSVTIYLQPIYISSPNVSGLTSKFENQKTLTCDVHSSSLSNVLWYLTFNGYDKYYLNQSKTEVVIPMNDSINSICASCKITNELGSMNSKSICKNITDIDFDDDQKYLQIFLVNATIWNSKLNRTEKFEYISLKQNPISVLNDRPIEILCAGKXXXXXXXXXXXXSSLNQTIFKTKYTVRSLIKLPIEPDKTEDFSGTYICEQKDSIGNSVIKSYLIIKILQGIIPHIYQHNSEWKYIPGQNIHVSFQIVSFPPAKVEYFQLLSNDKKELFFQNRSDIRSHKFSNLTHSTFSIKFINIGQNDSGEYVLESSNIFGKNSTKFFLKFIISKGSSTIYYTISGACXXXXXXXXXXXKFCERSGYAVPIIQIQNSMYKSFDCDSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRPSAXXXXXXXXXXXXXXXXXXXHVDGFYQSDTQGTTSRDSIGSSKYLSSRTSIVTLNFPPTIPTTNLLHQNPYFFDESPM 3801
            MENCKLVISKRNYFKPKISIKENNFTVTIDQEKLEFNAELSFCKNNPLTSYFVDYVDLPSCCPCCSGYVQVKCERFSSQFQQCSKFILYFDTIISYFRFIVVYDKVNHFLPCKMPQSGMRDSLRIYNEEKDETYFNSSGYLLENSHYYPSGGLCFNTSVFDEDIQVRCYYYDKSKEVMLSIKKINFIRVEITGSLFFIENSSSHHSFLNNTNLQLLNNHLVTIGCSGKVSAETYFPMICMRFNRSD+VLIEDLDCEETSKYIKNLTINTKDLKGLTRFVCHIDNPSKTDLKTIGFSVEIVNEESLEIVN HELDKKKFKIFEHQSFQLNV+YNSVPINANNRCKLIDIKTNQSSNCEIHFIGFCTCQVDYDILYANKVTSQYSIVISNEKFQRSVTIYLQPIYISSPN+SGLTSKFE QKTLTCDVHSSSLSNVLWYLTFNGYDKYYLNQSKTEVVIPMNDSINSICASCKITNELGSMNSKSICKNITDIDFDDDQKYLQIFLVNATIWNSKLNRTEKFEYISLKQNPISVLNDRPIEILCAGKIRNRPINIRFNNSSLNQTIFKTKYTVRSLIKLPIEPDKTEDFSGTYICEQKDSIGNSVIKSYLIIKILQGIIPHIYQHNSEWKYIPGQNIHVSFQIVSFPPAKVEYFQLLSNDKKELFF+NRSDIRSHKFSNLTHSTFSIKFINIGQNDSGEYVLESSNIFGKNSTKFFLKFIISKGSSTIYYTISGACIIVIVILIL+IKFCERSGYAVPIIQIQNSMYKSFDCDSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQ PDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFL IPKCADSSIWDIIKMCWAFHPVNRPSASLLKTKLIEIISKSSIEEIHVDGFYQSDTQGTTSRDSIGSSKYLSSRTSIVTLNFPPTIPTTNLLHQNPYFFDESPM
Sbjct:    1 MENCKLVISKRNYFKPKISIKENNFTVTIDQEKLEFNAELSFCKNNPLTSYFVDYVDLPSCCPCCSGYVQVKCERFSSQFQQCSKFILYFDTIISYFRFIVVYDKVNHFLPCKMPQSGMRDSLRIYNEEKDETYFNSSGYLLENSHYYPSGGLCFNTSVFDEDIQVRCYYYDKSKEVMLSIKKINFIRVEITGSLFFIENSSSHHSFLNNTNLQLLNNHLVTIGCSGKVSAETYFPMICMRFNRSDYVLIEDLDCEETSKYIKNLTINTKDLKGLTRFVCHIDNPSKTDLKTIGFSVEIVNEESLEIVNTHELDKKKFKIFEHQSFQLNVAYNSVPINANNRCKLIDIKTNQSSNCEIHFIGFCTCQVDYDILYANKVTSQYSIVISNEKFQRSVTIYLQPIYISSPNISGLTSKFEIQKTLTCDVHSSSLSNVLWYLTFNGYDKYYLNQSKTEVVIPMNDSINSICASCKITNELGSMNSKSICKNITDIDFDDDQKYLQIFLVNATIWNSKLNRTEKFEYISLKQNPISVLNDRPIEILCAGKIRNRPINIRFNNSSLNQTIFKTKYTVRSLIKLPIEPDKTEDFSGTYICEQKDSIGNSVIKSYLIIKILQGIIPHIYQHNSEWKYIPGQNIHVSFQIVSFPPAKVEYFQLLSNDKKELFFRNRSDIRSHKFSNLTHSTFSIKFINIGQNDSGEYVLESSNIFGKNSTKFFLKFIISKGSSTIYYTISGACIIVIVILILMIKFCERSGYAVPIIQIQNSMYKSFDCDSIQLLTHLWPDPLDRKRWTISPSRVKINTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKFSQPPDFNGIKLDEEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETLFPDFENPIDLLKYIRSRLFDNELRDFLFIPKCADSSIWDIIKMCWAFHPVNRPSASLLKTKLIEIISKSSIEEIHVDGFYQSDTQGTTSRDSIGSSKYLSSRTSIVTLNFPPTIPTTNLLHQNPYFFDESPM 1183          
BLAST of Fibroblast growth factor receptor 1 vs. Planmine SMEST
Match: SMESG000054557.1 (SMESG000054557.1)

HSP 1 Score: 118.627 bits (296), Expect = 9.308e-27
Identity = 94/333 (28.23%), Postives = 158/333 (47.45%), Query Frame = 1
Query: 2587 LWPDPLDRKRWTISPSRVKI-NTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKF--SQQPDFNGIKLD-EEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQ---ETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            L+  P D   W     ++KI N ++G+G +G +++G+  D           K+P  +    K  +  F   ++  F+ E++I+  +    N+I+++G    +NG         P  ++                  VE +PY  LR F  S+   ++  K + E +T   L   +  IANG+ YL+  S++HRDL+ RNIL+ E+   KI DFGL         +   Y+  T +  LP K +APE L  K +  KSD+WS+G+LLW++F L      ++ P  E  +D++K    + F N        P+ A+  I+ +++ CW     NRP
Sbjct:  505 LYEFPCD-PEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDI---------AKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCT-QNG---------PLRVI------------------VELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLT------RIVDYYYRKKT-DGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILP--EKVVDVIK----KGFQNPQ------PELANFEIYSLMQHCWNISTENRP 780          
BLAST of Fibroblast growth factor receptor 1 vs. Planmine SMEST
Match: SMESG000054557.1 (SMESG000054557.1)

HSP 1 Score: 118.627 bits (296), Expect = 1.078e-26
Identity = 94/333 (28.23%), Postives = 158/333 (47.45%), Query Frame = 1
Query: 2587 LWPDPLDRKRWTISPSRVKI-NTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKF--SQQPDFNGIKLD-EEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQ---ETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            L+  P D   W     ++KI N ++G+G +G +++G+  D           K+P  +    K  +  F   ++  F+ E++I+  +    N+I+++G    +NG         P  ++                  VE +PY  LR F  S+   ++  K + E +T   L   +  IANG+ YL+  S++HRDL+ RNIL+ E+   KI DFGL         +   Y+  T +  LP K +APE L  K +  KSD+WS+G+LLW++F L      ++ P  E  +D++K    + F N        P+ A+  I+ +++ CW     NRP
Sbjct:  526 LYEFPCD-PEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDI---------AKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCT-QNG---------PLRVI------------------VELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLT------RIVDYYYRKKT-DGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILP--EKVVDVIK----KGFQNPQ------PELANFEIYSLMQHCWNISTENRP 801          
BLAST of Fibroblast growth factor receptor 1 vs. Planmine SMEST
Match: SMESG000054557.1 (SMESG000054557.1)

HSP 1 Score: 118.242 bits (295), Expect = 1.421e-26
Identity = 94/333 (28.23%), Postives = 158/333 (47.45%), Query Frame = 1
Query: 2587 LWPDPLDRKRWTISPSRVKI-NTEIGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLDCFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYSNRSLNEFLLAHSVEFSPYTKLRKF--SQQPDFNGIKLD-EEITVLDLKKIAMGIANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMSTTYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQ---ETLFPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPVNRP 3564
            L+  P D   W     ++KI N ++G+G +G +++G+  D           K+P  +    K  +  F   ++  F+ E++I+  +    N+I+++G    +NG         P  ++                  VE +PY  LR F  S+   ++  K + E +T   L   +  IANG+ YL+  S++HRDL+ RNIL+ E+   KI DFGL         +   Y+  T +  LP K +APE L  K +  KSD+WS+G+LLW++F L      ++ P  E  +D++K    + F N        P+ A+  I+ +++ CW     NRP
Sbjct:  522 LYEFPCD-PEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDI---------AKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCT-QNG---------PLRVI------------------VELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLT------RIVDYYYRKKT-DGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILP--EKVVDVIK----KGFQNPQ------PELANFEIYSLMQHCWNISTENRP 797          
The following BLAST results are available for this feature:
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FLT11.523e-2726.76fms related tyrosine kinase 1 [Source:HGNC Symbol;... [more]
FGFR32.051e-2629.05fibroblast growth factor receptor 3 [Source:HGNC S... [more]
FGFR32.051e-2629.05fibroblast growth factor receptor 3 [Source:HGNC S... [more]
FGFR32.716e-2628.88fibroblast growth factor receptor 3 [Source:HGNC S... [more]
FGFR32.872e-2629.05fibroblast growth factor receptor 3 [Source:HGNC S... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R09D1.121.604e-2730.09pep chromosome:WBcel235:II:9450028:9452263:-1 gene... [more]
old-12.717e-2627.55Tyrosine-protein kinase receptor old-1 [Source:Un... [more]
W04G5.102.897e-2528.92pep chromosome:WBcel235:I:11638482:11640414:-1 gen... [more]
old-28.667e-2527.44Overexpression Longevity Determinant [Source:UniP... [more]
kin-158.894e-2527.27Receptor-like tyrosine-protein kinase kin-15 [Sou... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htl4.712e-2728.44gene:FBgn0010389 transcript:FBtr0083550[more]
htl4.712e-2728.44gene:FBgn0010389 transcript:FBtr0083549[more]
htl4.712e-2728.44gene:FBgn0010389 transcript:FBtr0083548[more]
Ret3.558e-2625.70gene:FBgn0011829 transcript:FBtr0081493[more]
Ret3.558e-2625.70gene:FBgn0011829 transcript:FBtr0081494[more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flt44.421e-3129.14fms-related tyrosine kinase 4 [Source:NCBI gene;Ac... [more]
flt45.467e-3129.14fms-related tyrosine kinase 4 [Source:NCBI gene;Ac... [more]
kitb2.113e-2726.58KIT proto-oncogene, receptor tyrosine kinase b [So... [more]
kitb2.395e-2726.58KIT proto-oncogene, receptor tyrosine kinase b [So... [more]
kitb2.395e-2726.58KIT proto-oncogene, receptor tyrosine kinase b [So... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tgm61.802e-2827.61transglutaminase 6 [Source:Xenbase;Acc:XB-GENE-587... [more]
trpm12.233e-2728.57transient receptor potential cation channel subfam... [more]
csf1r2.798e-2724.81colony stimulating factor 1 receptor [Source:NCBI ... [more]
tgm63.203e-2726.67transglutaminase 6 [Source:Xenbase;Acc:XB-GENE-587... [more]
csf1r5.824e-2724.72colony stimulating factor 1 receptor [Source:NCBI ... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flt12.771e-2822.56FMS-like tyrosine kinase 1 [Source:MGI Symbol;Acc:... [more]
Fgfr33.960e-2829.18fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
Fgfr33.960e-2829.18fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
Fgfr34.039e-2829.36fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
Fgfr34.039e-2829.36fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5MD89|VGFR3_DANRE3.673e-3029.14Vascular endothelial growth factor receptor 3 OS=D... [more]
sp|Q61851|FGFR3_MOUSE7.977e-2829.05Fibroblast growth factor receptor 3 OS=Mus musculu... [more]
sp|P35969|VGFR1_MOUSE1.989e-2722.56Vascular endothelial growth factor receptor 1 OS=M... [more]
sp|P18460|FGFR3_CHICK4.103e-2728.18Fibroblast growth factor receptor 3 OS=Gallus gall... [more]
sp|P17948|VGFR1_HUMAN7.315e-2726.76Vascular endothelial growth factor receptor 1 OS=H... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YAX21.091e-3830.96Macrophage colony-stimulating factor 1 receptor OS... [more]
A0A2H1C7G01.434e-3531.23Protein tyrosine kinase OS=Fasciola hepatica OX=61... [more]
A0A4E0R3Y73.232e-3530.96Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A183ADI33.547e-3528.91Protein kinase domain-containing protein OS=Echino... [more]
H2KS895.138e-3534.17Macrophage colony-stimulating factor 1 receptor OS... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flt41.873e-2828.61fms-related tyrosine kinase 4 [Source:NCBI gene;Ac... [more]
CSF1R3.652e-2826.46colony stimulating factor 1 receptor [Source:HGNC ... [more]
kitb9.817e-2825.89KIT proto-oncogene, receptor tyrosine kinase b [So... [more]
flt43.981e-2727.87fms-related tyrosine kinase 4 [Source:NCBI gene;Ac... [more]
flt44.842e-2727.87fms-related tyrosine kinase 4 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009485.11.451e-2624.53pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gen... [more]
fgfr25.284e-2626.12fibroblast growth factor receptor 2 [Source:NCBI g... [more]
ENSPMAT00000004131.11.476e-2525.86pep scaffold:Pmarinus_7.0:GL490249:322:4273:1 gene... [more]
fgfr21.970e-2529.06fibroblast growth factor receptor 2 [Source:NCBI g... [more]
ENSPMAT00000004129.12.181e-2526.81pep scaffold:Pmarinus_7.0:GL490249:304:4500:1 gene... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MKK16.443e-1432.43MAPKK involved in the protein kinase C signaling p... [more]
STE72.049e-1324.66Signal transducing MAP kinase kinase; involved in ... [more]
CDC151.036e-1227.68Protein kinase of the Mitotic Exit Network; locali... [more]
MKK25.027e-1228.65MAPKK involved in the protein kinase C signaling p... [more]
BCK13.130e-1125.41MAPKKK acting in the protein kinase C signaling pa... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380785.352e-3028.35Predicted protein; Ret-like protein [Source:UniPr... [more]
EDO476521.870e-2928.26Tyrosine-protein kinase receptor [Source:UniProtK... [more]
EDO355945.233e-2932.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365514.273e-2827.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417961.628e-2730.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flt42.066e-2927.40fms related tyrosine kinase 4 [Source:NCBI gene;Ac... [more]
flt42.066e-2927.40fms related tyrosine kinase 4 [Source:NCBI gene;Ac... [more]
ENSORLT00000016041.22.323e-2926.82macrophage colony-stimulating factor 1 receptor 2-... [more]
flt13.751e-2727.22fms related tyrosine kinase 1 [Source:NCBI gene;Ac... [more]
MUSK1.708e-2627.85muscle associated receptor tyrosine kinase [Source... [more]
back to top
BLAST of Fibroblast growth factor receptor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022746.10.000e+099.27SMESG000022746.1[more]
SMESG000022746.10.000e+099.24SMESG000022746.1[more]
SMESG000054557.19.308e-2728.23SMESG000054557.1[more]
SMESG000054557.11.078e-2628.23SMESG000054557.1[more]
SMESG000054557.11.421e-2628.23SMESG000054557.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001259 ID=SMED30001259|Name=Fibroblast growth factor receptor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3876bp
ATCTGATACACAACTTGTAAATGTTAACTTACACTTAACATTGTCACATG
AGATTGTGTAAATCACATTTGTAACATTTGAAAATTTAATGTTGCAATTG
GACAAATGAATTTCTTATTGTTATTTATATTGATTTTGCACTTCGAATGC
CATCTCTCTGACTTAGTTGACAAGGAAATTATTGTGGATTTTAATGAAAC
AACTATCGAAATTGATTTAAACAAACCCTCGGGGAAATTATTGTTTGTTT
GTATGGAAAACTGTAAATTGGTCATTTCAAAGAGAAACTATTTCAAACCG
AAAATCTCAATCAAAGAAAACAATTTCACAGTCACAATTGACCAGGAAAA
GTTGGAGTTTAATGCCGAATTGAGTTTTTGCAAGAATAACCCTTTGACTT
CCTATTTTGTTGACTATGTCGATCTTCCCAGTTGTTGTCCCTGTTGTTCG
GGATATGTCCAAGTGAAATGCGAAAGATTCTCCAGTCAATTCCAGCAGTG
TTCAAAATTCATTCTATACTTTGATACAATTATTTCGTACTTTCGATTTA
TTGTGGTTTATGATAAAGTCAATCATTTTCTACCTTGCAAAATGCCTCAA
TCTGGAATGAGGGATAGTTTAAGGATTTATAACGAAGAAAAGGATGAAAC
GTATTTCAATTCCAGCGGGTATTTGTTGGAGAATTCACACTACTATCCAT
CGGGTGGACTTTGTTTCAACACTTCGGTGTTTGATGAGGATATCCAAGTG
AGATGCTATTATTACGATAAATCCAAAGAAGTTATGCTAAGTATCAAAAA
GATAAATTTCATTCGTGTTGAAATCACCGGATCTTTGTTTTTTATTGAGA
ATTCAAGCAGTCACCATTCGTTTCTAAATAATACCAATTTGCAATTGTTA
AATAATCATTTGGTAACAATTGGTTGCAGCGGAAAGGTTTCGGCCGAAAC
CTACTTCCCGATGATATGCATGCGATTCAACAGATCTGACTTTGTTTTGA
TAGAAGATTTAGATTGTGAAGAAACTTCAAAATATATAAAGAACTTGACT
ATTAATACCAAAGACTTGAAAGGCCTTACCCGATTCGTTTGCCACATTGA
TAATCCATCGAAAACAGATTTAAAGACAATCGGGTTTTCCGTTGAAATAG
TAAACGAAGAAAGTCTGGAAATTGTCAACGCTCATGAATTGGATAAAAAA
AAGTTTAAAATCTTTGAACATCAATCTTTTCAATTAAATGTTTCTTATAA
TTCAGTTCCGATCAATGCCAACAATCGGTGTAAATTGATAGACATCAAGA
CAAATCAATCCAGTAATTGTGAAATTCATTTTATCGGTTTTTGCACTTGC
CAAGTGGATTATGATATTTTGTATGCCAATAAGGTCACGTCTCAATATTC
AATTGTCATTTCAAATGAGAAATTTCAAAGATCTGTGACGATTTATCTGC
AACCTATTTACATAAGCAGCCCGAACGTTTCTGGATTGACTTCAAAATTT
GAAAACCAAAAAACCCTTACTTGTGACGTACATTCTTCAAGTTTGTCAAA
TGTTCTTTGGTATTTGACTTTTAATGGATACGATAAATATTACTTGAATC
AAAGTAAAACAGAAGTAGTTATTCCTATGAATGATTCAATTAACTCTATA
TGTGCATCGTGTAAAATTACCAATGAACTCGGATCAATGAACTCAAAAAG
TATTTGTAAAAATATCACTGATATTGATTTTGATGATGATCAAAAATATC
TACAGATCTTCCTTGTAAATGCGACGATTTGGAATTCAAAACTCAATAGA
ACAGAAAAATTTGAATACATATCCTTGAAACAAAACCCAATATCGGTTTT
AAACGATCGACCAATAGAAATCTTATGCGCTGGGAAAATTCGAAACCGAC
CAATCAATATTCGATTCAATAATTCGAGTCTAAACCAAACGATTTTCAAA
ACAAAATACACAGTAAGAAGTTTAATAAAATTACCAATTGAACCGGATAA
AACCGAAGATTTTTCTGGCACATATATTTGCGAACAAAAGGATTCAATTG
GAAATTCAGTAATAAAATCTTATTTAATTATCAAAATCCTCCAAGGAATT
ATTCCTCACATTTACCAACATAATTCCGAATGGAAATACATTCCAGGACA
AAATATTCACGTCTCATTTCAAATAGTCAGTTTCCCGCCGGCTAAAGTCG
AATATTTTCAATTATTATCCAATGATAAAAAAGAATTATTTTTTCAAAAC
CGTTCCGATATTAGGTCTCATAAATTTAGTAATTTGACTCACAGCACTTT
TAGTATAAAGTTTATCAATATTGGTCAAAACGATTCCGGAGAATACGTTC
TAGAATCTTCAAATATTTTCGGTAAAAATAGCACGAAATTCTTTTTAAAA
TTTATAATCTCAAAAGGCAGTTCGACGATCTATTACACGATATCTGGAGC
TTGTATAATAGTTATAGTTATTTTAATATTGCTGATAAAGTTTTGTGAAA
GATCCGGCTATGCAGTTCCAATAATTCAAATTCAAAATAGCATGTATAAA
AGTTTTGATTGCGACTCAATCCAACTGTTGACCCATCTATGGCCGGATCC
TTTGGATAGAAAGAGGTGGACAATCAGTCCCAGTAGAGTAAAAATAAACA
CAGAAATAGGCAAAGGAAATTATGGAAGGATCTTCAAAGGTATTCTAACG
GATTTTAATTCAACGTCACAACAATTTGTTGCGATTAAACAACCGATTTT
ATCGAATCAAACAAACAAAGGTAAACAAATACATTTTTGCCAAATAAGTC
TCGATTGTTTCATGAATGAAATAAAAATCCTTTCCAAATTAACCGGATGT
TCAAACATCATCAAAATGATTGGCTGCGCAGTGTTTGAAAACGGGGTTGA
AAATTATGACACAACCAAAGAGCCTACGACTTTGTTGATTCTCGAATACT
ACAGCAATAGATCATTGAACGAGTTTTTGTTGGCTCATTCTGTTGAGTTT
TCACCGTACACAAAATTGAGGAAATTTTCCCAACAACCCGATTTCAATGG
CATAAAACTCGACGAAGAAATAACTGTATTGGATTTGAAAAAGATCGCTA
TGGGCATTGCAAACGGCTTGGAATATTTGTCTGGTTTCAGCATAATCCAT
CGAGATTTGGCGACGAGGAATATTTTACTTGACGAAAATAAAGTCCCGAA
AATCTGTGATTTCGGTTTGGCCATTGAATTAGAGACCGATAATTTTATGT
CTACGACATATCAAATTATTACTTATAACAAAGCTTTGCCGTTTAAAATT
CTGGCACCAGAAGTCCTGGAATCGAAATCGTTTTGTTTGAAATCTGACAT
TTGGAGTTTTGGGTTGTTATTGTGGCAAATGTTTAACTTGGAACAAGAGA
CTCTATTTCCGGATTTTGAAAACCCAATTGACTTGTTAAAGTATATCAGA
AGTCGATTATTTGACAATGAATTGAGAGACTTTTTATTGATTCCCAAGTG
TGCAGATTCATCAATTTGGGATATTATCAAGATGTGTTGGGCTTTCCACC
CGGTAAACAGACCTTCGGCGTCGTTATTGAAAACAAAGTTAATAGAAATT
ATCAGTAAAAGTTCTATCGAAGAGATTCATGTTGATGGTTTCTATCAATC
TGACACTCAAGGTACCACAAGTCGGGACTCGATAGGAAGCAGTAAATATC
TATCATCAAGAACAAGCATCGTTACTCTAAATTTCCCCCCTACCATACCA
ACCACAAATCTATTACATCAAAATCCCTATTTTTTTGACGAATCACCCAT
GTAAAGAAAAATTTATAAAAATTAGACATGAACTGTATTATTTGTTTTAA
TGAATATTTTTGTAATGTTATTTGAG
back to top

protein sequence of SMED30001259-orf-1

>SMED30001259-orf-1 ID=SMED30001259-orf-1|Name=SMED30001259-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1233bp
MNFLLLFILILHFECHLSDLVDKEIIVDFNETTIEIDLNKPSGKLLFVCM
ENCKLVISKRNYFKPKISIKENNFTVTIDQEKLEFNAELSFCKNNPLTSY
FVDYVDLPSCCPCCSGYVQVKCERFSSQFQQCSKFILYFDTIISYFRFIV
VYDKVNHFLPCKMPQSGMRDSLRIYNEEKDETYFNSSGYLLENSHYYPSG
GLCFNTSVFDEDIQVRCYYYDKSKEVMLSIKKINFIRVEITGSLFFIENS
SSHHSFLNNTNLQLLNNHLVTIGCSGKVSAETYFPMICMRFNRSDFVLIE
DLDCEETSKYIKNLTINTKDLKGLTRFVCHIDNPSKTDLKTIGFSVEIVN
EESLEIVNAHELDKKKFKIFEHQSFQLNVSYNSVPINANNRCKLIDIKTN
QSSNCEIHFIGFCTCQVDYDILYANKVTSQYSIVISNEKFQRSVTIYLQP
IYISSPNVSGLTSKFENQKTLTCDVHSSSLSNVLWYLTFNGYDKYYLNQS
KTEVVIPMNDSINSICASCKITNELGSMNSKSICKNITDIDFDDDQKYLQ
IFLVNATIWNSKLNRTEKFEYISLKQNPISVLNDRPIEILCAGKIRNRPI
NIRFNNSSLNQTIFKTKYTVRSLIKLPIEPDKTEDFSGTYICEQKDSIGN
SVIKSYLIIKILQGIIPHIYQHNSEWKYIPGQNIHVSFQIVSFPPAKVEY
FQLLSNDKKELFFQNRSDIRSHKFSNLTHSTFSIKFINIGQNDSGEYVLE
SSNIFGKNSTKFFLKFIISKGSSTIYYTISGACIIVIVILILLIKFCERS
GYAVPIIQIQNSMYKSFDCDSIQLLTHLWPDPLDRKRWTISPSRVKINTE
IGKGNYGRIFKGILTDFNSTSQQFVAIKQPILSNQTNKGKQIHFCQISLD
CFMNEIKILSKLTGCSNIIKMIGCAVFENGVENYDTTKEPTTLLILEYYS
NRSLNEFLLAHSVEFSPYTKLRKFSQQPDFNGIKLDEEITVLDLKKIAMG
IANGLEYLSGFSIIHRDLATRNILLDENKVPKICDFGLAIELETDNFMST
TYQIITYNKALPFKILAPEVLESKSFCLKSDIWSFGLLLWQMFNLEQETL
FPDFENPIDLLKYIRSRLFDNELRDFLLIPKCADSSIWDIIKMCWAFHPV
NRPSASLLKTKLIEIISKSSIEEIHVDGFYQSDTQGTTSRDSIGSSKYLS
SRTSIVTLNFPPTIPTTNLLHQNPYFFDESPM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0005007fibroblast growth factor-activated receptor activity
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0031410cytoplasmic vesicle
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0008284positive regulation of cell proliferation
GO:0008543fibroblast growth factor receptor signaling pathway
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR020635Tyr_kinase_cat_dom
IPR013783Ig-like_fold
IPR008266Tyr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR000719Prot_kinase_dom
IPR007110Ig-like_dom
IPR011009Kinase-like_dom_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 1007..1025
score: 54.62
coord: 1061..1071
score: 47.11
coord: 946..959
score: 37.85
coord: 1080..1102
score: 36.86
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 846..1161
e-value: 1.5E-49
score: 168.7
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 845..1162
e-value: 1.1E-49
score: 181.0
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 956..1162
e-value: 9.3E-40
score: 138.0
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 828..931
e-value: 1.0E-11
score: 46.6
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 385..1162
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.771
NoneNo IPR availableTMHMMTMhelixcoord: 772..794
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 666..767
e-value: 7.5E-6
score: 27.9
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 1013..1025
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 851..878
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 845..1163
score: 33.601
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 820..1158
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 667..764