G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30001251
Length (bp)1237
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30001251) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30001251) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30001251) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30001251) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001251

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001251SMESG000012748.1 Contig2765newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001251SMESG000012748.1 Contig2765uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001251SMESG000000375.1 Contig2765newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001251SMESG000000375.1 Contig2765uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30001251SMESG000012748.1 dd_Smed_v4_15409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001251SMESG000012748.1 dd_Smed_v6_15409_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30001251SMESG000012748.1 OX_Smed_1.0.00799ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
ovarySMED30001251SMESG000012748.1 GCR157smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30001251SMESG000012748.1 GCR157smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: SIFaR (gene:FBgn0038880 transcript:FBtr0084098)

HSP 1 Score: 50.447 bits (119), Expect = 2.107e-6
Identity = 47/177 (26.55%), Postives = 84/177 (47.46%), Query Frame = 3
Query:  216 IIAVIGIVGNVFVISIFIKYRRNRFAI--YSSVLAIVNIVILVF--------NTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVG---MALVLNFPLLLTYQLVIND--FVNNSVENILNPEFEC 701
            ++ ++G++GN FVI++ ++  R R     +   LAI +I+++VF        N F+   LG        W +           C+F+ +I      A+ Y ++A+S+DR++ +  PLK    +  R      ++I+G   +ALV   P LL + LV  +  F +  V     P+F C
Sbjct:  217 VVFLVGLIGNSFVIAVVLRAPRMRTVTNYFIVNLAIADILVIVFCLPATLIGNIFVPWMLG--------WLM-----------CKFVPYIQGVSVAASVYSLIAVSLDRFIAIWWPLKQMTKRRAR------IMIIGIWVIALVTTIPWLLFFDLVPAEEVFSDALVSAYSQPQFLC 368          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: SIFaR (gene:FBgn0038880 transcript:FBtr0301815)

HSP 1 Score: 50.447 bits (119), Expect = 2.107e-6
Identity = 47/177 (26.55%), Postives = 84/177 (47.46%), Query Frame = 3
Query:  216 IIAVIGIVGNVFVISIFIKYRRNRFAI--YSSVLAIVNIVILVF--------NTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVG---MALVLNFPLLLTYQLVIND--FVNNSVENILNPEFEC 701
            ++ ++G++GN FVI++ ++  R R     +   LAI +I+++VF        N F+   LG        W +           C+F+ +I      A+ Y ++A+S+DR++ +  PLK    +  R      ++I+G   +ALV   P LL + LV  +  F +  V     P+F C
Sbjct:  217 VVFLVGLIGNSFVIAVVLRAPRMRTVTNYFIVNLAIADILVIVFCLPATLIGNIFVPWMLG--------WLM-----------CKFVPYIQGVSVAASVYSLIAVSLDRFIAIWWPLKQMTKRRAR------IMIIGIWVIALVTTIPWLLFFDLVPAEEVFSDALVSAYSQPQFLC 368          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: FO904943.1 (neuromedin-K receptor-like [Source:NCBI gene;Acc:100333270])

HSP 1 Score: 51.2174 bits (121), Expect = 1.336e-6
Identity = 38/139 (27.34%), Postives = 66/139 (47.48%), Query Frame = 3
Query:  216 IIAVIGIVGNVFVISIFIKYRRNRFAI--YSSVLAIVNIVILVFNTFLDDFLG-RGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPL 623
            ++ ++ + GN+ VI I + ++R R     +   LA+ ++ +   N  ++   G  G  Y            +S   CRF NF P A   A+ Y + A+++DRY+ +  P+K      V    + CV I  +A  L+FPL
Sbjct:   32 LVLLVAVTGNLIVIWIIVAHKRMRTVTNYFLLNLAVSDVCVAALNALVNFVYGAHGHWY------------FSSAYCRFQNFYPVAAVFASIYSMSAIALDRYMAIIHPMKPRLSAKVTKAVIVCVWI--LAAFLSFPL 156          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: tacr2 (tachykinin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-090312-188])

HSP 1 Score: 49.6766 bits (117), Expect = 3.819e-6
Identity = 45/171 (26.32%), Postives = 78/171 (45.61%), Query Frame = 3
Query:  129 LMYFDGFNNDSILVNVVKADF--IFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSV--LAIVNIVILVFNTFLDDFLGRGISYA--TDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPL 623
            L+Y+D   N++ +    + D+     A    +I +I  +GNV VI I + ++R R      +  LA  +  +  FNT  +        YA   DW        + +G C+F NF P     ++ Y + A++VDRY+ +  PLK       R +  T  +++G+   + F L
Sbjct:   12 LLYYDEDGNETSINLFEQPDWQVALWAIAYTLIVIISFIGNVTVIWIILAHKRMRTVTNYFIVNLAFSDASMATFNTVFN------FVYALHNDW-------YFGLGYCKFQNFFPITAMFSSIYSMAAIAVDRYMAIIHPLK------PRLSSTTTKLLIGVIWTVAFSL 163          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: tacr2 (tachykinin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-090312-188])

HSP 1 Score: 49.6766 bits (117), Expect = 3.819e-6
Identity = 45/171 (26.32%), Postives = 78/171 (45.61%), Query Frame = 3
Query:  129 LMYFDGFNNDSILVNVVKADF--IFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSV--LAIVNIVILVFNTFLDDFLGRGISYA--TDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPL 623
            L+Y+D   N++ +    + D+     A    +I +I  +GNV VI I + ++R R      +  LA  +  +  FNT  +        YA   DW        + +G C+F NF P     ++ Y + A++VDRY+ +  PLK       R +  T  +++G+   + F L
Sbjct:   12 LLYYDEDGNETSINLFEQPDWQVALWAIAYTLIVIISFIGNVTVIWIILAHKRMRTVTNYFIVNLAFSDASMATFNTVFN------FVYALHNDW-------YFGLGYCKFQNFFPITAMFSSIYSMAAIAVDRYMAIIHPLK------PRLSSTTTKLLIGVIWTVAFSL 163          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: tacr2 (tachykinin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-090312-188])

HSP 1 Score: 49.6766 bits (117), Expect = 3.819e-6
Identity = 45/171 (26.32%), Postives = 78/171 (45.61%), Query Frame = 3
Query:  129 LMYFDGFNNDSILVNVVKADF--IFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSV--LAIVNIVILVFNTFLDDFLGRGISYA--TDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPL 623
            L+Y+D   N++ +    + D+     A    +I +I  +GNV VI I + ++R R      +  LA  +  +  FNT  +        YA   DW        + +G C+F NF P     ++ Y + A++VDRY+ +  PLK       R +  T  +++G+   + F L
Sbjct:   12 LLYYDEDGNETSINLFEQPDWQVALWAIAYTLIVIISFIGNVTVIWIILAHKRMRTVTNYFIVNLAFSDASMATFNTVFN------FVYALHNDW-------YFGLGYCKFQNFFPITAMFSSIYSMAAIAVDRYMAIIHPLK------PRLSSTTTKLLIGVIWTVAFSL 163          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: grpr (gastrin-releasing peptide receptor [Source:ZFIN;Acc:ZDB-GENE-081015-4])

HSP 1 Score: 48.9062 bits (115), Expect = 6.730e-6
Identity = 63/264 (23.86%), Postives = 117/264 (44.32%), Query Frame = 3
Query:  231 GIVGNVFVISIF--IKYRRNRFAIYSSVLAIVNIVILVFNTFLD--DFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFE-CS-LDNSALAHFELYSKSLFTLA--IPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLSEQSRFVGHLAVSC-----LFSVLFLPLSIVIVMRLLHNSKADN 983
            G++GNV +I  F  +K  RN   ++ S LA+ ++++LV    +D   FL      A +W       ++    C+ + FI       + + + AL+ DRY  + KP+   + K     CL    I  +++VL  P     + V +D     +    N  F+ C+   ++   H +++S + F +   IP  II     FI   L+   S+ +  ++G   +  Q      LA +      LF++ +LP  ++ + R  H ++ D 
Sbjct:   48 GLIGNVTLIRTFCIVKSMRNVPNLFMSSLALGDVLLLVTCAPVDASKFL------ADEW-------LFGRMGCKLIPFIQLTSVGVSVFTLTALAADRYKAIVKPMDIQSSKASLKVCLRAASIWMLSMVLAIP-----EAVFSDLHTFHIPQT-NETFKTCAPYPHAGDLHPKIHSMASFLILYIIPLFIISVYYIFIARSLI--QSANNMPVEGNTHIRRQVESRMRLAKTVLVFVGLFAICWLPNHVIYLYRSYHYTEVDT 290          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Gpr183 (G protein-coupled receptor 183 [Source:MGI Symbol;Acc:MGI:2442034])

HSP 1 Score: 50.0618 bits (118), Expect = 2.729e-6
Identity = 70/263 (26.62%), Postives = 113/263 (42.97%), Query Frame = 3
Query:  111 NEFEKYLMYFDGFNNDSILVNVVKADFIFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSVLAIVNIVI--LVFNTFLDDFLGRGISYAT--DWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGV---RGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLSEQS 878
            N F   L    G NN  +  +   A  +   ++S ++ +IG+VGN+  + + ++   NR  I S+ L  +N+VI  ++F T L     R   YA   DW+I           CR    +      A    +  LS+DR+  +  PL+YN  K +   +G CL+  I+V        PLLLT    ++    +    +  P FE     +A   + L    L    +P  +I+   + I  K LFR + Q       N L+E+S
Sbjct:    3 NNFTTPLATSHG-NNCDLYAHHSTARVLMPLHYS-LVFIIGLVGNLLALVVIVQ---NRKKINSTTLYSMNLVISDILFTTALPT---RIAYYALGFDWRI-------GDALCRVTALVFYINTYAGVNFMTCLSIDRFFAVVHPLRYNKIKRIEYAKGVCLSVWILV---FAQTLPLLLT---PMSKEEGDKTTCMEYPNFE----GTASLPWILLGACLLGYVLPITVILLCYSQICCK-LFRTAKQ-------NPLTEKS 232          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUG5 (GCR157 OS=Schmidtea mediterranea OX=79327 GN=gcr157 PE=2 SV=1)

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 358/360 (99.44%), Postives = 359/360 (99.72%), Query Frame = 3
Query:  132 MYFDGFNNDSILVNVVKADFIFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLSEQSRFVGHLAVSCLFSVLFLPLSIVIVMRLLHNSKADNFDYXXXXXXXXXXXXVKDISFGGNIFLYLLFMPNFRKRCKQMVTCYYNSHPSHYHCSQVFLSPARLSLLIQNDLKY 1211
            MYFDGFNNDSILVNVVK+DFIFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYS GTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLSEQSRFVGHLAVSCLFSVLFLPLSIVIVMRLLHNSKADNFDYLFLKALSKFLSSVKDISFGGNIFLYLLFMPNFRKRCKQMVTCYYNSHPSHYHCSQVFLSPARLSLLIQNDLKY
Sbjct:    1 MYFDGFNNDSILVNVVKSDFIFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSTGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLSEQSRFVGHLAVSCLFSVLFLPLSIVIVMRLLHNSKADNFDYLFLKALSKFLSSVKDISFGGNIFLYLLFMPNFRKRCKQMVTCYYNSHPSHYHCSQVFLSPARLSLLIQNDLKY 360          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183KKN2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS15594 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.396e-48
Identity = 117/321 (36.45%), Postives = 187/321 (58.26%), Query Frame = 3
Query:  195 FRAYFSPIIAVIGIVGNVFVISIFIKYRR-NRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSL-DNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLS--EQSRFVGHLAVSCLFSVLFLPLSIVIVMRL-LHNSKADNFD--YXXXXXXXXXXXXVKDISFGGNIFLYLLFMPNFRK---------RCKQM 1109
            FRAY  PIIA+IG++GN F++ IF+K ++ +RF+IYS  LAI NI+ L+ NTF+DDFLGRG+ YAT+ +   K+D  S   C+ + +I N MY  ++Y+IV  S+DR L + KP+K+ +        + C+++  M ++ N PLL    L+++    +S  N     F C +     +A F +  +++ T  IP  +++FLN FI  +L     +++ ++   +S +  E  R  GHLA+S  F +L+LP+   +++RL L  S  D      + +  LS+  SSVKDI++  N FLYL+F+ NFR           CK+M
Sbjct:   17 FRAYICPIIAIIGVIGNSFIVIIFLKEKQLSRFSIYSIFLAIANIITLIMNTFIDDFLGRGLYYATNHQFYFKLDTISTFWCKSVEYISNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSIYHKHWALIACILVYSMGILSNSPLLFVQTLMVD---TSSRTN-----FTCRMISEHPVAKFTITFETIVTFTIPFCLVLFLNVFICIELWKLKVNRTALLPADSSRNRMEMGRVFGHLALSTAFLLLYLPMVCFVLIRLSLTLSHVDRHKPYAMCIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRHGFQRSICTVSCKKM 329          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A430QMQ3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0001525 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.441e-48
Identity = 117/321 (36.45%), Postives = 187/321 (58.26%), Query Frame = 3
Query:  195 FRAYFSPIIAVIGIVGNVFVISIFIKYRR-NRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSL-DNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLS--EQSRFVGHLAVSCLFSVLFLPLSIVIVMRL-LHNSKADNFD--YXXXXXXXXXXXXVKDISFGGNIFLYLLFMPNFRK---------RCKQM 1109
            FRAY  PIIA+IG++GN F++ IF+K ++ +RF+IYS  LAI NI+ L+ NTF+DDFLGRG+ YAT+ +   K+D  S   C+ + +I N MY  ++Y+IV  S+DR L + KP+K+ +        + C+++  M ++ N PLL    L+++    +S  N     F C +     +A F +  +++ T  IP  +++FLN FI  +L     +++ ++   +S +  E  R  GHLA+S  F +L+LP+   +++RL L  S  D      + +  LS+  SSVKDI++  N FLYL+F+ NFR           CK+M
Sbjct:   17 FRAYICPIIAIIGVIGNSFIVIIFLKEKQLSRFSIYSIFLAIANIITLIMNTFIDDFLGRGLYYATNHQFYFKLDTISTFWCKSVEYISNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSIYHKHWALIACILVYSMGILSNSPLLFVQTLMVD---TSSRTN-----FTCRMISEHPVAKFTITFETIVTFTIPFCLVLFLNVFICIELWKLKVNRTALLPADSSRNRMEMGRVFGHLALSTAFLLLYLPMVCFVLIRLSLTLSHVDRHKPYAMCIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRHGFQRSICTVSCKKM 329          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183P8J0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS10676 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.568e-48
Identity = 117/321 (36.45%), Postives = 187/321 (58.26%), Query Frame = 3
Query:  195 FRAYFSPIIAVIGIVGNVFVISIFIKYRR-NRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSL-DNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLS--EQSRFVGHLAVSCLFSVLFLPLSIVIVMRL-LHNSKADNFD--YXXXXXXXXXXXXVKDISFGGNIFLYLLFMPNFRK---------RCKQM 1109
            FRAY  PIIA+IG++GN F++ IF+K ++ +RF+IYS  LAI NI+ L+ NTF+DDFLGRG+ YAT+ +   K+D  S   C+ + +I N MY  ++Y+IV  S+DR L + KP+K+ +        + C+++  M ++ N PLL    L+++    +S  N     F C +     +A F +  +++ T  IP  +++FLN FI  +L     +++ ++   +S +  E  R  GHLA+S  F +L+LP+   +++RL L  S  D      + +  LS+  SSVKDI++  N FLYL+F+ NFR           CK+M
Sbjct:   17 FRAYICPIIAIIGVIGNSFIVIIFLKEKQLSRFSIYSIFLAIANIITLIMNTFIDDFLGRGLYYATNHQFYFKLDTISTFWCKSVEYISNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSIYHKHWALIACILVYSMGILSNSPLLFVQTLMVD---KSSRTN-----FTCRMISEHPVAKFTITFETIVTFTIPFCLVLFLNVFICIELWKLKVNRTALLPADSSRNRMEMGRVFGHLALSTAFLLLYLPMVCFVLIRLSLTLSHVDRHKPYAMCIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRHGFQRSICTVSCKKM 329          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183L9P8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS523 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 6.596e-48
Identity = 118/318 (37.11%), Postives = 188/318 (59.12%), Query Frame = 3
Query:  195 FRAYFSPIIAVIGIVGNVFVISIFIKYRR-NRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSL-DNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLS--EQSRFVGHLAVSCLFSVLFLPLSIVIVMRL-LHNSKADNFD--YXXXXXXXXXXXXVKDISFGGNIFLYLLFMPNFR---KRCKQMVTC 1118
            FRAY  PIIA+IG++GN F+I IF+K ++ +RF+IYS  LAI NI+ L+ NTF+DDFLGRG+ YAT+ +   K+D  S   C+ + +I N MY  ++Y+IV  S+DR L + KP+K+ +        + C+++  M ++ N PLL    L+++    +S  N     F C +     +A F +  +++ T  IP  +++FLN FI  +L     +++ ++   +S +  E  R  GHLA+S  F +L+LP+   +++RL L  S  D      + +  LS+  SSVKDI++  N FLYL+F+ NFR   +R    V+C
Sbjct:   17 FRAYICPIIAIIGVIGNSFIIIIFLKEKQLSRFSIYSIFLAIANIITLIMNTFIDDFLGRGLYYATNHQFYFKLDTISTFWCKSVEYISNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSIYHKHWAMIACILVYLMGILSNSPLLFVQTLMVD---KSSRTN-----FTCRMISEHPVAKFTITFETIVTFTIPFCLVLFLNIFICIELWKLKVNRTALLPADSSRNCMEMGRVSGHLALSTAFLLLYLPMVCFVLIRLSLTLSHVDRHKPYAMCIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRHGFRRSICTVSC 326          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035261.1 (probable G-protein coupled receptor 139 [Source:NCBI gene;Acc:111191700])

HSP 1 Score: 54.299 bits (129), Expect = 1.211e-7
Identity = 75/331 (22.66%), Postives = 142/331 (42.90%), Query Frame = 3
Query:  177 VKADFIFRAYFSPIIAVIGIVGNVFVISIFIKYR----RNRFAIYSSVLAIVNIVILVFNTFLD---DFL-GRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPL-LLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFR----YSSQSFIIQGANSLSEQSRFVGHLA-VSCLFSVLFLPLSIV-IVMRLLHNSKA-DNFDYXXXX-XXXXXXXXVKDISFGGNIFLYLLFMPNFRKRCKQMVTC 1118
            V A   F+  + P++ ++GI  N+F   + I++R     +   IY S LA+V+   LV+   LD    FL  +   +   W             C  MN +    +  +A+++VA +++R+L+L   +        R   LTC  I+ ++ + + P   +     +N  +N  V ++  P   C    +  +   ++  S  +  +P  ++I  N+ I + LL         +   IQG+ +     R +  L  +S  F VL LP  +   ++R ++N K  D  DY      +S   + + +++   N  LY +    FR+     +TC
Sbjct:    4 VLAFITFQKVYYPLLCILGIPANLFTFYM-IRFRTCGMSDSARIYLSCLALVDTCYLVWVILLDLCLTFLQSQPFWHYHPW-------------CGIMNILQFGTFYCSAWVVVAFTIERFLVLRATVSCQRPLHARHALLTCTTIILLSHLASIPAGWINVVAQVNLTLNGQVVSM--P--RCIYREALYSTVVVWITSFLSSGVPIMLVIIFNSLIAYHLLCSSRLFTKEERRTIQGSKTRGSIRRTLLLLGTISVAFVVLTLPRFVTYCILRTIYNHKDFDRDDYEMPINIVSDVANMLHNLNSSTNFLLYCMVSRRFRQELLNTLTC 316          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000004512.2 (neuromedin-K receptor-like [Source:NCBI gene;Acc:103040187])

HSP 1 Score: 53.5286 bits (127), Expect = 1.780e-7
Identity = 39/138 (28.26%), Postives = 64/138 (46.38%), Query Frame = 3
Query:  219 IAVIGIVGNVFVISIFIKYRRNRFAI--YSSVLAIVNIVILVFNTFLD-DFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPL 623
            + ++ + GNV    + + +RR R     +   LA+ +  +   NT ++  +  RG  Y            + +  CRF NF P A   A+ Y + A++VDRY+ +  PLK      V    + CV   G A+VL FP+
Sbjct:   34 VLLVALTGNVLTAWVILAHRRMRTVTNYFLLNLAVADASLAALNTPVNFIYAARGQWY------------FGLAYCRFHNFYPVAAVFASIYTMTAIAVDRYMAIIHPLKPRFSATVTKVVIACVW--GAAVVLAFPV 157          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: tacr2 (tachykinin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-090312-188])

HSP 1 Score: 50.447 bits (119), Expect = 1.719e-6
Identity = 45/165 (27.27%), Postives = 73/165 (44.24%), Query Frame = 3
Query:  141 DGFNNDSILVNVVKADFIFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSV--LAIVNIVILVFNTFLDDFLGRGISYA--TDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPL 623
            DG   DS L           A    +I ++ +VGN+ VI I + ++R R      +  LA  +  +  FNT  +        YA   DW        + +G C+F NF P  +  ++ Y + A++VDRY+ +  PLK       R +  T  I++G+   + F L
Sbjct:   20 DGNYTDSNLFEQPNWQVALWAVAYSLIVLVSVVGNLTVIWIIVAHKRMRTVTNYFIVNLAFSDASMATFNTVFN------FVYALHNDW-------YFGLGYCKFQNFFPITVVFSSIYSMAAIAVDRYMAIIHPLK------SRLSSTTTKIVIGVIWAVAFSL 165          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: tacr2 (tachykinin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-090312-188])

HSP 1 Score: 50.447 bits (119), Expect = 1.754e-6
Identity = 45/165 (27.27%), Postives = 73/165 (44.24%), Query Frame = 3
Query:  141 DGFNNDSILVNVVKADFIFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSV--LAIVNIVILVFNTFLDDFLGRGISYA--TDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPL 623
            DG   DS L           A    +I ++ +VGN+ VI I + ++R R      +  LA  +  +  FNT  +        YA   DW        + +G C+F NF P  +  ++ Y + A++VDRY+ +  PLK       R +  T  I++G+   + F L
Sbjct:   37 DGNYTDSNLFEQPNWQVALWAVAYSLIVLVSVVGNLTVIWIIVAHKRMRTVTNYFIVNLAFSDASMATFNTVFN------FVYALHNDW-------YFGLGYCKFQNFFPITVVFSSIYSMAAIAVDRYMAIIHPLK------SRLSSTTTKIVIGVIWAVAFSL 182          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008040.1 (pep scaffold:Pmarinus_7.0:GL477351:476361:492361:-1 gene:ENSPMAG00000007251.1 transcript:ENSPMAT00000008040.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 8.415e-7
Identity = 42/145 (28.97%), Postives = 61/145 (42.07%), Query Frame = 3
Query:  219 IAVIGIVGNVFVISIFIKYRRNR---------FAIYSSVLAIVNIVI-LVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPL 623
            I  +   GN+ VI I + +RR R          A+  S +A +N  I  V+    D + G                      CRF NFIP A   A+ Y + A++VDRY+ +  PLK       + T L    I  +A+ L+ PL
Sbjct:   67 IVAVAFFGNMVVIWIVVAHRRMRTVTNYFLVNLAVADSAMAALNTSINFVYAVHNDWYFGGAY-------------------CRFQNFIPVAAVFASIYSMTAIAVDRYMAIRHPLK--PRMTAQSTRLVMAGIWALAMCLSLPL 190          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042752.1 (pep primary_assembly:ASM223467v1:24:10229220:10232247:1 gene:ENSORLG00000028764.1 transcript:ENSORLT00000042752.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 2.130e-9
Identity = 84/325 (25.85%), Postives = 157/325 (48.31%), Query Frame = 3
Query:  198 RAYFSPIIAVIGIVGNVFVISIFIKYRRN-----RFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLL-TKPLKYN-ADKGVRGTCLTCVIIVGMALVLNFPL--LLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKL-----LFRYSSQSFIIQGANSLSEQSRFVGHLA-VSCLFSVLFLPLSIV-IVMRLLHNSKA-DNFDYXXXXXXXXXXX-XVKDISFGGNIFLYLLFMPNFRKRCKQMVTC 1118
            R Y+ P + ++GI  N+F  + ++ Y RN        +Y S LAI +   L++   LD  L       T W  +++   +S   C  + F+ +   C++++I+V  +++RYL+L +  +K   ++ GV  T LTC+ IV ++ +++ P+  + T +LV N  V+   EN+  P   C       +   ++  S  +  IP  ++I  N  I + L     LF    Q  ++ G ++     R +  L  +S +F VL LP  +   ++R  HN ++ D  DY     ++  ++  + +++   N  LY +    FR+   Q+VTC
Sbjct:   14 RIYY-PFLCIMGIPANLF--TFYMIYFRNCGMSNAAVVYLSSLAIADTFYLIWVILLDLTL-------TFW--ILQPFWHSQPWCGILGFLQHGSLCSSSWIVVVFTIERYLVLKSSTVKQRLSEAGV--TKLTCMAIVVLSHLVSVPMGWINTVKLV-NLTVDG--ENMTLPR--CLYREHTYSTAVVWIASFLSGGIPIVLVILFNYLIGYNLCRASNLFTKEEQR-VMHGRSTRGMLKRTIFLLGTISVVFVVLSLPRFVTYCILRTKHNDESFDRNDYSIPINVAGDVANMLHNLNSSTNFLLYCVVSHRFRQELVQVVTC 318          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: tacr2 (tachykinin receptor 2 [Source:NCBI gene;Acc:101157117])

HSP 1 Score: 52.373 bits (124), Expect = 5.037e-7
Identity = 41/140 (29.29%), Postives = 65/140 (46.43%), Query Frame = 3
Query:  216 IIAVIGIVGNVFVISIFIKYRRNRFAIYSSV--LAIVNIVILVFNTFLDDFLGRGISYA--TDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPL 623
            +I ++ I GNV VI I + +RR R      +  LA  ++ +  FNT  +        YA   DW        + +G CRF NF P     ++ Y + A+SVDRY+ +  PLK       R +  +  +++ +  V  F L
Sbjct:   52 LIIIVSITGNVTVIWIILAHRRMRTVTNYFIVNLAFSDVSMATFNTLFN------FVYALHNDW-------YFGLGYCRFQNFFPITAMFSSIYSMAAISVDRYMAIIHPLK------PRLSSTSTKVVIALIWVFAFSL 172          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: grpr (gastrin-releasing peptide receptor-like [Source:NCBI gene;Acc:101159797])

HSP 1 Score: 48.1358 bits (113), Expect = 9.739e-6
Identity = 63/267 (23.60%), Postives = 124/267 (46.44%), Query Frame = 3
Query:  216 IIAVIGIVGNVFVISIFI--KYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTY-QLVINDFVNNSVENILNPEFECS-LDNSALAHFELYSKSLFTL--AIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLSEQSRFVGHLAVSC-----LFSVLFLPLSIVIVMRLLHNSKADN 983
            +I+V+G+VGN+ +I  F   K  RN   ++ S LA+ ++++LV    +D        Y +D  +  ++       C+ + FI       + + + ALS DRY  + KPL       ++ +  T  II+  A +  F L+L   + V +D    ++ +       C+   ++   H +++S + F +   IP  ++I +   +I + L + S+ +  ++G   +  Q      LA +      LF++ +LP  I+ + R  H S+ D 
Sbjct:   14 VISVLGLVGNITLIKTFCSSKSARNVPNLFMSSLALGDVLLLVTCAPVD-----ASRYLSDEWLFGRVG------CKVIPFIQLTSVGVSVFTLTALSADRYRAIVKPLD------IQTSVTTASIILRAASIWVFSLILAIPEAVYSDLHTFNIPSTNESFVTCAPYPHAGKLHPQIHSMASFLIFYVIPL-LVISMYYTVIAQSLIK-SASTLPVEGNVHMRRQIESRKRLAKTVLVFVGLFAICWLPSHIIYLYRSYHYSQVDT 261          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000012748.1 (SMESG000012748.1)

HSP 1 Score: 423.705 bits (1088), Expect = 2.252e-149
Identity = 212/215 (98.60%), Postives = 213/215 (99.07%), Query Frame = 3
Query:  132 MYFDGFNNDSILVNVVKADFIFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTG 776
            MYFDGFNNDSILVNVVK+DFIFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYS GTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPT 
Sbjct:    1 MYFDGFNNDSILVNVVKSDFIFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSTGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTA 215          

HSP 2 Score: 80.8777 bits (198), Expect = 3.589e-17
Identity = 42/50 (84.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  802 LYSNSCFDIP---ASLSSFKAQTVCLSSPDSSATWPLAVYFQYCFCLYPS 942
            LYS S F +    ASLSSFKAQTVCLSSPDSSATWPLAVYFQYCFCLYPS
Sbjct:  202 LYSKSLFTLAIPTASLSSFKAQTVCLSSPDSSATWPLAVYFQYCFCLYPS 251          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000072348.1 (SMESG000072348.1)

HSP 1 Score: 192.2 bits (487), Expect = 1.693e-57
Identity = 123/310 (39.68%), Postives = 185/310 (59.68%), Query Frame = 3
Query:  192 IFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTGIIIFLNAF--IIFKLLFRYSS--QSFIIQGAN--SLSEQSRFVGHLAVSCLFSVLFLPLSIVIVMRL-LHNSKADNFDYXX---XXXXXXXXXXVKDISFGGNIFLYLLFMPNFR 1091
            ++R YF P+I+++GI+GN+F+I  F     N+F IY   LA+ N   L+ NTFLDDFLGRG+ + T  K  IKI+    G+C FM ++PN MY A++Y++VA S+DR L+L  P+KY+  +G R T   C+ +  M  ++  PLL +Y L           N  + E  C + NS +  F LY KSL    IPT   +F+ +F  +I+ LL +     Q+   +  N  S SE  R V HLA+S +F +L +PLSI I++RL +  +   N+ Y +   +  L+K LSS+KD+S+  N FLYL+F+P+F+
Sbjct:   16 VYRGYFCPVISILGILGNIFIIFTFAYNFNNKFVIYCCALALYNSFALLTNTFLDDFLGRGLGFLTKNKFSIKIEELCQGSCLFMEYVPNVMYFASSYVMVAFSLDRMLVLALPIKYSPYRGYRYTIFICLAVGVMGAIVAGPLLFSYSL--------EKTNANSTEMSCQMINSKMVTFGLYLKSLVIFVIPT---VFVASFNIVIYCLLLQTKKRRQNLSSRKTNRGSSSEMGRIVAHLALSTVFLLLTIPLSITIILRLIIKKNSLYNYSYSYKNNVIHLTKLLSSIKDLSYAVNFFLYLIFIPSFK 314          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000016714.1 (SMESG000016714.1)

HSP 1 Score: 191.43 bits (485), Expect = 3.436e-57
Identity = 122/315 (38.73%), Postives = 185/315 (58.73%), Query Frame = 3
Query:  186 DFIFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLSEQSRFVGHLAVSCLFSVLFLPLSIVIVMRL-LHNSKADNFDYXXXXXXXXXXXXVKDISFGGNIFLYLLFMPNFRKRCKQMVTCYYN 1127
            D I+RA+ +P+ AVIGI GN  ++ +FI+ +  RF  Y  +LAI N+  ++FNT LDDFLGRG+ Y T      K +++S  +CR + F P  MY  +AY++V  ++DR L+++ P K+  +  +  T     I++ ++ +++FPL  ++ L I   ++NS          C +  S L+   LY KSL     PT III LN  II++L      Q        S  E +R  GH+A+S  F +L +PLS+VI++RL L+ S+ +N     L  LSK  SS+KDIS+  NIFLY++F+PNFRK+C  +  C YN
Sbjct:   11 DNIYRAFMAPVAAVIGIFGNSIILFLFIRMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLFITKNISNS----------CEVSKSHLSVVSLYIKSLLIFVSPTLIIIVLNVVIIYQLTQMQKYQRITTMLPVSRPEMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKSEINNDPNSILTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLFYCNYN 315          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000006006.1 (SMESG000006006.1)

HSP 1 Score: 180.644 bits (457), Expect = 4.244e-53
Identity = 119/308 (38.64%), Postives = 180/308 (58.44%), Query Frame = 3
Query:  192 IFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFII--QGANSLSEQSRFVGHLAVSCLFSVLFLPLSIVIVMRLLHNSKADNFDYXXXXXXXXXXXXVKDISFGGNIFLYLLFMPNFRKRCKQM 1109
            I+RAY  P IA+ GIVGNV VI +F++ R +RF +YS  L I N + L  N+FLDDFLGRG+ YAT  K  +K D  S  +C  M + PN MY ++ +++V  + DR+ +L  P K+    GVR + + CV +  +  +   PL +++QL      +N    I     + S ++S LA   LY +S+    IPT +I  +N FII++++     +S II  + AN L E  R VG LAVS  F +  +PLS+VI++RL    + D+ +   L+ALSK  SS+KDI++  N F+Y +F+  F+   K +
Sbjct:    9 IYRAYLIPFIAIFGIVGNVLVILVFLRKRISRFNVYSIALLIANSLALFINSFLDDFLGRGLYYATSGKSYVKFDTISKSSCIAMEYFPNVMYFSSGFVMVIFTFDRFFVLMWPFKFKGTGGVRKSIIACVAVYFLGFITGIPLGISHQLK----ASNDKWGIEGKICQISSNDSHLATLSLYYESVIVYVIPTVLIFIVNTFIIYEIIKMTKIRSTIILDKQANHL-EMCRIVGMLAVSSTFLLFTIPLSVVIIIRL----QIDHPNGKNLRALSKLFSSLKDINYSINFFIYFIFLSYFKYDLKML 307          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000003388.1 (SMESG000003388.1)

HSP 1 Score: 164.081 bits (414), Expect = 2.134e-46
Identity = 107/325 (32.92%), Postives = 183/325 (56.31%), Query Frame = 3
Query:  195 FRAYFSPIIAVIGIVGNVFVISIF-IKYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIV-IKIDVYSIGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSA----LAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQG----------------ANSLSEQSRFVGHLAVSCLFSVLFLPLSIVIVMRLLHNSK----ADNFDYXXXXXXXXXXXXVKDISFGGNIFLYLLFMPNFR 1091
            FRAY +P++AV+GI GN+FVI IF  + + +RF++Y   LA V +V L+ N+F+DDFLGRG+S+   + ++  K D +S  +C+ M ++PN M+   +++ V  S+DR L + +PLK+++   ++ + + CV        +N PLLL+Y L+         EN      +C++  +     +A F LY   L +  IPT I++ LN  I  KL   + +++ + +                  N   E +R +GHLAV+ +F +L +PL IVI++R+  +       + + Y   + LS+  SS+KD++F    F+Y++F+PNFR
Sbjct:   25 FRAYVTPVVAVVGIFGNIFVILIFYFETKLSRFSVYCISLAFVQLVALIVNSFMDDFLGRGLSHVLGYYLLAFKWDTHSDMSCKMMEYVPNTMFFIASFVTVLFSIDRLLTIHQPLKFHSVYYIKYSIMACVGTFLFGFAINIPLLLSYGLI-------KQENEFGITLKCTVVATGARKFVADFGLYLVLLGSFTIPTFIVLILNTLISIKLWQLHLNRAEMTKSFDTSDSKSSAINPSLMKNQEKELNRVLGHLAVNVVFLLLTMPLVIVIILRMYSDDNKMYLTNLYLYNSFQHLSRLFSSLKDVNFSCEFFIYMIFLPNFR 342          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SIFaR2.107e-626.55gene:FBgn0038880 transcript:FBtr0084098[more]
SIFaR2.107e-626.55gene:FBgn0038880 transcript:FBtr0301815[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FO904943.11.336e-627.34neuromedin-K receptor-like [Source:NCBI gene;Acc:1... [more]
tacr23.819e-626.32tachykinin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-09... [more]
tacr23.819e-626.32tachykinin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-09... [more]
tacr23.819e-626.32tachykinin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-09... [more]
grpr6.730e-623.86gastrin-releasing peptide receptor [Source:ZFIN;Ac... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Gpr1832.729e-626.62G protein-coupled receptor 183 [Source:MGI Symbol;... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUG50.000e+099.44GCR157 OS=Schmidtea mediterranea OX=79327 GN=gcr15... [more]
A0A183KKN21.396e-4836.45G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A430QMQ31.441e-4836.45G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183P8J01.568e-4836.45G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183L9P86.596e-4837.11G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000035261.11.211e-722.66probable G-protein coupled receptor 139 [Source:NC... [more]
ENSAMXT00000004512.21.780e-728.26neuromedin-K receptor-like [Source:NCBI gene;Acc:1... [more]
tacr21.719e-627.27tachykinin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-09... [more]
tacr21.754e-627.27tachykinin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-09... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008040.18.415e-728.97pep scaffold:Pmarinus_7.0:GL477351:476361:492361:-... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000042752.12.130e-925.85pep primary_assembly:ASM223467v1:24:10229220:10232... [more]
tacr25.037e-729.29tachykinin receptor 2 [Source:NCBI gene;Acc:101157... [more]
grpr9.739e-623.60gastrin-releasing peptide receptor-like [Source:NC... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012748.12.252e-14998.60SMESG000012748.1[more]
SMESG000072348.11.693e-5739.68SMESG000072348.1[more]
SMESG000016714.13.436e-5738.73SMESG000016714.1[more]
SMESG000006006.14.244e-5338.64SMESG000006006.1[more]
SMESG000003388.12.134e-4632.92SMESG000003388.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001251 ID=SMED30001251|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1237bp
AATTGATTGACAAGAATGGCTGTACACGTTTCAACTCTACTCTGAACCAG
CCAATCAAAACAAGATTAAAATAGAAGCTACTTACAATTTAATTTGTTGA
AATTTGAAATAATGAATTTGAAAAATATTTGATGTATTTCGATGGTTTTA
ACAACGACTCGATATTGGTAAATGTAGTCAAAGCCGATTTCATATTCCGT
GCCTATTTCAGTCCGATAATTGCTGTGATTGGAATTGTTGGAAACGTTTT
TGTCATCTCAATTTTCATAAAATACCGACGAAACCGATTTGCAATTTATT
CTTCAGTGTTAGCAATTGTCAACATTGTCATTCTCGTATTCAATACGTTT
CTCGATGATTTTCTCGGTCGGGGAATTTCCTACGCCACAGATTGGAAAAT
CGTCATCAAAATCGACGTTTATTCAATCGGAACCTGTCGGTTTATGAATT
TCATTCCGAACGCAATGTATTGCGCGAATGCCTACATCATTGTCGCCCTG
TCTGTTGATAGGTATTTGCTATTGACGAAACCGTTGAAATACAACGCCGA
CAAAGGTGTTAGAGGGACTTGTTTGACATGTGTCATTATTGTTGGAATGG
CTTTGGTTTTAAACTTCCCGCTTCTACTTACGTATCAATTGGTGATAAAT
GATTTTGTCAACAATTCTGTCGAGAATATATTAAATCCAGAATTCGAATG
CAGCTTGGATAATTCAGCTTTGGCACATTTTGAATTGTATTCTAAATCCT
TGTTTACTTTAGCAATTCCGACAGGTATTATAATCTTTCTCAACGCATTT
ATTATATTCAAACTCCTGTTTCGATATTCCAGCCAGTCTTTCATCATTCA
AGGCGCAAACAGTTTGTCTGAGCAGTCCAGATTCGTCGGCCACTTGGCCG
TTAGCTGTTTATTTTCAGTATTGTTTCTGCCTTTATCCATCGTGATCGTA
ATGAGACTGTTACATAATAGTAAGGCTGATAATTTTGATTATTTATTTCT
CAAAGCTCTTTCGAAATTCTTGTCCTCTGTAAAAGACATCAGTTTCGGCG
GGAACATTTTTCTATACCTGTTGTTCATGCCGAATTTCAGAAAGCGATGT
AAACAGATGGTCACTTGCTATTACAACAGTCATCCTTCTCATTATCACTG
CAGCCAGGTATTTTTGAGCCCGGCTAGGTTGTCACTGTTGATCCAGAATG
ATCTGAAATACTAAATATCAAGTTCAGTGAACTATCC
back to top

protein sequence of SMED30001251-orf-1

>SMED30001251-orf-1 ID=SMED30001251-orf-1|Name=SMED30001251-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
MYFDGFNNDSILVNVVKADFIFRAYFSPIIAVIGIVGNVFVISIFIKYRR
NRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSIG
TCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTC
VIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHF
ELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLSEQSR
FVGHLAVSCLFSVLFLPLSIVIVMRLLHNSKADNFDYLFLKALSKFLSSV
KDISFGGNIFLYLLFMPNFRKRCKQMVTCYYNSHPSHYHCSQVFLSPARL
SLLIQNDLKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 37..291
e-value: 1.3E-13
score: 50.9
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 115..131
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 10..336
e-value: 4.7E-35
score: 123.0
NoneNo IPR availablePANTHERPTHR24229NEUROPEPTIDES RECEPTORcoord: 19..341
NoneNo IPR availablePANTHERPTHR24229:SF40GH14208Pcoord: 19..341
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 21..323
e-value: 3.0046E-20
score: 87.6884
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 20..339
NoneNo IPR availableTMHMMTMhelixcoord: 150..172
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 55..74
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 107..129
NoneNo IPR availableTMHMMTMhelixcoord: 208..230
NoneNo IPR availableTMHMMTMhelixcoord: 293..315
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 37..312
score: 20.913