Mitogen-activated protein kinase kinase kinase 1a

Overview
NameMitogen-activated protein kinase kinase kinase 1a
Smed IDSMED30001242
Length (bp)2745
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitogen-activated protein kinase kinase kinase 1a (SMED30001242) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitogen-activated protein kinase kinase kinase 1a (SMED30001242) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitogen-activated protein kinase kinase kinase 1a (SMED30001242) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitogen-activated protein kinase kinase kinase 1a (SMED30001242) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001242

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30001242SMESG000017260.1 dd_Smed_v4_4322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001242SMESG000017260.1 dd_Smed_v4_4322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001242SMESG000017260.1 dd_Smed_v4_4322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001242SMESG000017260.1 dd_Smed_v4_4322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001242SMESG000017260.1 SMESG000017259.1 SMESG000017258.1 Contig34002newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001242SMESG000017260.1 SMESG000017259.1 SMESG000017258.1 Contig34002uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30001242SMESG000017260.1 dd_Smed_v4_4322_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 195.667 bits (496), Expect = 2.291e-50
Identity = 89/380 (23.42%), Postives = 187/380 (49.21%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L++   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q  +  A   +   PLHL+  +GH D+   L+D   ++    +    P+H+A   G L++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   +I   L+ +  D  A    G  ++HLA ++G+ D+  LL+  N ++ + ++    P+H A +     + ++L++   +++A  K    P+H     G+++    L+     + A  +N    +H A ++GH  I+ +L++ + +   LT+ GN+ + +A +     +++ LK
Sbjct:  431 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 810          

HSP 2 Score: 188.734 bits (478), Expect = 3.681e-48
Identity = 95/383 (24.80%), Postives = 189/383 (49.35%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A   +   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K L ++K N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH  IV  L++H       +  G  A+H+A   G A++ + L+ +   +E   +  + P+H +  +G  +IVQ L+    +  A       P+H ++  GH +    L+     +    +     +H+A + G  E+  LL++   + +A    G +P+ +A     Q++  LL
Sbjct:  229 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLL 611          

HSP 3 Score: 187.193 bits (474), Expect = 1.147e-47
Identity = 105/415 (25.30%), Postives = 193/415 (46.51%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGH---------------------------------KEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L+++K N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH                                  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q  + +A   +   P+HL+  +GH  +   L +   ++    +  + P+H A   G+ E+ N+L+ K    +A  K  L P+H+A    ++++  +L++      A   +G+  +H+A +K   DIA  L++   D     +     +H A + GH ++V LL+  N N+   +K    P+H A++   V   ++L+ +   ++A  +     +H+ C  G+ +IV  L++      A T  G +P+  A +     II +L Q
Sbjct:  364 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 778          

HSP 4 Score: 179.489 bits (454), Expect = 2.688e-45
Identity = 99/412 (24.03%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V++L+++     +  +N   P+H A +                                  GH +V K+L+++K N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+       A    G+  +HL+  +G+ D+A  L+D+   + +  +    P+H A + G  E+  LL+  + + +A  K    P+H A+   + +   +L+ +     A A+N    +H+A +K   +I   L+    +  A+T +G + + LA +    +++ LL
Sbjct:  266 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 677          

HSP 5 Score: 179.489 bits (454), Expect = 2.688e-45
Identity = 86/347 (24.78%), Postives = 168/347 (48.41%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G A++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q     A   +   P+H + + GH++V   L++   +L    K    PLH+A + G  ++  LL+ +  + DA  ++   P+H+A    + K+   L +Q  +  AA +  + P+H A  K Q +I   L+    D  A  ++ +  +HLA  +GH ++V +L+    ++   +  G   +HLA ++   ++A++L++    ++   ++   P+H  C  G+ +IV  L+  +  + A  K    P+H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  463 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 809          

HSP 6 Score: 178.718 bits (452), Expect = 4.752e-45
Identity = 98/428 (22.90%), Postives = 201/428 (46.96%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC-----------------------------NIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  EGH ++V  L+ ++ N +   +K    +H+A   G  ++VK+L+    +  A  +N   P++ A +  H EVVK L++   +     ++   PL +A ++GH  +V LL++                                N D   ++   P+H+A   G++ +   L N+   ++   + +  P+H A  +G   +V +L+ +   I+A  +  L P+H     GH+++VE+L++    I +   +G   +H+A +  + +  QLL+ +N  ++         +H A   GH ++ ++L+D  AN N +A + +   P+H A +   ++  ++L+     I+A  ++    IH+A   GH  IV  L+    +     ++G + + +A +S + E++  L Q   + ++    D+ P
Sbjct:   71 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFT--PLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTP 496          

HSP 7 Score: 174.481 bits (441), Expect = 1.129e-43
Identity = 93/382 (24.35%), Postives = 177/382 (46.34%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A    HL  V+ L      ++         +H A   G  ++  +L+ KK +  A       P+H+AC K   +++E+L+ H   I+A  + G   IH+A   G+ +I   L+ +       +   +  +H A   G  E+V+ L+     +EA  K ++ P+H ++  G  +  + L+ +     A   +    +HL+  +GH ++   L+    +    T KG +P+ +A K  K E+  LL Q
Sbjct:  199 ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQ 580          

HSP 8 Score: 173.326 bits (438), Expect = 2.233e-43
Identity = 88/379 (23.22%), Postives = 181/379 (47.76%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV  L+    + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +     A       P+HL+  +GH+++   L++H   +      G+  +H+A + G  ++A LL+  +   +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   ++    L+    D  A  +    ++HLA ++GH ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  332 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVL 710          

HSP 9 Score: 161.384 bits (407), Expect = 1.236e-39
Identity = 87/376 (23.14%), Postives = 182/376 (48.40%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   GH +     I    +   C +     +HLA ++G+ ++V  L++++ + +A  +     +H A   G  EVVK+L+    N+ A  +N   PL++A ++ H ++V+ L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V++L+D    I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   42 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELL 413          

HSP 10 Score: 134.806 bits (338), Expect = 2.400e-31
Identity = 81/317 (25.55%), Postives = 151/317 (47.63%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDG---WRAIHLACEKGYADIAQLLI--DNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + GH E     I    ++  C++N    LHLA ++GH ++V  L+ ++ N+DA  +  N  +H+A   G  ++VK L     N+ A +Q  + P++ A  +   E+V  L+          +    P+ +A  +GH ++V +L+ +       D  G     A+H+A  K     A LL+  DNN D+E     +  P+H A   G+  +  LL++    ++   + +  P+H AS+ G+    K+L+ +   I+A  ++    +H     GH ++V++L+       + T  G SP+ +A +      ++LL Q
Sbjct:   42 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN-------DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFT--PLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 349          

HSP 11 Score: 133.65 bits (335), Expect = 6.489e-31
Identity = 61/252 (24.21%), Postives = 122/252 (48.41%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  ++  +L+ +  + +   +    P+H+A     +K+  +L++Q     A  +N   P+H A K+   ++   L+    +  A  +     +HLA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ  +++A  ++ + P+H  C  G  +IVN L+     + A  K    P+H A  +GH  I+ VL+ +         +G  A+ +A   GY  +   L
Sbjct:  558 KGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 809          

HSP 12 Score: 82.8037 bits (203), Expect = 2.465e-15
Identity = 44/151 (29.14%), Postives = 76/151 (50.33%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G+ + A   I N  DI +C+Q     +H A + GH E+V  L+    N++A  K     +H AS AG  E  K+L+    ++ A +QN    +++A ++ H E+VK L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   42 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 192          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 195.282 bits (495), Expect = 2.509e-50
Identity = 89/380 (23.42%), Postives = 187/380 (49.21%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L++   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q  +  A   +   PLHL+  +GH D+   L+D   ++    +    P+H+A   G L++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   +I   L+ +  D  A    G  ++HLA ++G+ D+  LL+  N ++ + ++    P+H A +     + ++L++   +++A  K    P+H     G+++    L+     + A  +N    +H A ++GH  I+ +L++ + +   LT+ GN+ + +A +     +++ LK
Sbjct:  420 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 799          

HSP 2 Score: 188.348 bits (477), Expect = 3.755e-48
Identity = 95/383 (24.80%), Postives = 189/383 (49.35%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A   +   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K L ++K N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH  IV  L++H       +  G  A+H+A   G A++ + L+ +   +E   +  + P+H +  +G  +IVQ L+    +  A       P+H ++  GH +    L+     +    +     +H+A + G  E+  LL++   + +A    G +P+ +A     Q++  LL
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLL 600          

HSP 3 Score: 186.808 bits (473), Expect = 1.170e-47
Identity = 105/415 (25.30%), Postives = 193/415 (46.51%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGH---------------------------------KEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L+++K N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH                                  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q  + +A   +   P+HL+  +GH  +   L +   ++    +  + P+H A   G+ E+ N+L+ K    +A  K  L P+H+A    ++++  +L++      A   +G+  +H+A +K   DIA  L++   D     +     +H A + GH ++V LL+  N N+   +K    P+H A++   V   ++L+ +   ++A  +     +H+ C  G+ +IV  L++      A T  G +P+  A +     II +L Q
Sbjct:  353 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 767          

HSP 4 Score: 179.489 bits (454), Expect = 2.790e-45
Identity = 99/412 (24.03%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V++L+++     +  +N   P+H A +                                  GH +V K+L+++K N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+       A    G+  +HL+  +G+ D+A  L+D+   + +  +    P+H A + G  E+  LL+  + + +A  K    P+H A+   + +   +L+ +     A A+N    +H+A +K   +I   L+    +  A+T +G + + LA +    +++ LL
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 666          

HSP 5 Score: 179.489 bits (454), Expect = 2.941e-45
Identity = 86/347 (24.78%), Postives = 168/347 (48.41%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G A++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q     A   +   P+H + + GH++V   L++   +L    K    PLH+A + G  ++  LL+ +  + DA  ++   P+H+A    + K+   L +Q  +  AA +  + P+H A  K Q +I   L+    D  A  ++ +  +HLA  +GH ++V +L+    ++   +  G   +HLA ++   ++A++L++    ++   ++   P+H  C  G+ +IV  L+  +  + A  K    P+H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  452 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 798          

HSP 6 Score: 178.718 bits (452), Expect = 4.763e-45
Identity = 98/428 (22.90%), Postives = 201/428 (46.96%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC-----------------------------NIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  EGH ++V  L+ ++ N +   +K    +H+A   G  ++VK+L+    +  A  +N   P++ A +  H EVVK L++   +     ++   PL +A ++GH  +V LL++                                N D   ++   P+H+A   G++ +   L N+   ++   + +  P+H A  +G   +V +L+ +   I+A  +  L P+H     GH+++VE+L++    I +   +G   +H+A +  + +  QLL+ +N  ++         +H A   GH ++ ++L+D  AN N +A + +   P+H A +   ++  ++L+     I+A  ++    IH+A   GH  IV  L+    +     ++G + + +A +S + E++  L Q   + ++    D+ P
Sbjct:   60 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFT--PLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTP 485          

HSP 7 Score: 174.481 bits (441), Expect = 1.122e-43
Identity = 93/382 (24.35%), Postives = 177/382 (46.34%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A    HL  V+ L      ++         +H A   G  ++  +L+ KK +  A       P+H+AC K   +++E+L+ H   I+A  + G   IH+A   G+ +I   L+ +       +   +  +H A   G  E+V+ L+     +EA  K ++ P+H ++  G  +  + L+ +     A   +    +HL+  +GH ++   L+    +    T KG +P+ +A K  K E+  LL Q
Sbjct:  188 ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQ 569          

HSP 8 Score: 173.326 bits (438), Expect = 2.297e-43
Identity = 88/379 (23.22%), Postives = 181/379 (47.76%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV  L+    + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +     A       P+HL+  +GH+++   L++H   +      G+  +H+A + G  ++A LL+  +   +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   ++    L+    D  A  +    ++HLA ++GH ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  321 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVL 699          

HSP 9 Score: 161.77 bits (408), Expect = 1.156e-39
Identity = 87/376 (23.14%), Postives = 182/376 (48.40%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   GH +     I    +   C +     +HLA ++G+ ++V  L++++ + +A  +     +H A   G  EVVK+L+    N+ A  +N   PL++A ++ H ++V+ L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V++L+D    I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   31 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELL 402          

HSP 10 Score: 134.806 bits (338), Expect = 2.854e-31
Identity = 81/317 (25.55%), Postives = 151/317 (47.63%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDG---WRAIHLACEKGYADIAQLLI--DNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + GH E     I    ++  C++N    LHLA ++GH ++V  L+ ++ N+DA  +  N  +H+A   G  ++VK L     N+ A +Q  + P++ A  +   E+V  L+          +    P+ +A  +GH ++V +L+ +       D  G     A+H+A  K     A LL+  DNN D+E     +  P+H A   G+  +  LL++    ++   + +  P+H AS+ G+    K+L+ +   I+A  ++    +H     GH ++V++L+       + T  G SP+ +A +      ++LL Q
Sbjct:   31 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN-------DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFT--PLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 338          

HSP 11 Score: 133.265 bits (334), Expect = 7.392e-31
Identity = 61/252 (24.21%), Postives = 122/252 (48.41%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  ++  +L+ +  + +   +    P+H+A     +K+  +L++Q     A  +N   P+H A K+   ++   L+    +  A  +     +HLA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ  +++A  ++ + P+H  C  G  +IVN L+     + A  K    P+H A  +GH  I+ VL+ +         +G  A+ +A   GY  +   L
Sbjct:  547 KGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 798          

HSP 12 Score: 84.3445 bits (207), Expect = 7.455e-16
Identity = 57/197 (28.93%), Postives = 90/197 (45.69%), Query Frame = 2
Query: 1334 EAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            E P++KN +P H    KG K           D  A      RA HL     Y       I N  DI +C+Q     +H A + GH E+V  L+    N++A  K     +H AS AG  E  K+L+    ++ A +QN    +++A ++ H E+VK L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:    3 EEPKEKNAKPAHRKR-KGKK----------SDANASYLRAARAGHLEKALDY-------IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 181          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 186.422 bits (472), Expect = 1.187e-47
Identity = 98/384 (25.52%), Postives = 190/384 (49.48%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ ++  +L+N+    +  A     P+H+A ++G   +VK+L+++    +A   +   P+H A + GH +VV+LL+ +   L A  KN   PLH+A +  H + V+ L+  K  +D    +    +H+A   GH ++ K L +++ N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH  IV +L+ +    +  +  G  A+H+A   G  ++ + L+ N   ++   +  + P+H A  +G TEIVQLL+    + +A       P+H ++  G V+   +L+          +     +H+A + G  ++ KLL++     ++    G +P+ +A     Q++  LL
Sbjct:  204 SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLL 587          

HSP 2 Score: 180.644 bits (457), Expect = 8.038e-46
Identity = 107/420 (25.48%), Postives = 199/420 (47.38%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIE----------------QKCDTEA---------------------YDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  ++ A  E H D+VK L+    N  T  E    P+ +A ++G+ + V IL+E                +K DT++                       E+   P+H A   G+  V  LL+N+   ++   +N   PLH+A ++G+T++V+LL+D+   IDA  ++   P+H A   GH ++V+ L  +   + A  +    P+H A      E V  L+  K  ++      L  +H+A   GH  + ++L++ + +  A   +G+  +H+AC+K    + +LL+     I+   +    PIH A  MGH  IV LL+    + +  +      +H A+ AG VE  + L+     ++A A+ E+  +H+A   G  EIV+LL++   + +A T  G +P+ ++ +  + ++  +L
Sbjct:  102 GFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL 521          

HSP 3 Score: 176.407 bits (446), Expect = 1.776e-44
Identity = 100/412 (24.27%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+ ++VK+L+++    +        P+H A   G++++V++L+E+     A  +N   P+H A +                                  GH  V KLL++++ N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GHL IV  L     + +  N      +H A   GQ E+V  L+     ++A  ++   P+H+A   G  EIV++L+ H    +A   +G+  +H++  +G  D+A +L++      +  +    P+H A + G  ++ +LL+      ++  K    P+H A+   + +   +L+ K     A A+N    +H+A +K   +I   L+     T  +T +G +P+ LA +    +++ LL
Sbjct:  242 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLL 653          

HSP 4 Score: 174.481 bits (441), Expect = 6.285e-44
Identity = 94/368 (25.54%), Postives = 176/368 (47.83%), Query Frame = 2
Query:  809 KMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            KM++N+        E    P+H+A   G   +  +L+ +    +    N   P+H A KRG+  +VKLL+++   ++A  ++   PLH A   GH  +V LL+++   + A  +N   P+H+A    H++ VK L   K  ++         +H A   G   +  +L+ K+ +  A       P+H+AC K   +++E+L+ +   I+A  + G   IH+A   G+ +I  LL+ N    +V +   +  +H A   G  E+V+ L+     ++A  +  + P+H AS  G  E  ++L+      +A   N    +H++  +G  ++  +L+ A       T KG +P+ +A K    ++ +LL Q
Sbjct:  195 KMMVNR------TTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ 556          

HSP 5 Score: 173.711 bits (439), Expect = 1.409e-43
Identity = 94/385 (24.42%), Postives = 179/385 (46.49%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+  IV +L++     +  +      +H A + G  EVV+ L+     ++A  +  Q PLH+A   G T+IV+LL+    + DA   N   P+H++  +G + +   L         A +  + P+H A   G  ++  +L+ ++   ++  K  L P+H+A    ++++  +L+       A   +G+  +H+A +K    IA  L++   +  +  +    P+H A + GHT++V LL+D   NI    K     +H A++   V    IL     D +A  +     + +AC  G+ ++V  L++   N  A T  G +P+  A +     II +L Q
Sbjct:  370 GFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 754          

HSP 6 Score: 171.014 bits (432), Expect = 1.003e-42
Identity = 88/380 (23.16%), Postives = 175/380 (46.05%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV +L+    + +    + +  +H+A   G  ++V+ L+      +A       P+H A + G  E+V+LL+    + +A   N   PLH++  +G  D+  +L++         +    P+H+A   G L + K L  ++   ++A +    P+H A     +++  +L+ K     A  K    P+H+A  K   +I   L+N+  +       G   +HLA ++G+ D+  LL+D   +I +  +     +H A +     +  +L     + +A  K    P+  A   G+V+    L+ +  ++ A  +N    +H A ++GH  I+ +L++      A T  GN+ + +A++     +++ LK
Sbjct:  407 IHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 786          

HSP 7 Score: 169.859 bits (429), Expect = 2.344e-42
Identity = 87/368 (23.64%), Postives = 174/368 (47.28%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            A+H A   GH  + K+L++++ N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH  +V LL+    + +  +   +  LH+A   G  ++VR L+     +DA  +    P+H+A   G  +IV+ L     + +AA    + P+H +  +GQ ++ ++L+          KK   P+H+A   G  ++ ++L+  +   ++   +G   +H+A       +A LL++         +    P+H A +    +I   L++         K    P+H AS+ GH +   +L+ K  +I    ++   ++HLA ++    +  +L +   + +A T  G +P+ +A
Sbjct:  340 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVA 707          

HSP 8 Score: 168.318 bits (425), Expect = 5.923e-42
Identity = 85/347 (24.50%), Postives = 164/347 (47.26%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G  ++V+ L+      +  A + Q P+H+A   G  +IV++L++     +A   N   P+H + + G  +V  +L+          K    PLH+A + G  D+ +LL+ ++   D+  +N   P+H+A    + K+   L  +  +  A  +  + P+H A  K Q +I + L+    +     K+ + P+HLA  +GH ++V +L++   +I      G  ++HLA ++   ++A +L  +  D +   ++   P+  AC  G+ ++V  L+    N+ A  K    P+H A++ GH     +L+       A   N   A+ +A   G+  +V  L
Sbjct:  439 ALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 785          

HSP 9 Score: 164.851 bits (416), Expect = 8.654e-41
Identity = 94/390 (24.10%), Postives = 185/390 (47.44%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKAL--------TNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  EGH  +V+ L+ +  + ++  +K    +H+A   G  ++VK+L+++  +  A  +N   P++ A +  H +VVK L+    N     ++   PL +A ++GH   V +L++     D   +     +H+A  K   K    L           K  +    +  + P+H A   G   +  +L+ +   ++   +  + P+H+A  +G+  +V++L++    I+A   DG   +H A   G+  + +LL++    +    +    P+H A +  H E V+ L+     ++         +H A+  GH   TK+L+ K+ +  A A N    +H+AC+K   ++++LLV+   + +A+T  G +PI +A       I+ LL Q
Sbjct:   39 ALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQ 424          

HSP 10 Score: 162.925 bits (411), Expect = 3.525e-40
Identity = 94/384 (24.48%), Postives = 182/384 (47.40%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNIL--------ITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   G+ D V   +    +  TC +     +HLA ++G+  +V+ L+ +    ++  +     +H A   G  EVVK+L+ +  N+ A  +N   PL++A ++ H D+V+ L++   N     ++   P+ +A  +GH + V  L       +   ++    +H A  K   +   +L        +  K  +    +    P+H+A   G+  +  +L+N    ++    +G   +H+A ++G  ++ +LL+D    I+   +    P+H A   GH ++V+LL++    + A  K    P+H A++  HVEC K L+  K  ++    +   A+H+A   GH  + KLL+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   10 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELL 389          

HSP 11 Score: 158.688 bits (400), Expect = 7.238e-39
Identity = 87/381 (22.83%), Postives = 177/381 (46.46%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            +H A    H + VK L+  K   +         +H+A   G+ ++ K+L++++ +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV LL+    + D  +      +H+A   G +++V+ L      ++A  +    P+H A   G+ EIV +L+      +A       P+H++  +G  ++  VL+            G+  +H+A + G  D+A+LL+      +   +    P+H A    + ++  LL++   +  A  K    P+H A++   ++    L+    +     +     +HLA ++GH ++V LL+    N    T  G + + LA +  K  + ++L +
Sbjct:  308 LHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTK 688          

HSP 12 Score: 141.739 bits (356), Expect = 1.225e-33
Identity = 68/252 (26.98%), Postives = 123/252 (48.81%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  D+ K+L+ ++   ++  +    P+H+A     +K+  +L+E+     A  +N   P+H A K+   ++   L+N         K    PLHLA ++GHTD+V LL+D+  NI  + ++    +HLA  +  + +   LT    + +A  ++ + P+  AC  G  ++VN L+ +  ++ A  K    P+H A  +GH  I+ VL+ H     A   +G  A+ +A   GY  +   L
Sbjct:  534 KGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 785          

HSP 13 Score: 97.0561 bits (240), Expect = 8.306e-20
Identity = 64/290 (22.07%), Postives = 127/290 (43.79%), Query Frame = 2
Query: 1148 QNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLI-------------------------------DANCNIEACDKWNR------RPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +SN     A   G+L  V        +I   NQ     +H A  +G   +V  L+ +   +++  KK    +H+A   G  E+V+VL+    +I A   +G+  +++A ++ + D+ + L++N  +     +    P+  A + GH + V +L+                               D N ++++    NR       P+H A+  G+V    +L+ +   ++  A+N    +H+A ++G+  +VKLL+      +A T  G +P+  A +S   +++ELL
Sbjct:    1 SDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL 290          

HSP 14 Score: 72.0182 bits (175), Expect = 4.296e-12
Identity = 40/151 (26.49%), Postives = 72/151 (47.68%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  D     +    DI  C+Q     +H A + GH  +VQ L+    ++++  K     +H AS AG  E  K+L+ +  +I A +QN    +++A ++ H ++VK L+    N    T  G +P+ +A +    + + +L +  TK
Sbjct:   10 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTK 160          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 186.037 bits (471), Expect = 1.347e-47
Identity = 98/384 (25.52%), Postives = 190/384 (49.48%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ ++  +L+N+    +  A     P+H+A ++G   +VK+L+++    +A   +   P+H A + GH +VV+LL+ +   L A  KN   PLH+A +  H + V+ L+  K  +D    +    +H+A   GH ++ K L +++ N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH  IV +L+ +    +  +  G  A+H+A   G  ++ + L+ N   ++   +  + P+H A  +G TEIVQLL+    + +A       P+H ++  G V+   +L+          +     +H+A + G  ++ KLL++     ++    G +P+ +A     Q++  LL
Sbjct:  211 SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLL 594          

HSP 2 Score: 180.259 bits (456), Expect = 1.039e-45
Identity = 107/420 (25.48%), Postives = 199/420 (47.38%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIE----------------QKCDTEA---------------------YDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  ++ A  E H D+VK L+    N  T  E    P+ +A ++G+ + V IL+E                +K DT++                       E+   P+H A   G+  V  LL+N+   ++   +N   PLH+A ++G+T++V+LL+D+   IDA  ++   P+H A   GH ++V+ L  +   + A  +    P+H A      E V  L+  K  ++      L  +H+A   GH  + ++L++ + +  A   +G+  +H+AC+K    + +LL+     I+   +    PIH A  MGH  IV LL+    + +  +      +H A+ AG VE  + L+     ++A A+ E+  +H+A   G  EIV+LL++   + +A T  G +P+ ++ +  + ++  +L
Sbjct:  109 GFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL 528          

HSP 3 Score: 176.022 bits (445), Expect = 2.075e-44
Identity = 100/412 (24.27%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+ ++VK+L+++    +        P+H A   G++++V++L+E+     A  +N   P+H A +                                  GH  V KLL++++ N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GHL IV  L     + +  N      +H A   GQ E+V  L+     ++A  ++   P+H+A   G  EIV++L+ H    +A   +G+  +H++  +G  D+A +L++      +  +    P+H A + G  ++ +LL+      ++  K    P+H A+   + +   +L+ K     A A+N    +H+A +K   +I   L+     T  +T +G +P+ LA +    +++ LL
Sbjct:  249 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLL 660          

HSP 4 Score: 174.096 bits (440), Expect = 7.553e-44
Identity = 94/368 (25.54%), Postives = 176/368 (47.83%), Query Frame = 2
Query:  809 KMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            KM++N+        E    P+H+A   G   +  +L+ +    +    N   P+H A KRG+  +VKLL+++   ++A  ++   PLH A   GH  +V LL+++   + A  +N   P+H+A    H++ VK L   K  ++         +H A   G   +  +L+ K+ +  A       P+H+AC K   +++E+L+ +   I+A  + G   IH+A   G+ +I  LL+ N    +V +   +  +H A   G  E+V+ L+     ++A  +  + P+H AS  G  E  ++L+      +A   N    +H++  +G  ++  +L+ A       T KG +P+ +A K    ++ +LL Q
Sbjct:  202 KMMVNR------TTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ 563          

HSP 5 Score: 172.94 bits (437), Expect = 1.709e-43
Identity = 94/385 (24.42%), Postives = 179/385 (46.49%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+  IV +L++     +  +      +H A + G  EVV+ L+     ++A  +  Q PLH+A   G T+IV+LL+    + DA   N   P+H++  +G + +   L         A +  + P+H A   G  ++  +L+ ++   ++  K  L P+H+A    ++++  +L+       A   +G+  +H+A +K    IA  L++   +  +  +    P+H A + GHT++V LL+D   NI    K     +H A++   V    IL     D +A  +     + +AC  G+ ++V  L++   N  A T  G +P+  A +     II +L Q
Sbjct:  377 GFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 761          

HSP 6 Score: 170.629 bits (431), Expect = 1.024e-42
Identity = 88/380 (23.16%), Postives = 175/380 (46.05%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV +L+    + +    + +  +H+A   G  ++V+ L+      +A       P+H A + G  E+V+LL+    + +A   N   PLH++  +G  D+  +L++         +    P+H+A   G L + K L  ++   ++A +    P+H A     +++  +L+ K     A  K    P+H+A  K   +I   L+N+  +       G   +HLA ++G+ D+  LL+D   +I +  +     +H A +     +  +L     + +A  K    P+  A   G+V+    L+ +  ++ A  +N    +H A ++GH  I+ +L++      A T  GN+ + +A++     +++ LK
Sbjct:  414 IHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 793          

HSP 7 Score: 169.088 bits (427), Expect = 2.904e-42
Identity = 87/368 (23.64%), Postives = 174/368 (47.28%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            A+H A   GH  + K+L++++ N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH  +V LL+    + +  +   +  LH+A   G  ++VR L+     +DA  +    P+H+A   G  +IV+ L     + +AA    + P+H +  +GQ ++ ++L+          KK   P+H+A   G  ++ ++L+  +   ++   +G   +H+A       +A LL++         +    P+H A +    +I   L++         K    P+H AS+ GH +   +L+ K  +I    ++   ++HLA ++    +  +L +   + +A T  G +P+ +A
Sbjct:  347 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVA 714          

HSP 8 Score: 168.318 bits (425), Expect = 6.443e-42
Identity = 85/347 (24.50%), Postives = 164/347 (47.26%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G  ++V+ L+      +  A + Q P+H+A   G  +IV++L++     +A   N   P+H + + G  +V  +L+          K    PLH+A + G  D+ +LL+ ++   D+  +N   P+H+A    + K+   L  +  +  A  +  + P+H A  K Q +I + L+    +     K+ + P+HLA  +GH ++V +L++   +I      G  ++HLA ++   ++A +L  +  D +   ++   P+  AC  G+ ++V  L+    N+ A  K    P+H A++ GH     +L+       A   N   A+ +A   G+  +V  L
Sbjct:  446 ALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          

HSP 9 Score: 164.466 bits (415), Expect = 1.049e-40
Identity = 94/390 (24.10%), Postives = 185/390 (47.44%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKAL--------TNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  EGH  +V+ L+ +  + ++  +K    +H+A   G  ++VK+L+++  +  A  +N   P++ A +  H +VVK L+    N     ++   PL +A ++GH   V +L++     D   +     +H+A  K   K    L           K  +    +  + P+H A   G   +  +L+ +   ++   +  + P+H+A  +G+  +V++L++    I+A   DG   +H A   G+  + +LL++    +    +    P+H A +  H E V+ L+     ++         +H A+  GH   TK+L+ K+ +  A A N    +H+AC+K   ++++LLV+   + +A+T  G +PI +A       I+ LL Q
Sbjct:   46 ALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQ 431          

HSP 10 Score: 162.54 bits (410), Expect = 4.026e-40
Identity = 94/384 (24.48%), Postives = 182/384 (47.40%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNIL--------ITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   G+ D V   +    +  TC +     +HLA ++G+  +V+ L+ +    ++  +     +H A   G  EVVK+L+ +  N+ A  +N   PL++A ++ H D+V+ L++   N     ++   P+ +A  +GH + V  L       +   ++    +H A  K   +   +L        +  K  +    +    P+H+A   G+  +  +L+N    ++    +G   +H+A ++G  ++ +LL+D    I+   +    P+H A   GH ++V+LL++    + A  K    P+H A++  HVEC K L+  K  ++    +   A+H+A   GH  + KLL+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELL 396          

HSP 11 Score: 158.303 bits (399), Expect = 8.665e-39
Identity = 87/381 (22.83%), Postives = 177/381 (46.46%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            +H A    H + VK L+  K   +         +H+A   G+ ++ K+L++++ +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV LL+    + D  +      +H+A   G +++V+ L      ++A  +    P+H A   G+ EIV +L+      +A       P+H++  +G  ++  VL+            G+  +H+A + G  D+A+LL+      +   +    P+H A    + ++  LL++   +  A  K    P+H A++   ++    L+    +     +     +HLA ++GH ++V LL+    N    T  G + + LA +  K  + ++L +
Sbjct:  315 LHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTK 695          

HSP 12 Score: 141.739 bits (356), Expect = 1.295e-33
Identity = 68/252 (26.98%), Postives = 123/252 (48.81%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  D+ K+L+ ++   ++  +    P+H+A     +K+  +L+E+     A  +N   P+H A K+   ++   L+N         K    PLHLA ++GHTD+V LL+D+  NI  + ++    +HLA  +  + +   LT    + +A  ++ + P+  AC  G  ++VN L+ +  ++ A  K    P+H A  +GH  I+ VL+ H     A   +G  A+ +A   GY  +   L
Sbjct:  541 KGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          

HSP 13 Score: 97.0561 bits (240), Expect = 8.707e-20
Identity = 64/290 (22.07%), Postives = 127/290 (43.79%), Query Frame = 2
Query: 1148 QNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLI-------------------------------DANCNIEACDKWNR------RPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +SN     A   G+L  V        +I   NQ     +H A  +G   +V  L+ +   +++  KK    +H+A   G  E+V+VL+    +I A   +G+  +++A ++ + D+ + L++N  +     +    P+  A + GH + V +L+                               D N ++++    NR       P+H A+  G+V    +L+ +   ++  A+N    +H+A ++G+  +VKLL+      +A T  G +P+  A +S   +++ELL
Sbjct:    8 SDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL 297          

HSP 14 Score: 72.0182 bits (175), Expect = 4.568e-12
Identity = 40/151 (26.49%), Postives = 72/151 (47.68%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  D     +    DI  C+Q     +H A + GH  +VQ L+    ++++  K     +H AS AG  E  K+L+ +  +I A +QN    +++A ++ H ++VK L+    N    T  G +P+ +A +    + + +L +  TK
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTK 167          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 186.808 bits (473), Expect = 1.361e-47
Identity = 98/384 (25.52%), Postives = 190/384 (49.48%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ ++  +L+N+    +  A     P+H+A ++G   +VK+L+++    +A   +   P+H A + GH +VV+LL+ +   L A  KN   PLH+A +  H + V+ L+  K  +D    +    +H+A   GH ++ K L +++ N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH  IV +L+ +    +  +  G  A+H+A   G  ++ + L+ N   ++   +  + P+H A  +G TEIVQLL+    + +A       P+H ++  G V+   +L+          +     +H+A + G  ++ KLL++     ++    G +P+ +A K  + +I   L
Sbjct:  211 SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTL 594          

HSP 2 Score: 186.037 bits (471), Expect = 2.023e-47
Identity = 99/382 (25.92%), Postives = 185/382 (48.43%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L++++ N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH  +V LL+    + +  +   +  LH+A   G  ++VR L+     +DA  +    P+H+A   G  +IV+ L     + +AA    + P+H +  +GQ ++ ++L+          KK   P+H+A   G  ++ ++L+  +   ++   +G+  +H+A +K    IA  L++   +  +  +    P+H A + GHT++V LL+D   NI    K     +H A++   V    IL     D +A  +     + +AC  G+ ++V  L++   N  A T  G +P+  A +     II +L Q
Sbjct:  347 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 728          

HSP 3 Score: 179.104 bits (453), Expect = 3.575e-45
Identity = 107/420 (25.48%), Postives = 199/420 (47.38%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIE----------------QKCDTEA---------------------YDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  ++ A  E H D+VK L+    N  T  E    P+ +A ++G+ + V IL+E                +K DT++                       E+   P+H A   G+  V  LL+N+   ++   +N   PLH+A ++G+T++V+LL+D+   IDA  ++   P+H A   GH ++V+ L  +   + A  +    P+H A      E V  L+  K  ++      L  +H+A   GH  + ++L++ + +  A   +G+  +H+AC+K    + +LL+     I+   +    PIH A  MGH  IV LL+    + +  +      +H A+ AG VE  + L+     ++A A+ E+  +H+A   G  EIV+LL++   + +A T  G +P+ ++ +  + ++  +L
Sbjct:  109 GFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL 528          

HSP 4 Score: 172.94 bits (437), Expect = 2.942e-43
Identity = 94/368 (25.54%), Postives = 176/368 (47.83%), Query Frame = 2
Query:  809 KMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            KM++N+        E    P+H+A   G   +  +L+ +    +    N   P+H A KRG+  +VKLL+++   ++A  ++   PLH A   GH  +V LL+++   + A  +N   P+H+A    H++ VK L   K  ++         +H A   G   +  +L+ K+ +  A       P+H+AC K   +++E+L+ +   I+A  + G   IH+A   G+ +I  LL+ N    +V +   +  +H A   G  E+V+ L+     ++A  +  + P+H AS  G  E  ++L+      +A   N    +H++  +G  ++  +L+ A       T KG +P+ +A K    ++ +LL Q
Sbjct:  202 KMMVNR------TTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ 563          

HSP 5 Score: 171.4 bits (433), Expect = 1.016e-42
Identity = 98/414 (23.67%), Postives = 188/414 (45.41%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            +H A   G+ ++VK+L+++    +        P+H A   G++++V++L+E+     A  +N   P+H A +                                  GH  V KLL++++ N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GHL IV  L     + +  N      +H A   GQ E+V  L+     ++A  ++   P+H+A   G  EIV++L+ H    +A   +G+  +H++  +G  D+A +L++      +  +    P+H A + G  ++ +LL+      ++  K    P+H A++   ++    L+    +     +     +HLA ++GH ++V LL+    N    T  G + + LA +  K  + ++L +
Sbjct:  249 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTK 662          

HSP 6 Score: 169.859 bits (429), Expect = 2.700e-42
Identity = 88/384 (22.92%), Postives = 178/384 (46.35%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
             +  +H AC +    ++++L+    + +   E    PIH+A   G+  IV +L++     +  +      +H A + G  EVV+ L+     ++A  +  Q PLH+A   G T+IV+LL+    + DA   N   P+H++  +G + +   L         A +  + P+H A   G  ++  +L+ ++   ++  K    P+H+A  K   +I   L+N+  +       G   +HLA ++G+ D+  LL+D   +I +  +     +H A +     +  +L     + +A  K    P+  A   G+V+    L+ +  ++ A  +N    +H A ++GH  I+ +L++      A T  GN+ + +A++     +++ LK
Sbjct:  377 GFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 760          

HSP 7 Score: 162.925 bits (411), Expect = 3.886e-40
Identity = 94/390 (24.10%), Postives = 185/390 (47.44%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKAL--------TNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  EGH  +V+ L+ +  + ++  +K    +H+A   G  ++VK+L+++  +  A  +N   P++ A +  H +VVK L+    N     ++   PL +A ++GH   V +L++     D   +     +H+A  K   K    L           K  +    +  + P+H A   G   +  +L+ +   ++   +  + P+H+A  +G+  +V++L++    I+A   DG   +H A   G+  + +LL++    +    +    P+H A +  H E V+ L+     ++         +H A+  GH   TK+L+ K+ +  A A N    +H+AC+K   ++++LLV+   + +A+T  G +PI +A       I+ LL Q
Sbjct:   46 ALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQ 431          

HSP 8 Score: 161.384 bits (407), Expect = 1.212e-39
Identity = 94/384 (24.48%), Postives = 182/384 (47.40%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNIL--------ITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   G+ D V   +    +  TC +     +HLA ++G+  +V+ L+ +    ++  +     +H A   G  EVVK+L+ +  N+ A  +N   PL++A ++ H D+V+ L++   N     ++   P+ +A  +GH + V  L       +   ++    +H A  K   +   +L        +  K  +    +    P+H+A   G+  +  +L+N    ++    +G   +H+A ++G  ++ +LL+D    I+   +    P+H A   GH ++V+LL++    + A  K    P+H A++  HVEC K L+  K  ++    +   A+H+A   GH  + KLL+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELL 396          

HSP 9 Score: 106.686 bits (265), Expect = 1.245e-22
Identity = 53/219 (24.20%), Postives = 105/219 (47.95%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVL 1411
            K +  +H A   G  D+ K+L+ ++   ++  +    P+H+A +K   +I   L+    +T    +    P+H A + GH ++V LL+++  N+    K+    LHLA ++   ++  +L     + DA+ +    P+ +AC  G++K+V  L  Q  N+ A  +  + P+H A  +G   I+N+L+       A        + +A   G+  +V+ L
Sbjct:  541 KGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 759          

HSP 10 Score: 96.6709 bits (239), Expect = 1.372e-19
Identity = 64/289 (22.15%), Postives = 127/289 (43.94%), Query Frame = 2
Query: 1151 NSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLI-------------------------------DANCNIEACDKWNR------RPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +SN     A   G+L  V        +I   NQ     +H A  +G   +V  L+ +   +++  KK    +H+A   G  E+V+VL+    +I A   +G+  +++A ++ + D+ + L++N  +     +    P+  A + GH + V +L+                               D N ++++    NR       P+H A+  G+V    +L+ +   ++  A+N    +H+A ++G+  +VKLL+      +A T  G +P+  A +S   +++ELL
Sbjct:    9 DSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL 297          

HSP 11 Score: 71.633 bits (174), Expect = 6.927e-12
Identity = 40/151 (26.49%), Postives = 72/151 (47.68%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  D     +    DI  C+Q     +H A + GH  +VQ L+    ++++  K     +H AS AG  E  K+L+ +  +I A +QN    +++A ++ H ++VK L+    N    T  G +P+ +A +    + + +L +  TK
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTK 167          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 188.348 bits (477), Expect = 1.767e-48
Identity = 95/346 (27.46%), Postives = 172/346 (49.71%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            +H A      D+V++LI      +  A + Q P+H+A   G   IV +L++   ++ A   +N  P+H A K G +EV  +L++   +     K    PLHLA + G+ ++VRLL+++   +D   +N   P+H+A    + K+   L     + +AA +  + P+H A  K Q EI + L+  K D  A  +    P+HL+  +GHKEI  +LI +  D+ A  ++G  A+HL  ++ +  +AQ+L +N  +I         P+H AC  G   +V+ L++   ++    + +  P+H A++ GH  C + L+             +  + +A   G+  +V+ L
Sbjct:  462 LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 181.8 bits (460), Expect = 1.822e-46
Identity = 100/367 (27.25%), Postives = 175/367 (47.68%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +H A   GH  + K+L+++  +  + A     P+H+AC+K   K+V++L++ +   EA  E+   P+H A   G   +V  L+ Q  N +      + PLHLA     TD+VR+LI     +DA  +    P+H+A   G+  IV  L     N  A  + N+ P+H A  +GQ+E+  IL+    D     KK   P+HLA   G+ E+V +L+     ++    +    +H+A       +A LL++N    +   +    P+H A +    EI   L+    +  A  +    P+H +++ GH E + +L+    D+ A A N   A+HL  ++ H  + ++L        + T  G +P+ +A
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA 729          

HSP 3 Score: 177.178 bits (448), Expect = 5.968e-45
Identity = 96/386 (24.87%), Postives = 186/386 (48.19%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL--KQTP 1918
            A+H A  +       +L+  + N +  ++    P+H+A   G+E + ++L+E+  +      +N  P+H A K G   +  LL+++   +++  K+   PLH A   GH  +V LL+ Q   I A  +N   P+H+A    H+   + L   +  ++        P+H A   G   +  +L+ +  D  +       P+H+AC K   ++VE+L+ ++  IEA  + G   +H+A   G  +I   L+    + +V     + P+H A     T++V++LI     ++A  +  + P+H AS  G+ +   +L+    +  A  ++    +H+A ++G  E+  +L+  + +   LT KG +P+ LA K    E++ LL  + TP
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP 582          

HSP 4 Score: 173.326 bits (438), Expect = 8.445e-44
Identity = 100/419 (23.87%), Postives = 190/419 (45.35%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEK---------------------------------GHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
              +  +H A   GH ++ ++L+ +  N    A  N  P+H+A + G   +  +L+ +    ++  ++   P+H A + GH +VV LL+ Q   + A  KN   PLH+A +                                  GH  + +LL+D+  + ++   N   P+H+AC K  +K+V+ L   +  IEA  +    P+H A + G   IV  L+ +  + +    +   P+HLA      ++V VLI +   ++A   +    +H+A   G  DI  LL+    +     + +  P+H A + G  E+  +L+D N +     K    P+H AS+ G++E  ++L+ +   ++   +N+   +H+A    + ++  LL+    + +A    G +P+ +A K  + EI   L Q
Sbjct:  226 SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 5 Score: 173.326 bits (438), Expect = 8.519e-44
Identity = 100/411 (24.33%), Postives = 193/411 (46.96%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIV-----------------------------RLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            ++H A  EGH+++V+ LI ++   +    K    +H+A   G   IV IL+E   +      N   P++ A +  H+EVVK L+    N     ++   PL +A ++GH  +V                              LL+  + N D   ++   P+H+A   GH  + + L  +  N+    + N  P+H A   G+  + N+L+++   I++  K  L P+H A   GH ++V++L+     I A   +G   +H+A +  + D A+ L+ +   ++        P+H A   GH  + +LL+D  A+ N  A + +   P+H A +   ++  ++L+  +  IEA  ++    +H+A   G   IV  L++   N +  T++G +P+ LA ++ + +++ +L
Sbjct:   69 SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFT--PLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 6 Score: 172.94 bits (437), Expect = 1.136e-43
Identity = 93/349 (26.65%), Postives = 171/349 (49.00%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNC--DIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLV 1810
            +H A    H D  + L+  +   +        P+H+A   G+ ++ K+L+++  D  +   N   P+H ACK+   +VV+LL+  +  +EA  ++   PLH+A   G  +IV  L+ Q  N D        P+HLA       +V+ L      ++A  +    P+H A   G  +IV +L+    +  A  + N  P+H+A  +G +E+  +L++H  D       G+  +HLA + G  ++ +LL++     DIE  +Q++  P+H A    + ++  LL++   + +A  K    P+H A++   +E    L+  K D  A ++     +HL+ ++GH EI  LL+
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT--PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 7 Score: 172.94 bits (437), Expect = 1.353e-43
Identity = 96/379 (25.33%), Postives = 184/379 (48.55%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  +V +L+ Q        +    P+H+A +  +    + L+  +   +    +   P+H A   GH  V KLL+++  +  +   N   PLH+AC+K    +V LL+  +  I+A  ++   P+H+A   G + IV  L  Q  N +        P+H A    Q ++V +LI     ++A  ++   P+H+A   G+ +IV +L+    +  A   D +  +H+A ++G  ++A +L+D+N D  +  +    P+H A + G+ E+V+LL++    ++   K    P+H A+   + +   +L+      +A A+N    +H+A +K   EI   L++   +  A +  G +P+ L+ +   +EI  LL
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 8 Score: 143.28 bits (360), Expect = 2.547e-34
Identity = 83/376 (22.07%), Postives = 172/376 (45.74%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   G  + V  L+    +  T        +HLA ++G+ ++V+ LI+++   +A        +H A   G   +V +L+    N+     N   PL++A ++ H ++V+ L+    N   + ++   P+ +A  +GH ++V  L       ++  ++    +H A  K       +L+  + + +   K    P+H+A   GH+ + ++L+    ++          +H+A + G  ++A LL+     I+   +    P+H A   GH ++V LL+     I A  K    P+H A++  HV+  + L+  +  ++    +    +H+A   GH  + KLL+    +  +  L G +P+ +A K  + +++ELL
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 9 Score: 132.88 bits (333), Expect = 4.283e-31
Identity = 74/317 (23.34%), Postives = 140/317 (44.16%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKIL 1708
            N+  +H A  EG  ++  +L++   +     +K   P+HLA + G  ++V++L+E+    +   +N   P+H A    + +V  LL+    + +A  KN   PLH+A +K   +I   L+  K + +A  +    P+HL+  +GH                                 KEI  +LI    D+ A     L  +HL   + H  + ++L N+  +I +  + G+  +H+AC  G  ++ + L++N  D+    + S  P+H A + GH   V+ L++   +        + P+  A   G+V   + L
Sbjct:  524 NYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH---------------------------------KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 10 Score: 121.324 bits (303), Expect = 1.235e-27
Identity = 62/256 (24.22%), Postives = 116/256 (45.31%), Query Frame = 2
Query:  743 LII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            L+  K +  +H A   G+ ++V++L+ +    +   +    P+H+A     +K+  +L+E     +A  +N   P+H A K+   E+   L+  K +  A  +    PLHL+ ++GH +I  LLI+   ++ A   N    +HL   + H+ + + L N    I +     + P+H AC  GQ  +V  L+    D+    + +  P+H A  +GH   V  L+ +          G   + +A   GY  + + L
Sbjct:  552 LLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 11 Score: 57.3806 bits (137), Expect = 4.961e-8
Identity = 33/139 (23.74%), Postives = 65/139 (46.76%), Query Frame = 2
Query: 1508 LIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            L+    DI   +      +H A + GH+E+V+ LI     ++A  +     +H AS AG      IL+    ++   + N    +++A ++ H E+VK L++   N    T  G +P+ +A +     ++ +L +  +K
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK 190          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 188.348 bits (477), Expect = 1.767e-48
Identity = 95/346 (27.46%), Postives = 172/346 (49.71%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            +H A      D+V++LI      +  A + Q P+H+A   G   IV +L++   ++ A   +N  P+H A K G +EV  +L++   +     K    PLHLA + G+ ++VRLL+++   +D   +N   P+H+A    + K+   L     + +AA +  + P+H A  K Q EI + L+  K D  A  +    P+HL+  +GHKEI  +LI +  D+ A  ++G  A+HL  ++ +  +AQ+L +N  +I         P+H AC  G   +V+ L++   ++    + +  P+H A++ GH  C + L+             +  + +A   G+  +V+ L
Sbjct:  462 LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 181.8 bits (460), Expect = 1.822e-46
Identity = 100/367 (27.25%), Postives = 175/367 (47.68%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +H A   GH  + K+L+++  +  + A     P+H+AC+K   K+V++L++ +   EA  E+   P+H A   G   +V  L+ Q  N +      + PLHLA     TD+VR+LI     +DA  +    P+H+A   G+  IV  L     N  A  + N+ P+H A  +GQ+E+  IL+    D     KK   P+HLA   G+ E+V +L+     ++    +    +H+A       +A LL++N    +   +    P+H A +    EI   L+    +  A  +    P+H +++ GH E + +L+    D+ A A N   A+HL  ++ H  + ++L        + T  G +P+ +A
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA 729          

HSP 3 Score: 177.178 bits (448), Expect = 5.968e-45
Identity = 96/386 (24.87%), Postives = 186/386 (48.19%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL--KQTP 1918
            A+H A  +       +L+  + N +  ++    P+H+A   G+E + ++L+E+  +      +N  P+H A K G   +  LL+++   +++  K+   PLH A   GH  +V LL+ Q   I A  +N   P+H+A    H+   + L   +  ++        P+H A   G   +  +L+ +  D  +       P+H+AC K   ++VE+L+ ++  IEA  + G   +H+A   G  +I   L+    + +V     + P+H A     T++V++LI     ++A  +  + P+H AS  G+ +   +L+    +  A  ++    +H+A ++G  E+  +L+  + +   LT KG +P+ LA K    E++ LL  + TP
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP 582          

HSP 4 Score: 173.326 bits (438), Expect = 8.445e-44
Identity = 100/419 (23.87%), Postives = 190/419 (45.35%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEK---------------------------------GHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
              +  +H A   GH ++ ++L+ +  N    A  N  P+H+A + G   +  +L+ +    ++  ++   P+H A + GH +VV LL+ Q   + A  KN   PLH+A +                                  GH  + +LL+D+  + ++   N   P+H+AC K  +K+V+ L   +  IEA  +    P+H A + G   IV  L+ +  + +    +   P+HLA      ++V VLI +   ++A   +    +H+A   G  DI  LL+    +     + +  P+H A + G  E+  +L+D N +     K    P+H AS+ G++E  ++L+ +   ++   +N+   +H+A    + ++  LL+    + +A    G +P+ +A K  + EI   L Q
Sbjct:  226 SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 5 Score: 173.326 bits (438), Expect = 8.519e-44
Identity = 100/411 (24.33%), Postives = 193/411 (46.96%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIV-----------------------------RLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            ++H A  EGH+++V+ LI ++   +    K    +H+A   G   IV IL+E   +      N   P++ A +  H+EVVK L+    N     ++   PL +A ++GH  +V                              LL+  + N D   ++   P+H+A   GH  + + L  +  N+    + N  P+H A   G+  + N+L+++   I++  K  L P+H A   GH ++V++L+     I A   +G   +H+A +  + D A+ L+ +   ++        P+H A   GH  + +LL+D  A+ N  A + +   P+H A +   ++  ++L+  +  IEA  ++    +H+A   G   IV  L++   N +  T++G +P+ LA ++ + +++ +L
Sbjct:   69 SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFT--PLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 6 Score: 172.94 bits (437), Expect = 1.136e-43
Identity = 93/349 (26.65%), Postives = 171/349 (49.00%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNC--DIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLV 1810
            +H A    H D  + L+  +   +        P+H+A   G+ ++ K+L+++  D  +   N   P+H ACK+   +VV+LL+  +  +EA  ++   PLH+A   G  +IV  L+ Q  N D        P+HLA       +V+ L      ++A  +    P+H A   G  +IV +L+    +  A  + N  P+H+A  +G +E+  +L++H  D       G+  +HLA + G  ++ +LL++     DIE  +Q++  P+H A    + ++  LL++   + +A  K    P+H A++   +E    L+  K D  A ++     +HL+ ++GH EI  LL+
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT--PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 7 Score: 172.94 bits (437), Expect = 1.353e-43
Identity = 96/379 (25.33%), Postives = 184/379 (48.55%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  +V +L+ Q        +    P+H+A +  +    + L+  +   +    +   P+H A   GH  V KLL+++  +  +   N   PLH+AC+K    +V LL+  +  I+A  ++   P+H+A   G + IV  L  Q  N +        P+H A    Q ++V +LI     ++A  ++   P+H+A   G+ +IV +L+    +  A   D +  +H+A ++G  ++A +L+D+N D  +  +    P+H A + G+ E+V+LL++    ++   K    P+H A+   + +   +L+      +A A+N    +H+A +K   EI   L++   +  A +  G +P+ L+ +   +EI  LL
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 8 Score: 143.28 bits (360), Expect = 2.547e-34
Identity = 83/376 (22.07%), Postives = 172/376 (45.74%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   G  + V  L+    +  T        +HLA ++G+ ++V+ LI+++   +A        +H A   G   +V +L+    N+     N   PL++A ++ H ++V+ L+    N   + ++   P+ +A  +GH ++V  L       ++  ++    +H A  K       +L+  + + +   K    P+H+A   GH+ + ++L+    ++          +H+A + G  ++A LL+     I+   +    P+H A   GH ++V LL+     I A  K    P+H A++  HV+  + L+  +  ++    +    +H+A   GH  + KLL+    +  +  L G +P+ +A K  + +++ELL
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 9 Score: 132.88 bits (333), Expect = 4.283e-31
Identity = 74/317 (23.34%), Postives = 140/317 (44.16%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKIL 1708
            N+  +H A  EG  ++  +L++   +     +K   P+HLA + G  ++V++L+E+    +   +N   P+H A    + +V  LL+    + +A  KN   PLH+A +K   +I   L+  K + +A  +    P+HL+  +GH                                 KEI  +LI    D+ A     L  +HL   + H  + ++L N+  +I +  + G+  +H+AC  G  ++ + L++N  D+    + S  P+H A + GH   V+ L++   +        + P+  A   G+V   + L
Sbjct:  524 NYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH---------------------------------KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 10 Score: 121.324 bits (303), Expect = 1.235e-27
Identity = 62/256 (24.22%), Postives = 116/256 (45.31%), Query Frame = 2
Query:  743 LII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            L+  K +  +H A   G+ ++V++L+ +    +   +    P+H+A     +K+  +L+E     +A  +N   P+H A K+   E+   L+  K +  A  +    PLHL+ ++GH +I  LLI+   ++ A   N    +HL   + H+ + + L N    I +     + P+H AC  GQ  +V  L+    D+    + +  P+H A  +GH   V  L+ +          G   + +A   GY  + + L
Sbjct:  552 LLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 11 Score: 57.3806 bits (137), Expect = 4.961e-8
Identity = 33/139 (23.74%), Postives = 65/139 (46.76%), Query Frame = 2
Query: 1508 LIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            L+    DI   +      +H A + GH+E+V+ LI     ++A  +     +H AS AG      IL+    ++   + N    +++A ++ H E+VK L++   N    T  G +P+ +A +     ++ +L +  +K
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK 190          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 187.963 bits (476), Expect = 1.946e-48
Identity = 95/346 (27.46%), Postives = 172/346 (49.71%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            +H A      D+V++LI      +  A + Q P+H+A   G   IV +L++   ++ A   +N  P+H A K G +EV  +L++   +     K    PLHLA + G+ ++VRLL+++   +D   +N   P+H+A    + K+   L     + +AA +  + P+H A  K Q EI + L+  K D  A  +    P+HL+  +GHKEI  +LI +  D+ A  ++G  A+HL  ++ +  +AQ+L +N  +I         P+H AC  G   +V+ L++   ++    + +  P+H A++ GH  C + L+             +  + +A   G+  +V+ L
Sbjct:  462 LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 181.8 bits (460), Expect = 2.097e-46
Identity = 100/367 (27.25%), Postives = 175/367 (47.68%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +H A   GH  + K+L+++  +  + A     P+H+AC+K   K+V++L++ +   EA  E+   P+H A   G   +V  L+ Q  N +      + PLHLA     TD+VR+LI     +DA  +    P+H+A   G+  IV  L     N  A  + N+ P+H A  +GQ+E+  IL+    D     KK   P+HLA   G+ E+V +L+     ++    +    +H+A       +A LL++N    +   +    P+H A +    EI   L+    +  A  +    P+H +++ GH E + +L+    D+ A A N   A+HL  ++ H  + ++L        + T  G +P+ +A
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA 729          

HSP 3 Score: 176.792 bits (447), Expect = 6.516e-45
Identity = 96/386 (24.87%), Postives = 186/386 (48.19%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL--KQTP 1918
            A+H A  +       +L+  + N +  ++    P+H+A   G+E + ++L+E+  +      +N  P+H A K G   +  LL+++   +++  K+   PLH A   GH  +V LL+ Q   I A  +N   P+H+A    H+   + L   +  ++        P+H A   G   +  +L+ +  D  +       P+H+AC K   ++VE+L+ ++  IEA  + G   +H+A   G  +I   L+    + +V     + P+H A     T++V++LI     ++A  +  + P+H AS  G+ +   +L+    +  A  ++    +H+A ++G  E+  +L+  + +   LT KG +P+ LA K    E++ LL  + TP
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP 582          

HSP 4 Score: 173.326 bits (438), Expect = 8.981e-44
Identity = 100/419 (23.87%), Postives = 190/419 (45.35%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEK---------------------------------GHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
              +  +H A   GH ++ ++L+ +  N    A  N  P+H+A + G   +  +L+ +    ++  ++   P+H A + GH +VV LL+ Q   + A  KN   PLH+A +                                  GH  + +LL+D+  + ++   N   P+H+AC K  +K+V+ L   +  IEA  +    P+H A + G   IV  L+ +  + +    +   P+HLA      ++V VLI +   ++A   +    +H+A   G  DI  LL+    +     + +  P+H A + G  E+  +L+D N +     K    P+H AS+ G++E  ++L+ +   ++   +N+   +H+A    + ++  LL+    + +A    G +P+ +A K  + EI   L Q
Sbjct:  226 SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 5 Score: 173.326 bits (438), Expect = 9.465e-44
Identity = 99/411 (24.09%), Postives = 193/411 (46.96%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC-----------------------------NIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            ++H A  EGH+++V+ LI ++   +    K    +H+A   G   IV IL+E   +      N   P++ A +  H+EVVK L+    N     ++   PL +A ++GH  +V +L++                                N D   ++   P+H+A   GH  + + L  +  N+    + N  P+H A   G+  + N+L+++   I++  K  L P+H A   GH ++V++L+     I A   +G   +H+A +  + D A+ L+ +   ++        P+H A   GH  + +LL+D  A+ N  A + +   P+H A +   ++  ++L+  +  IEA  ++    +H+A   G   IV  L++   N +  T++G +P+ LA ++ + +++ +L
Sbjct:   69 SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFT--PLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 6 Score: 172.94 bits (437), Expect = 1.354e-43
Identity = 96/379 (25.33%), Postives = 184/379 (48.55%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  +V +L+ Q        +    P+H+A +  +    + L+  +   +    +   P+H A   GH  V KLL+++  +  +   N   PLH+AC+K    +V LL+  +  I+A  ++   P+H+A   G + IV  L  Q  N +        P+H A    Q ++V +LI     ++A  ++   P+H+A   G+ +IV +L+    +  A   D +  +H+A ++G  ++A +L+D+N D  +  +    P+H A + G+ E+V+LL++    ++   K    P+H A+   + +   +L+      +A A+N    +H+A +K   EI   L++   +  A +  G +P+ L+ +   +EI  LL
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 7 Score: 172.94 bits (437), Expect = 1.354e-43
Identity = 93/349 (26.65%), Postives = 171/349 (49.00%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNC--DIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLV 1810
            +H A    H D  + L+  +   +        P+H+A   G+ ++ K+L+++  D  +   N   P+H ACK+   +VV+LL+  +  +EA  ++   PLH+A   G  +IV  L+ Q  N D        P+HLA       +V+ L      ++A  +    P+H A   G  +IV +L+    +  A  + N  P+H+A  +G +E+  +L++H  D       G+  +HLA + G  ++ +LL++     DIE  +Q++  P+H A    + ++  LL++   + +A  K    P+H A++   +E    L+  K D  A ++     +HL+ ++GH EI  LL+
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT--PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 8 Score: 142.895 bits (359), Expect = 2.734e-34
Identity = 83/376 (22.07%), Postives = 172/376 (45.74%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   G  + V  L+    +  T        +HLA ++G+ ++V+ LI+++   +A        +H A   G   +V +L+    N+     N   PL++A ++ H ++V+ L+    N   + ++   P+ +A  +GH ++V  L       ++  ++    +H A  K       +L+  + + +   K    P+H+A   GH+ + ++L+    ++          +H+A + G  ++A LL+     I+   +    P+H A   GH ++V LL+     I A  K    P+H A++  HV+  + L+  +  ++    +    +H+A   GH  + KLL+    +  +  L G +P+ +A K  + +++ELL
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 9 Score: 132.494 bits (332), Expect = 4.718e-31
Identity = 74/317 (23.34%), Postives = 140/317 (44.16%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKIL 1708
            N+  +H A  EG  ++  +L++   +     +K   P+HLA + G  ++V++L+E+    +   +N   P+H A    + +V  LL+    + +A  KN   PLH+A +K   +I   L+  K + +A  +    P+HL+  +GH                                 KEI  +LI    D+ A     L  +HL   + H  + ++L N+  +I +  + G+  +H+AC  G  ++ + L++N  D+    + S  P+H A + GH   V+ L++   +        + P+  A   G+V   + L
Sbjct:  524 NYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH---------------------------------KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 10 Score: 121.324 bits (303), Expect = 1.432e-27
Identity = 62/256 (24.22%), Postives = 116/256 (45.31%), Query Frame = 2
Query:  743 LII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            L+  K +  +H A   G+ ++V++L+ +    +   +    P+H+A     +K+  +L+E     +A  +N   P+H A K+   E+   L+  K +  A  +    PLHL+ ++GH +I  LLI+   ++ A   N    +HL   + H+ + + L N    I +     + P+H AC  GQ  +V  L+    D+    + +  P+H A  +GH   V  L+ +          G   + +A   GY  + + L
Sbjct:  552 LLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 11 Score: 57.3806 bits (137), Expect = 5.078e-8
Identity = 33/139 (23.74%), Postives = 65/139 (46.76%), Query Frame = 2
Query: 1508 LIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            L+    DI   +      +H A + GH+E+V+ LI     ++A  +     +H AS AG      IL+    ++   + N    +++A ++ H E+VK L++   N    T  G +P+ +A +     ++ +L +  +K
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK 190          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 187.963 bits (476), Expect = 1.946e-48
Identity = 95/346 (27.46%), Postives = 172/346 (49.71%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            +H A      D+V++LI      +  A + Q P+H+A   G   IV +L++   ++ A   +N  P+H A K G +EV  +L++   +     K    PLHLA + G+ ++VRLL+++   +D   +N   P+H+A    + K+   L     + +AA +  + P+H A  K Q EI + L+  K D  A  +    P+HL+  +GHKEI  +LI +  D+ A  ++G  A+HL  ++ +  +AQ+L +N  +I         P+H AC  G   +V+ L++   ++    + +  P+H A++ GH  C + L+             +  + +A   G+  +V+ L
Sbjct:  462 LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 181.8 bits (460), Expect = 2.097e-46
Identity = 100/367 (27.25%), Postives = 175/367 (47.68%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +H A   GH  + K+L+++  +  + A     P+H+AC+K   K+V++L++ +   EA  E+   P+H A   G   +V  L+ Q  N +      + PLHLA     TD+VR+LI     +DA  +    P+H+A   G+  IV  L     N  A  + N+ P+H A  +GQ+E+  IL+    D     KK   P+HLA   G+ E+V +L+     ++    +    +H+A       +A LL++N    +   +    P+H A +    EI   L+    +  A  +    P+H +++ GH E + +L+    D+ A A N   A+HL  ++ H  + ++L        + T  G +P+ +A
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA 729          

HSP 3 Score: 176.792 bits (447), Expect = 6.516e-45
Identity = 96/386 (24.87%), Postives = 186/386 (48.19%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL--KQTP 1918
            A+H A  +       +L+  + N +  ++    P+H+A   G+E + ++L+E+  +      +N  P+H A K G   +  LL+++   +++  K+   PLH A   GH  +V LL+ Q   I A  +N   P+H+A    H+   + L   +  ++        P+H A   G   +  +L+ +  D  +       P+H+AC K   ++VE+L+ ++  IEA  + G   +H+A   G  +I   L+    + +V     + P+H A     T++V++LI     ++A  +  + P+H AS  G+ +   +L+    +  A  ++    +H+A ++G  E+  +L+  + +   LT KG +P+ LA K    E++ LL  + TP
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP 582          

HSP 4 Score: 173.326 bits (438), Expect = 8.981e-44
Identity = 100/419 (23.87%), Postives = 190/419 (45.35%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEK---------------------------------GHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
              +  +H A   GH ++ ++L+ +  N    A  N  P+H+A + G   +  +L+ +    ++  ++   P+H A + GH +VV LL+ Q   + A  KN   PLH+A +                                  GH  + +LL+D+  + ++   N   P+H+AC K  +K+V+ L   +  IEA  +    P+H A + G   IV  L+ +  + +    +   P+HLA      ++V VLI +   ++A   +    +H+A   G  DI  LL+    +     + +  P+H A + G  E+  +L+D N +     K    P+H AS+ G++E  ++L+ +   ++   +N+   +H+A    + ++  LL+    + +A    G +P+ +A K  + EI   L Q
Sbjct:  226 SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 5 Score: 173.326 bits (438), Expect = 9.465e-44
Identity = 99/411 (24.09%), Postives = 193/411 (46.96%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC-----------------------------NIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            ++H A  EGH+++V+ LI ++   +    K    +H+A   G   IV IL+E   +      N   P++ A +  H+EVVK L+    N     ++   PL +A ++GH  +V +L++                                N D   ++   P+H+A   GH  + + L  +  N+    + N  P+H A   G+  + N+L+++   I++  K  L P+H A   GH ++V++L+     I A   +G   +H+A +  + D A+ L+ +   ++        P+H A   GH  + +LL+D  A+ N  A + +   P+H A +   ++  ++L+  +  IEA  ++    +H+A   G   IV  L++   N +  T++G +P+ LA ++ + +++ +L
Sbjct:   69 SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFT--PLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 6 Score: 172.94 bits (437), Expect = 1.354e-43
Identity = 96/379 (25.33%), Postives = 184/379 (48.55%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  +V +L+ Q        +    P+H+A +  +    + L+  +   +    +   P+H A   GH  V KLL+++  +  +   N   PLH+AC+K    +V LL+  +  I+A  ++   P+H+A   G + IV  L  Q  N +        P+H A    Q ++V +LI     ++A  ++   P+H+A   G+ +IV +L+    +  A   D +  +H+A ++G  ++A +L+D+N D  +  +    P+H A + G+ E+V+LL++    ++   K    P+H A+   + +   +L+      +A A+N    +H+A +K   EI   L++   +  A +  G +P+ L+ +   +EI  LL
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 7 Score: 172.94 bits (437), Expect = 1.354e-43
Identity = 93/349 (26.65%), Postives = 171/349 (49.00%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNC--DIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLV 1810
            +H A    H D  + L+  +   +        P+H+A   G+ ++ K+L+++  D  +   N   P+H ACK+   +VV+LL+  +  +EA  ++   PLH+A   G  +IV  L+ Q  N D        P+HLA       +V+ L      ++A  +    P+H A   G  +IV +L+    +  A  + N  P+H+A  +G +E+  +L++H  D       G+  +HLA + G  ++ +LL++     DIE  +Q++  P+H A    + ++  LL++   + +A  K    P+H A++   +E    L+  K D  A ++     +HL+ ++GH EI  LL+
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT--PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 8 Score: 142.895 bits (359), Expect = 2.734e-34
Identity = 83/376 (22.07%), Postives = 172/376 (45.74%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   G  + V  L+    +  T        +HLA ++G+ ++V+ LI+++   +A        +H A   G   +V +L+    N+     N   PL++A ++ H ++V+ L+    N   + ++   P+ +A  +GH ++V  L       ++  ++    +H A  K       +L+  + + +   K    P+H+A   GH+ + ++L+    ++          +H+A + G  ++A LL+     I+   +    P+H A   GH ++V LL+     I A  K    P+H A++  HV+  + L+  +  ++    +    +H+A   GH  + KLL+    +  +  L G +P+ +A K  + +++ELL
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 9 Score: 132.494 bits (332), Expect = 4.718e-31
Identity = 74/317 (23.34%), Postives = 140/317 (44.16%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKIL 1708
            N+  +H A  EG  ++  +L++   +     +K   P+HLA + G  ++V++L+E+    +   +N   P+H A    + +V  LL+    + +A  KN   PLH+A +K   +I   L+  K + +A  +    P+HL+  +GH                                 KEI  +LI    D+ A     L  +HL   + H  + ++L N+  +I +  + G+  +H+AC  G  ++ + L++N  D+    + S  P+H A + GH   V+ L++   +        + P+  A   G+V   + L
Sbjct:  524 NYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH---------------------------------KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 10 Score: 121.324 bits (303), Expect = 1.432e-27
Identity = 62/256 (24.22%), Postives = 116/256 (45.31%), Query Frame = 2
Query:  743 LII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            L+  K +  +H A   G+ ++V++L+ +    +   +    P+H+A     +K+  +L+E     +A  +N   P+H A K+   E+   L+  K +  A  +    PLHL+ ++GH +I  LLI+   ++ A   N    +HL   + H+ + + L N    I +     + P+H AC  GQ  +V  L+    D+    + +  P+H A  +GH   V  L+ +          G   + +A   GY  + + L
Sbjct:  552 LLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 11 Score: 57.3806 bits (137), Expect = 5.078e-8
Identity = 33/139 (23.74%), Postives = 65/139 (46.76%), Query Frame = 2
Query: 1508 LIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            L+    DI   +      +H A + GH+E+V+ LI     ++A  +     +H AS AG      IL+    ++   + N    +++A ++ H E+VK L++   N    T  G +P+ +A +     ++ +L +  +K
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK 190          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 187.963 bits (476), Expect = 2.240e-48
Identity = 95/346 (27.46%), Postives = 172/346 (49.71%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            +H A      D+V++LI      +  A + Q P+H+A   G   IV +L++   ++ A   +N  P+H A K G +EV  +L++   +     K    PLHLA + G+ ++VRLL+++   +D   +N   P+H+A    + K+   L     + +AA +  + P+H A  K Q EI + L+  K D  A  +    P+HL+  +GHKEI  +LI +  D+ A  ++G  A+HL  ++ +  +AQ+L +N  +I         P+H AC  G   +V+ L++   ++    + +  P+H A++ GH  C + L+             +  + +A   G+  +V+ L
Sbjct:  462 LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 181.415 bits (459), Expect = 2.209e-46
Identity = 100/367 (27.25%), Postives = 175/367 (47.68%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +H A   GH  + K+L+++  +  + A     P+H+AC+K   K+V++L++ +   EA  E+   P+H A   G   +V  L+ Q  N +      + PLHLA     TD+VR+LI     +DA  +    P+H+A   G+  IV  L     N  A  + N+ P+H A  +GQ+E+  IL+    D     KK   P+HLA   G+ E+V +L+     ++    +    +H+A       +A LL++N    +   +    P+H A +    EI   L+    +  A  +    P+H +++ GH E + +L+    D+ A A N   A+HL  ++ H  + ++L        + T  G +P+ +A
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA 729          

HSP 3 Score: 177.178 bits (448), Expect = 5.917e-45
Identity = 96/386 (24.87%), Postives = 186/386 (48.19%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL--KQTP 1918
            A+H A  +       +L+  + N +  ++    P+H+A   G+E + ++L+E+  +      +N  P+H A K G   +  LL+++   +++  K+   PLH A   GH  +V LL+ Q   I A  +N   P+H+A    H+   + L   +  ++        P+H A   G   +  +L+ +  D  +       P+H+AC K   ++VE+L+ ++  IEA  + G   +H+A   G  +I   L+    + +V     + P+H A     T++V++LI     ++A  +  + P+H AS  G+ +   +L+    +  A  ++    +H+A ++G  E+  +L+  + +   LT KG +P+ LA K    E++ LL  + TP
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP 582          

HSP 4 Score: 173.711 bits (439), Expect = 6.851e-44
Identity = 96/382 (25.13%), Postives = 176/382 (46.07%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ--KCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H A F G  +IV  L+ Q  N +    + + P+HLA       +V++LI      +A       P+H A + G+ ++V LL+    N  A  ++N  PLH+A ++G  ++  +L+D   +     +    P+HLA   G+L++V+ L  +    +IE  NQ+   P+H A      ++  +L+      +A  K    P+H+A  K   EI   L+  K D  A    G+  +HL+ ++G+ +I+ LLI+N  D+          +H   +  H  + Q+L +    I +       P+H A   G +   K L+    D+    +     +H A ++GH   V+ L+    +    T  G +P+ +A++     ++E L+
Sbjct:  429 LHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT--PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 5 Score: 173.326 bits (438), Expect = 8.904e-44
Identity = 100/411 (24.33%), Postives = 193/411 (46.96%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIV-----------------------------RLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            ++H A  EGH+++V+ LI ++   +    K    +H+A   G   IV IL+E   +      N   P++ A +  H+EVVK L+    N     ++   PL +A ++GH  +V                              LL+  + N D   ++   P+H+A   GH  + + L  +  N+    + N  P+H A   G+  + N+L+++   I++  K  L P+H A   GH ++V++L+     I A   +G   +H+A +  + D A+ L+ +   ++        P+H A   GH  + +LL+D  A+ N  A + +   P+H A +   ++  ++L+  +  IEA  ++    +H+A   G   IV  L++   N +  T++G +P+ LA ++ + +++ +L
Sbjct:   69 SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFT--PLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 6 Score: 173.326 bits (438), Expect = 9.221e-44
Identity = 100/419 (23.87%), Postives = 190/419 (45.35%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEK---------------------------------GHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
              +  +H A   GH ++ ++L+ +  N    A  N  P+H+A + G   +  +L+ +    ++  ++   P+H A + GH +VV LL+ Q   + A  KN   PLH+A +                                  GH  + +LL+D+  + ++   N   P+H+AC K  +K+V+ L   +  IEA  +    P+H A + G   IV  L+ +  + +    +   P+HLA      ++V VLI +   ++A   +    +H+A   G  DI  LL+    +     + +  P+H A + G  E+  +L+D N +     K    P+H AS+ G++E  ++L+ +   ++   +N+   +H+A    + ++  LL+    + +A    G +P+ +A K  + EI   L Q
Sbjct:  226 SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 7 Score: 172.94 bits (437), Expect = 1.331e-43
Identity = 96/379 (25.33%), Postives = 184/379 (48.55%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  +V +L+ Q        +    P+H+A +  +    + L+  +   +    +   P+H A   GH  V KLL+++  +  +   N   PLH+AC+K    +V LL+  +  I+A  ++   P+H+A   G + IV  L  Q  N +        P+H A    Q ++V +LI     ++A  ++   P+H+A   G+ +IV +L+    +  A   D +  +H+A ++G  ++A +L+D+N D  +  +    P+H A + G+ E+V+LL++    ++   K    P+H A+   + +   +L+      +A A+N    +H+A +K   EI   L++   +  A +  G +P+ L+ +   +EI  LL
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 8 Score: 172.94 bits (437), Expect = 1.331e-43
Identity = 93/349 (26.65%), Postives = 171/349 (49.00%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNC--DIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLV 1810
            +H A    H D  + L+  +   +        P+H+A   G+ ++ K+L+++  D  +   N   P+H ACK+   +VV+LL+  +  +EA  ++   PLH+A   G  +IV  L+ Q  N D        P+HLA       +V+ L      ++A  +    P+H A   G  +IV +L+    +  A  + N  P+H+A  +G +E+  +L++H  D       G+  +HLA + G  ++ +LL++     DIE  +Q++  P+H A    + ++  LL++   + +A  K    P+H A++   +E    L+  K D  A ++     +HL+ ++GH EI  LL+
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT--PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 9 Score: 142.895 bits (359), Expect = 2.601e-34
Identity = 83/376 (22.07%), Postives = 172/376 (45.74%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   G  + V  L+    +  T        +HLA ++G+ ++V+ LI+++   +A        +H A   G   +V +L+    N+     N   PL++A ++ H ++V+ L+    N   + ++   P+ +A  +GH ++V  L       ++  ++    +H A  K       +L+  + + +   K    P+H+A   GH+ + ++L+    ++          +H+A + G  ++A LL+     I+   +    P+H A   GH ++V LL+     I A  K    P+H A++  HV+  + L+  +  ++    +    +H+A   GH  + KLL+    +  +  L G +P+ +A K  + +++ELL
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 10 Score: 132.494 bits (332), Expect = 5.565e-31
Identity = 74/317 (23.34%), Postives = 140/317 (44.16%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKIL 1708
            N+  +H A  EG  ++  +L++   +     +K   P+HLA + G  ++V++L+E+    +   +N   P+H A    + +V  LL+    + +A  KN   PLH+A +K   +I   L+  K + +A  +    P+HL+  +GH                                 KEI  +LI    D+ A     L  +HL   + H  + ++L N+  +I +  + G+  +H+AC  G  ++ + L++N  D+    + S  P+H A + GH   V+ L++   +        + P+  A   G+V   + L
Sbjct:  524 NYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH---------------------------------KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 11 Score: 121.324 bits (303), Expect = 1.461e-27
Identity = 62/256 (24.22%), Postives = 116/256 (45.31%), Query Frame = 2
Query:  743 LII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            L+  K +  +H A   G+ ++V++L+ +    +   +    P+H+A     +K+  +L+E     +A  +N   P+H A K+   E+   L+  K +  A  +    PLHL+ ++GH +I  LLI+   ++ A   N    +HL   + H+ + + L N    I +     + P+H AC  GQ  +V  L+    D+    + +  P+H A  +GH   V  L+ +          G   + +A   GY  + + L
Sbjct:  552 LLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 12 Score: 57.3806 bits (137), Expect = 5.287e-8
Identity = 33/139 (23.74%), Postives = 65/139 (46.76%), Query Frame = 2
Query: 1508 LIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            L+    DI   +      +H A + GH+E+V+ LI     ++A  +     +H AS AG      IL+    ++   + N    +++A ++ H E+VK L++   N    T  G +P+ +A +     ++ +L +  +K
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK 190          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 186.422 bits (472), Expect = 4.661e-48
Identity = 100/417 (23.98%), Postives = 193/417 (46.28%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEK---------------------------------GHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ +I  +LI +  +    A+ N  P+H+A + G   +V +L+E+  + EA   +   P+H A + GH++VV +L+ +   + A  KN   PLH+A +                                  GH  + +LL+D+  + +A   N   P+H+AC K  LK+V+ L     +I A  +    P+H A + G   IV  L+      + P  +   P+HLA      +I+ +L+ +   ++A   +    +H+A   G  DI  LL+ +   ++   +     +H A + G  E+  +LI+    ++A  K    P+H  ++ GH++  ++L+ K+ D++A  +N    +H+AC   + ++  LL+    +  A    G++P+ +A +  + +I   L
Sbjct:  204 SGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTL 620          

HSP 2 Score: 182.185 bits (461), Expect = 1.071e-46
Identity = 96/382 (25.13%), Postives = 179/382 (46.86%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L+++  +    A     P+H+AC+K   K+V++L+       A  E+   P+H A   G   +V  L+    + +      + PLHLA     TDI+R+L+     +DA  +    P+H+A   G++ IV  L      ++A  +  +  +H A  +GQ E+  +LI     ++A  KK   P+HL    GH ++ ++L+  + D++A   +G   +H+AC      +A LL++         +    P+H A      +I   L++      A  K    P+H +S+ GH E + +L+  K  +   A+N    +HL  ++ +  + ++L +   N +  T  G +P+ +A    +  ++  L Q
Sbjct:  340 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQ 721          

HSP 3 Score: 182.185 bits (461), Expect = 1.312e-46
Identity = 96/382 (25.13%), Postives = 184/382 (48.17%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L++   N +  ++    P+H+A   G + I  +LI++  D     ++N  P+H A K G   +V LL+ +  N+EA  ++   PLH A   GH  +V +L+++   I A  +N   P+H+A    H+   + L   +  ++         +H A   G   +  +L+ +  D  A       P+H+AC K   ++VE+L+ H   I A  + G   +H+A   G  +I   L+ ++   +V     + P+H A     T+I+++L+     ++A  +  + P+H AS  G+V+   +L+     ++A  ++   A+H+A ++G  E+  +L+      +A T KG +P+ L  K    ++ +LL Q
Sbjct:  175 ALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQ 556          

HSP 4 Score: 177.948 bits (450), Expect = 2.296e-45
Identity = 93/380 (24.47%), Postives = 180/380 (47.37%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H A F G  +IV  L+    + +    + + P+HLA       I++IL+      +A       P+H A + G+ ++V LL+     ++A  K+    LH+A ++G  ++  +LI+    +DA  +    P+HL    GH+K+ + L  ++ +++A  +    P+H AC    +++  +L+ K     A  K    P+H+A  K   +I   L+ +     A    G+  +HL+ ++G+A+I+ LLI++   +    +    P+H   +  +  + ++L     NI+   K    P+H AS  G     + L+    +++A        +H   ++GH  IV LL+    N  A T+ G +P+ +A K     +++ LK
Sbjct:  407 LHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLK 786          

HSP 5 Score: 176.022 bits (445), Expect = 9.538e-45
Identity = 101/397 (25.44%), Postives = 185/397 (46.60%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  +GH  +V  L+ +    ++  +K    +H+A   G E++VK+L+E         +N   P++ A +  H  VV+LL++   N     ++   PL +A ++GH  +V +L++     D   +     +H+A  K  +K    L +   N +  ++  + P+H A   G + I N+LI K  D+    K N+ P+H+A   G   +V +L+    +IEA   DG   +H A   G+  +  +L++    I    +    P+H A +  H +  ++L+     ++         +H A+  GHV   K+L+ +  D  A A N    +H+AC+K   ++V+LL+R   +  A T  G +P+ +A       I+  L Q         ++ E P
Sbjct:   47 ALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETP 439          

HSP 6 Score: 175.637 bits (444), Expect = 1.506e-44
Identity = 103/416 (24.76%), Postives = 186/416 (44.71%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            N   +H A   G  ++V +L+ +  N E        P+H A   G+E++V +L+E+     A  +N   P+H A +                                  GH  V KLL+++  +  A   N   PLH+AC+K    +V LL+    +I A  ++   P+H+A   G + IV  L     + +        P+H A    Q +I+ IL+     ++A  ++   P+H+A   G+ +IV +L+ H   ++A   D + A+H+A ++G  ++A +LI+N   ++   +    P+H   + GH ++ QLL+    +++A  K    P+H A    + +   +L+ K     A A+N    +H+A  K   +I   L+       A +  G +P+ L+ +    EI  LL
Sbjct:  238 NISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLL 653          

HSP 7 Score: 150.599 bits (379), Expect = 9.986e-37
Identity = 86/359 (23.96%), Postives = 165/359 (45.96%), Query Frame = 2
Query:  917 IEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILI----------------TKKCDIEAP-------------EKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            ++   D    + N    +H A K GH  VV  L+ +   +++  K     LH+A   G  ++V+LL++   +++   QN   P+++A  + H  +V+ L +   N   A +  + P+  A  +G  ++V +L+                 KK D++A               K    P+H+A   G++ I  +LI    D+          +H+A + G  ++  LL++   +IE   +    P+H A   GH ++V +L++    I A  K    P+H A++  HV+  +IL+  +  ++    +   A+H+A   GH  + KLL+  + +  A  L G +P+ +A K  + +++ELL
Sbjct:   31 LKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELL 389          

HSP 8 Score: 149.443 bits (376), Expect = 2.683e-36
Identity = 83/331 (25.08%), Postives = 149/331 (45.02%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKIL-MLKKCDIEACAQNE 1750
            + A+H A  EG  ++  +LI      +   +K   P+HL  + G+ K+ ++L++++ D +A  +N   P+H AC   +++V  LL+ +  +  A  KN   PLH+A  K   DI   L++     +A  +    P+HL+  +GH                                  EI N+LI  K  +  P K  L P+HL   + +  + E+L  +  +I+     G+  +H+A   G A++ + L+ N  +++    I   P+H   + GH  IV LL++   N  A     + P+H A + G++     L  + K D  A A ++
Sbjct:  503 YTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGH---------------------------------AEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQ 800          

HSP 9 Score: 116.316 bits (290), Expect = 5.145e-26
Identity = 65/269 (24.16%), Postives = 134/269 (49.81%), Query Frame = 2
Query: 1106 RLLIDQKCNIDANDQNSN--RPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            R+L   K NID N  N+N    +HLA   GH+ +V  L  +   +++A +     +H A   GQ+E+V +L+     +    +    P+++A  + H  +V +L+++  +     +DG+  + +A ++G+  +  +L++++       ++    +H A +    +   LL+D + N +   K    P+H AS  G+     +L+ K  D+   A++    +H+A + G   +V LL+    N EA T  G +P+  A +S  ++++++L
Sbjct:   26 RVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR----GKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDML 290          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 186.808 bits (473), Expect = 5.336e-48
Identity = 113/413 (27.36%), Postives = 195/413 (47.22%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIE---------------------------------ACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A   GH  + K+L++ K N    A     P+H+AC+K   K+V++LI+   +  A  E+   P+H A   G   +V  L+  + + +      + PLHLA      DI+R+L+ +   +DA  +    P+H+A   G++ I+  L      I A +   +  +H A  +GQ+ IV +L+    +  A  KK   P+HLAC  G + +V++L+ +   I+                                  C  +G  AIH+AC+K Y +IA  L+ +  D+ +  +    P+H A + G+ ++VQLL++    I A  K    P+H A++ GHV  ++IL+    +I    +N    +H+A   GH ++VK  +    + E  +  G +P+  A +     II LL
Sbjct:  369 ALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLL 779          

HSP 2 Score: 182.57 bits (462), Expect = 1.258e-46
Identity = 112/450 (24.89%), Postives = 204/450 (45.33%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEK---------------------------------GHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKG---------------------------------QKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ DI  +L+N K +    A+ N  P+H+AC+ G   +  +L+ +    +A   +   P+H A + GH EV+K L+ Q   +    KN    LH+A +                                  GH  + +LL+D K N +A   N   P+H+AC K  +K+V+ L     NI A  +    P+H A + G                                 Q +I+ IL+ +   ++A  ++   P+H+A   G+  I+ +L+ H  +I A  +D + A+H+A ++G  +I Q+L++N  +     +    P+H AC+ G   +VQ+L+    +I+   K +  P+H A+   +    ++L+        CA+N + AIH+AC+K + EI   L++   +   ++  G SP+ LA +    ++++LL
Sbjct:  233 SGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 3 Score: 178.333 bits (451), Expect = 2.741e-45
Identity = 106/415 (25.54%), Postives = 189/415 (45.54%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQ--------------------------ISK------RPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +  +H AC +    +V++LI    N     E    P+H+A   G   IV  L++ +   +        P+H A +    +++++L+ +   ++A  +  Q PLH+A   G+ +I+ LL+     I+A   +    +H+A  +G   IV+ L        A  +  + P+H AC  G++ +V IL+     I+   K ++ P+H+A    +  IVE+L+ +      C  +G  AIH+AC+K Y +IA  L+ +  D+ +  +                          IS        P+H A + GH  + Q+L++   NI    +    P+H A+  GH++  K  +    DIE  +      +H A ++GH  I+ LL+R   N  ALT  GN+ + +A       ++E LK
Sbjct:  400 FTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          

HSP 4 Score: 168.703 bits (426), Expect = 2.768e-42
Identity = 96/382 (25.13%), Postives = 185/382 (48.43%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +   +  K+L+    N +  ++    P+H+A   G   I  +L+  K D     ++N  P+H ACK G   +  LL+ +   ++A  ++   PLH A   GH ++++ L+ Q   I    +N    +H+A    H +    L + K  ++         +H A   G  ++  +L+  K +  A       P+H+AC K   ++VE+LI H  +I A  + G   +H+A   G  +I   L+ +    ++     + P+H A      +I+++L+ +   ++A  +  + P+H AS  G++    +L+    +I A + ++  A+H+A ++G   IV++L+       A+T KG +P+ LA K  KQ ++++L Q
Sbjct:  204 ALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQ 584          

HSP 5 Score: 156.762 bits (395), Expect = 1.609e-38
Identity = 94/389 (24.16%), Postives = 186/389 (47.81%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQT 1915
            K   A+H A   G  D++  LI    N    +     P+++A ++ ++   + L+    +     E+   P+  A ++GH ++V +L+          K     LH+A +K   +  +LL+    N D   ++   P+H+A   G++ I   L N K ++    + N  P+H AC  G+  +  +L+ +   I+A  +  L P+H A   GH E+++ L+     I     +G  A+H+A +  + + A LL+DN   ++         +H A   GH ++ +LL+D  AN N  A + +   P+H A +   ++  ++L+    +I A  ++    +H+A   G   IV  L++   + +  T++G +P+ LA ++ + +II +L ++
Sbjct:  105 KGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVR----GKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFT--PLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS 487          

HSP 6 Score: 146.362 bits (368), Expect = 2.634e-35
Identity = 96/397 (24.18%), Postives = 173/397 (43.58%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  +G+ DI   L+ +    +   +K    +H+A   G   ++  LI    +      N   P++ A +  H    + L+    N     ++   PL +A ++GH  IV +L++     D   +     +H+A  K  +   K L     N +  ++  + P+H A   G  +I  +L+  K D+    K N+ P+H+AC  G   +  +L+     I+A   DG   +H A   G+ ++ + L+  N  I    +     +H A +  H E   LL+D    ++         +H A+  GHV+  K+L+  K +  A A N    +H+AC+K   ++V+LL++   N  A T  G +P+ +A       I+  L Q         ++ E P
Sbjct:   76 ALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETP 468          

HSP 7 Score: 134.42 bits (337), Expect = 1.415e-31
Identity = 95/391 (24.30%), Postives = 170/391 (43.48%), Query Frame = 2
Query:  746 II*KNWRAIHFACFEGHADIVKMLINQKC----NFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            II +N   I F       DI K++    C    +  +C       +HLA + GY  I   L+ +    +   +     +H A   G  +V+  LI    N+     N   PL++A ++ H +  R L+    N   + ++   P+ +A  +GH KIV  L       +   ++    +H A  K       +L+    + +   K    P+H+A   G+ +I  +L+N+K D+          +H+AC+ G   +  LL+     I+   +    P+H A   GH E+++ L+  N  I    K     +H A++  H E   +L+  K  ++    +   A+H+A   GH ++ KLL+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   32 IIKQNDATISFLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELL 418          

HSP 8 Score: 92.4337 bits (228), Expect = 1.341e-18
Identity = 60/262 (22.90%), Postives = 122/262 (46.56%), Query Frame = 2
Query: 1127 CNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +I++ + N    +HLA   G++ I   L  +   I+ A +     +H A   GQ +++N LI    ++         P+++A  + H      L+ +  +     +DG+  + +A ++G+  I  +L++N    +V  ++    +H A +       +LL+  + N +   K    P+H A+  G+V+   +L+  K D+   A++    +H+AC+ G   +  LL+      +A T  G +P+  A +S   E+I+ L Q
Sbjct:   64 SDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQ 321          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 186.808 bits (473), Expect = 5.336e-48
Identity = 113/413 (27.36%), Postives = 195/413 (47.22%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIE---------------------------------ACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A   GH  + K+L++ K N    A     P+H+AC+K   K+V++LI+   +  A  E+   P+H A   G   +V  L+  + + +      + PLHLA      DI+R+L+ +   +DA  +    P+H+A   G++ I+  L      I A +   +  +H A  +GQ+ IV +L+    +  A  KK   P+HLAC  G + +V++L+ +   I+                                  C  +G  AIH+AC+K Y +IA  L+ +  D+ +  +    P+H A + G+ ++VQLL++    I A  K    P+H A++ GHV  ++IL+    +I    +N    +H+A   GH ++VK  +    + E  +  G +P+  A +     II LL
Sbjct:  369 ALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLL 779          

HSP 2 Score: 182.57 bits (462), Expect = 1.258e-46
Identity = 112/450 (24.89%), Postives = 204/450 (45.33%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEK---------------------------------GHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKG---------------------------------QKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ DI  +L+N K +    A+ N  P+H+AC+ G   +  +L+ +    +A   +   P+H A + GH EV+K L+ Q   +    KN    LH+A +                                  GH  + +LL+D K N +A   N   P+H+AC K  +K+V+ L     NI A  +    P+H A + G                                 Q +I+ IL+ +   ++A  ++   P+H+A   G+  I+ +L+ H  +I A  +D + A+H+A ++G  +I Q+L++N  +     +    P+H AC+ G   +VQ+L+    +I+   K +  P+H A+   +    ++L+        CA+N + AIH+AC+K + EI   L++   +   ++  G SP+ LA +    ++++LL
Sbjct:  233 SGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 3 Score: 178.333 bits (451), Expect = 2.741e-45
Identity = 106/415 (25.54%), Postives = 189/415 (45.54%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQ--------------------------ISK------RPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +  +H AC +    +V++LI    N     E    P+H+A   G   IV  L++ +   +        P+H A +    +++++L+ +   ++A  +  Q PLH+A   G+ +I+ LL+     I+A   +    +H+A  +G   IV+ L        A  +  + P+H AC  G++ +V IL+     I+   K ++ P+H+A    +  IVE+L+ +      C  +G  AIH+AC+K Y +IA  L+ +  D+ +  +                          IS        P+H A + GH  + Q+L++   NI    +    P+H A+  GH++  K  +    DIE  +      +H A ++GH  I+ LL+R   N  ALT  GN+ + +A       ++E LK
Sbjct:  400 FTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          

HSP 4 Score: 168.703 bits (426), Expect = 2.768e-42
Identity = 96/382 (25.13%), Postives = 185/382 (48.43%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +   +  K+L+    N +  ++    P+H+A   G   I  +L+  K D     ++N  P+H ACK G   +  LL+ +   ++A  ++   PLH A   GH ++++ L+ Q   I    +N    +H+A    H +    L + K  ++         +H A   G  ++  +L+  K +  A       P+H+AC K   ++VE+LI H  +I A  + G   +H+A   G  +I   L+ +    ++     + P+H A      +I+++L+ +   ++A  +  + P+H AS  G++    +L+    +I A + ++  A+H+A ++G   IV++L+       A+T KG +P+ LA K  KQ ++++L Q
Sbjct:  204 ALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQ 584          

HSP 5 Score: 156.762 bits (395), Expect = 1.609e-38
Identity = 94/389 (24.16%), Postives = 186/389 (47.81%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQT 1915
            K   A+H A   G  D++  LI    N    +     P+++A ++ ++   + L+    +     E+   P+  A ++GH ++V +L+          K     LH+A +K   +  +LL+    N D   ++   P+H+A   G++ I   L N K ++    + N  P+H AC  G+  +  +L+ +   I+A  +  L P+H A   GH E+++ L+     I     +G  A+H+A +  + + A LL+DN   ++         +H A   GH ++ +LL+D  AN N  A + +   P+H A +   ++  ++L+    +I A  ++    +H+A   G   IV  L++   + +  T++G +P+ LA ++ + +II +L ++
Sbjct:  105 KGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVR----GKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFT--PLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS 487          

HSP 6 Score: 146.362 bits (368), Expect = 2.634e-35
Identity = 96/397 (24.18%), Postives = 173/397 (43.58%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  +G+ DI   L+ +    +   +K    +H+A   G   ++  LI    +      N   P++ A +  H    + L+    N     ++   PL +A ++GH  IV +L++     D   +     +H+A  K  +   K L     N +  ++  + P+H A   G  +I  +L+  K D+    K N+ P+H+AC  G   +  +L+     I+A   DG   +H A   G+ ++ + L+  N  I    +     +H A +  H E   LL+D    ++         +H A+  GHV+  K+L+  K +  A A N    +H+AC+K   ++V+LL++   N  A T  G +P+ +A       I+  L Q         ++ E P
Sbjct:   76 ALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETP 468          

HSP 7 Score: 134.42 bits (337), Expect = 1.415e-31
Identity = 95/391 (24.30%), Postives = 170/391 (43.48%), Query Frame = 2
Query:  746 II*KNWRAIHFACFEGHADIVKMLINQKC----NFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            II +N   I F       DI K++    C    +  +C       +HLA + GY  I   L+ +    +   +     +H A   G  +V+  LI    N+     N   PL++A ++ H +  R L+    N   + ++   P+ +A  +GH KIV  L       +   ++    +H A  K       +L+    + +   K    P+H+A   G+ +I  +L+N+K D+          +H+AC+ G   +  LL+     I+   +    P+H A   GH E+++ L+  N  I    K     +H A++  H E   +L+  K  ++    +   A+H+A   GH ++ KLL+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   32 IIKQNDATISFLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELL 418          

HSP 8 Score: 92.4337 bits (228), Expect = 1.341e-18
Identity = 60/262 (22.90%), Postives = 122/262 (46.56%), Query Frame = 2
Query: 1127 CNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +I++ + N    +HLA   G++ I   L  +   I+ A +     +H A   GQ +++N LI    ++         P+++A  + H      L+ +  +     +DG+  + +A ++G+  I  +L++N    +V  ++    +H A +       +LL+  + N +   K    P+H A+  G+V+   +L+  K D+   A++    +H+AC+ G   +  LL+      +A T  G +P+  A +S   E+I+ L Q
Sbjct:   64 SDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQ 321          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 186.808 bits (473), Expect = 5.336e-48
Identity = 113/413 (27.36%), Postives = 195/413 (47.22%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIE---------------------------------ACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A   GH  + K+L++ K N    A     P+H+AC+K   K+V++LI+   +  A  E+   P+H A   G   +V  L+  + + +      + PLHLA      DI+R+L+ +   +DA  +    P+H+A   G++ I+  L      I A +   +  +H A  +GQ+ IV +L+    +  A  KK   P+HLAC  G + +V++L+ +   I+                                  C  +G  AIH+AC+K Y +IA  L+ +  D+ +  +    P+H A + G+ ++VQLL++    I A  K    P+H A++ GHV  ++IL+    +I    +N    +H+A   GH ++VK  +    + E  +  G +P+  A +     II LL
Sbjct:  369 ALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLL 779          

HSP 2 Score: 182.57 bits (462), Expect = 1.258e-46
Identity = 112/450 (24.89%), Postives = 204/450 (45.33%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEK---------------------------------GHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKG---------------------------------QKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ DI  +L+N K +    A+ N  P+H+AC+ G   +  +L+ +    +A   +   P+H A + GH EV+K L+ Q   +    KN    LH+A +                                  GH  + +LL+D K N +A   N   P+H+AC K  +K+V+ L     NI A  +    P+H A + G                                 Q +I+ IL+ +   ++A  ++   P+H+A   G+  I+ +L+ H  +I A  +D + A+H+A ++G  +I Q+L++N  +     +    P+H AC+ G   +VQ+L+    +I+   K +  P+H A+   +    ++L+        CA+N + AIH+AC+K + EI   L++   +   ++  G SP+ LA +    ++++LL
Sbjct:  233 SGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 3 Score: 178.333 bits (451), Expect = 2.741e-45
Identity = 106/415 (25.54%), Postives = 189/415 (45.54%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQ--------------------------ISK------RPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +  +H AC +    +V++LI    N     E    P+H+A   G   IV  L++ +   +        P+H A +    +++++L+ +   ++A  +  Q PLH+A   G+ +I+ LL+     I+A   +    +H+A  +G   IV+ L        A  +  + P+H AC  G++ +V IL+     I+   K ++ P+H+A    +  IVE+L+ +      C  +G  AIH+AC+K Y +IA  L+ +  D+ +  +                          IS        P+H A + GH  + Q+L++   NI    +    P+H A+  GH++  K  +    DIE  +      +H A ++GH  I+ LL+R   N  ALT  GN+ + +A       ++E LK
Sbjct:  400 FTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          

HSP 4 Score: 168.703 bits (426), Expect = 2.768e-42
Identity = 96/382 (25.13%), Postives = 185/382 (48.43%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +   +  K+L+    N +  ++    P+H+A   G   I  +L+  K D     ++N  P+H ACK G   +  LL+ +   ++A  ++   PLH A   GH ++++ L+ Q   I    +N    +H+A    H +    L + K  ++         +H A   G  ++  +L+  K +  A       P+H+AC K   ++VE+LI H  +I A  + G   +H+A   G  +I   L+ +    ++     + P+H A      +I+++L+ +   ++A  +  + P+H AS  G++    +L+    +I A + ++  A+H+A ++G   IV++L+       A+T KG +P+ LA K  KQ ++++L Q
Sbjct:  204 ALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQ 584          

HSP 5 Score: 156.762 bits (395), Expect = 1.609e-38
Identity = 94/389 (24.16%), Postives = 186/389 (47.81%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQT 1915
            K   A+H A   G  D++  LI    N    +     P+++A ++ ++   + L+    +     E+   P+  A ++GH ++V +L+          K     LH+A +K   +  +LL+    N D   ++   P+H+A   G++ I   L N K ++    + N  P+H AC  G+  +  +L+ +   I+A  +  L P+H A   GH E+++ L+     I     +G  A+H+A +  + + A LL+DN   ++         +H A   GH ++ +LL+D  AN N  A + +   P+H A +   ++  ++L+    +I A  ++    +H+A   G   IV  L++   + +  T++G +P+ LA ++ + +II +L ++
Sbjct:  105 KGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVR----GKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFT--PLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS 487          

HSP 6 Score: 146.362 bits (368), Expect = 2.634e-35
Identity = 96/397 (24.18%), Postives = 173/397 (43.58%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  +G+ DI   L+ +    +   +K    +H+A   G   ++  LI    +      N   P++ A +  H    + L+    N     ++   PL +A ++GH  IV +L++     D   +     +H+A  K  +   K L     N +  ++  + P+H A   G  +I  +L+  K D+    K N+ P+H+AC  G   +  +L+     I+A   DG   +H A   G+ ++ + L+  N  I    +     +H A +  H E   LL+D    ++         +H A+  GHV+  K+L+  K +  A A N    +H+AC+K   ++V+LL++   N  A T  G +P+ +A       I+  L Q         ++ E P
Sbjct:   76 ALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETP 468          

HSP 7 Score: 134.42 bits (337), Expect = 1.415e-31
Identity = 95/391 (24.30%), Postives = 170/391 (43.48%), Query Frame = 2
Query:  746 II*KNWRAIHFACFEGHADIVKMLINQKC----NFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            II +N   I F       DI K++    C    +  +C       +HLA + GY  I   L+ +    +   +     +H A   G  +V+  LI    N+     N   PL++A ++ H +  R L+    N   + ++   P+ +A  +GH KIV  L       +   ++    +H A  K       +L+    + +   K    P+H+A   G+ +I  +L+N+K D+          +H+AC+ G   +  LL+     I+   +    P+H A   GH E+++ L+  N  I    K     +H A++  H E   +L+  K  ++    +   A+H+A   GH ++ KLL+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   32 IIKQNDATISFLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELL 418          

HSP 8 Score: 92.4337 bits (228), Expect = 1.341e-18
Identity = 60/262 (22.90%), Postives = 122/262 (46.56%), Query Frame = 2
Query: 1127 CNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +I++ + N    +HLA   G++ I   L  +   I+ A +     +H A   GQ +++N LI    ++         P+++A  + H      L+ +  +     +DG+  + +A ++G+  I  +L++N    +V  ++    +H A +       +LL+  + N +   K    P+H A+  G+V+   +L+  K D+   A++    +H+AC+ G   +  LL+      +A T  G +P+  A +S   E+I+ L Q
Sbjct:   64 SDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQ 321          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089173)

HSP 1 Score: 186.808 bits (473), Expect = 5.336e-48
Identity = 113/413 (27.36%), Postives = 195/413 (47.22%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIE---------------------------------ACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A   GH  + K+L++ K N    A     P+H+AC+K   K+V++LI+   +  A  E+   P+H A   G   +V  L+  + + +      + PLHLA      DI+R+L+ +   +DA  +    P+H+A   G++ I+  L      I A +   +  +H A  +GQ+ IV +L+    +  A  KK   P+HLAC  G + +V++L+ +   I+                                  C  +G  AIH+AC+K Y +IA  L+ +  D+ +  +    P+H A + G+ ++VQLL++    I A  K    P+H A++ GHV  ++IL+    +I    +N    +H+A   GH ++VK  +    + E  +  G +P+  A +     II LL
Sbjct:  369 ALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLL 779          

HSP 2 Score: 182.57 bits (462), Expect = 1.258e-46
Identity = 112/450 (24.89%), Postives = 204/450 (45.33%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEK---------------------------------GHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKG---------------------------------QKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ DI  +L+N K +    A+ N  P+H+AC+ G   +  +L+ +    +A   +   P+H A + GH EV+K L+ Q   +    KN    LH+A +                                  GH  + +LL+D K N +A   N   P+H+AC K  +K+V+ L     NI A  +    P+H A + G                                 Q +I+ IL+ +   ++A  ++   P+H+A   G+  I+ +L+ H  +I A  +D + A+H+A ++G  +I Q+L++N  +     +    P+H AC+ G   +VQ+L+    +I+   K +  P+H A+   +    ++L+        CA+N + AIH+AC+K + EI   L++   +   ++  G SP+ LA +    ++++LL
Sbjct:  233 SGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 3 Score: 178.333 bits (451), Expect = 2.741e-45
Identity = 106/415 (25.54%), Postives = 189/415 (45.54%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQ--------------------------ISK------RPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +  +H AC +    +V++LI    N     E    P+H+A   G   IV  L++ +   +        P+H A +    +++++L+ +   ++A  +  Q PLH+A   G+ +I+ LL+     I+A   +    +H+A  +G   IV+ L        A  +  + P+H AC  G++ +V IL+     I+   K ++ P+H+A    +  IVE+L+ +      C  +G  AIH+AC+K Y +IA  L+ +  D+ +  +                          IS        P+H A + GH  + Q+L++   NI    +    P+H A+  GH++  K  +    DIE  +      +H A ++GH  I+ LL+R   N  ALT  GN+ + +A       ++E LK
Sbjct:  400 FTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          

HSP 4 Score: 168.703 bits (426), Expect = 2.768e-42
Identity = 96/382 (25.13%), Postives = 185/382 (48.43%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +   +  K+L+    N +  ++    P+H+A   G   I  +L+  K D     ++N  P+H ACK G   +  LL+ +   ++A  ++   PLH A   GH ++++ L+ Q   I    +N    +H+A    H +    L + K  ++         +H A   G  ++  +L+  K +  A       P+H+AC K   ++VE+LI H  +I A  + G   +H+A   G  +I   L+ +    ++     + P+H A      +I+++L+ +   ++A  +  + P+H AS  G++    +L+    +I A + ++  A+H+A ++G   IV++L+       A+T KG +P+ LA K  KQ ++++L Q
Sbjct:  204 ALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQ 584          

HSP 5 Score: 156.762 bits (395), Expect = 1.609e-38
Identity = 94/389 (24.16%), Postives = 186/389 (47.81%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQT 1915
            K   A+H A   G  D++  LI    N    +     P+++A ++ ++   + L+    +     E+   P+  A ++GH ++V +L+          K     LH+A +K   +  +LL+    N D   ++   P+H+A   G++ I   L N K ++    + N  P+H AC  G+  +  +L+ +   I+A  +  L P+H A   GH E+++ L+     I     +G  A+H+A +  + + A LL+DN   ++         +H A   GH ++ +LL+D  AN N  A + +   P+H A +   ++  ++L+    +I A  ++    +H+A   G   IV  L++   + +  T++G +P+ LA ++ + +II +L ++
Sbjct:  105 KGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVR----GKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFT--PLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS 487          

HSP 6 Score: 146.362 bits (368), Expect = 2.634e-35
Identity = 96/397 (24.18%), Postives = 173/397 (43.58%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  +G+ DI   L+ +    +   +K    +H+A   G   ++  LI    +      N   P++ A +  H    + L+    N     ++   PL +A ++GH  IV +L++     D   +     +H+A  K  +   K L     N +  ++  + P+H A   G  +I  +L+  K D+    K N+ P+H+AC  G   +  +L+     I+A   DG   +H A   G+ ++ + L+  N  I    +     +H A +  H E   LL+D    ++         +H A+  GHV+  K+L+  K +  A A N    +H+AC+K   ++V+LL++   N  A T  G +P+ +A       I+  L Q         ++ E P
Sbjct:   76 ALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETP 468          

HSP 7 Score: 134.42 bits (337), Expect = 1.415e-31
Identity = 95/391 (24.30%), Postives = 170/391 (43.48%), Query Frame = 2
Query:  746 II*KNWRAIHFACFEGHADIVKMLINQKC----NFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            II +N   I F       DI K++    C    +  +C       +HLA + GY  I   L+ +    +   +     +H A   G  +V+  LI    N+     N   PL++A ++ H +  R L+    N   + ++   P+ +A  +GH KIV  L       +   ++    +H A  K       +L+    + +   K    P+H+A   G+ +I  +L+N+K D+          +H+AC+ G   +  LL+     I+   +    P+H A   GH E+++ L+  N  I    K     +H A++  H E   +L+  K  ++    +   A+H+A   GH ++ KLL+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   32 IIKQNDATISFLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELL 418          

HSP 8 Score: 92.4337 bits (228), Expect = 1.341e-18
Identity = 60/262 (22.90%), Postives = 122/262 (46.56%), Query Frame = 2
Query: 1127 CNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +I++ + N    +HLA   G++ I   L  +   I+ A +     +H A   GQ +++N LI    ++         P+++A  + H      L+ +  +     +DG+  + +A ++G+  I  +L++N    +V  ++    +H A +       +LL+  + N +   K    P+H A+  G+V+   +L+  K D+   A++    +H+AC+ G   +  LL+      +A T  G +P+  A +S   E+I+ L Q
Sbjct:   64 SDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQ 321          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 199.519 bits (506), Expect = 5.714e-52
Identity = 106/385 (27.53%), Postives = 196/385 (50.91%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ--KCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A    +  + ++L+N+  N     +    P+H+A  +G   +V++L+++    +A  ++   P+H A + GH  VV++L++Q   L+A  KN   P+H+A +  H D VR L+     ID    +   P+H+A   GH ++VK L ++  K N  A N   + P+H AC K     +++L+     +EA  +  L P+H+A   GH  IV+ L+       A +      +H+A   G+ ++AQ L+ NN  ++   +  + P+H A  MGH E+V+LL++   N ++       P+H A+  GH + T+IL+ +        +     +H+AC+ G  ++V+LL+    N  A    G +P+ +A      ++++LL
Sbjct:  239 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALN--GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL 621          

HSP 2 Score: 199.519 bits (506), Expect = 6.081e-52
Identity = 104/379 (27.44%), Postives = 197/379 (51.98%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  +V++L++Q    +   +    PIH+A +  +   V+ L++   + +    ++  P+H A   GH  +VK+L+++     A   N   PLH+AC+K H   + LL+    +++A  ++   P+H+A   GHL IVK+L  +  +  A+N     P+H A   G  E+   L+     ++A  K +  P+H A   GHKE+V++L+ HK + ++    G   +H+A  +G+A   ++L+D N       +    P+H AC+ G  ++V+LL++   N  A  K    P+H A    +++  K+L+ K     + A+N   A+H+A ++   E+   L++   N  + +L+G +P+ LA +  + +++ LL
Sbjct:  309 LHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALL 687          

HSP 3 Score: 194.512 bits (493), Expect = 1.906e-50
Identity = 101/380 (26.58%), Postives = 185/380 (48.68%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A          +L+    N +  ++    P+H+A       + ++L+ +  +     +N   P+H A +RG+  +V+LL+++   ++A  K+   PLH A   GH  +V +L+DQ   + A  +N   PIH+A    H+  V+ L      I+     +  P+H A   G   +V +L+ K     A       P+H+AC K H   +++L+ H   +EA  + G   +H+A   G+ +I + L+         +   + P+H A   GH E+ Q L+  N  ++A  K ++ P+H A+  GH E  K+LM  K + ++        +H+A  +GHA+  ++L+  +     +T KG +P+ +A K  K +++ELL
Sbjct:  209 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 588          

HSP 4 Score: 192.971 bits (489), Expect = 6.084e-50
Identity = 108/413 (26.15%), Postives = 197/413 (47.70%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILI-----------------------------EQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K +  ++ A  E H ++VK L+    N     E    P+ +A ++G+E +V +LI                             +   + +   +    P+H A    +  V +LL+N+  N+    KN   PLH+A  +G+  +VRLL+D+   IDA  ++   P+H A   GH+++V+ L +Q   ++A  +    PIH A      + V  L+    +I+     +L P+H+A   GH  +V+VL++      A   +G+  +H+AC+K +     LL+ ++  +E   +    P+H A  MGH  IV+ L+    +  A +     P+H A+ AGH E  + L+     ++A A++++  +H A   GH E+VKLL+    N ++ T  G++P+ +A +    +   +L
Sbjct:  143 KGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRIL 555          

HSP 5 Score: 187.578 bits (475), Expect = 3.372e-48
Identity = 96/362 (26.52%), Postives = 187/362 (51.66%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLID--NNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLV--RAHCNTE 1831
             +  +H AC + H   + +L+    + E   E    P+H+A   G+  IVK L+++     A +     P+H A + GH EV + L+     ++A  K++Q PLH A   GH ++V+LL++ K N D+     + P+H+A  +GH +  + L ++        +  + P+H AC  G+ ++V +L+ +  +  A  K  L P+H+A    + ++V++L++      +   +G+ A+H+A ++   ++A  L+    N + E    I+  P+H A + G  ++V LLI    N+   +K    P+H  ++ GHV    +L+ +   + A ++     +H+AC  G+ ++VK L+  +AH N++
Sbjct:  404 GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGIT--PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSK 763          

HSP 6 Score: 182.57 bits (462), Expect = 1.494e-46
Identity = 99/415 (23.86%), Postives = 190/415 (45.78%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKK--------------------------CDIEACA---------QNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H A F GH +IVK L+ +  +      K + P+H+A   G+ ++ + L++     +A  +++  P+H A + GHKE+VKLL+  K N ++       PLH+A  +GH    R+L+D+        +    P+H+AC  G + +V+ L  +  N  AA +    P+H A      ++V +L++K     +  +     +H+A  +   E+   L+ +  +  +    G   +HLA ++G  D+  LLI    ++ + ++    P+H   + GH  I  +L+    ++ A  +    P+H A   G+++  K L+ ++                          C +   A         Q     +H A ++GH +IV LL++       +T  G SP+ +A++     +I++LK
Sbjct:  441 LHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 855          

HSP 7 Score: 178.718 bits (452), Expect = 2.404e-45
Identity = 93/367 (25.34%), Postives = 172/367 (46.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +H A   GH  +VK+L+++       A     P+H+AC+K + + + +L++     EA  E+   P+H A   GH  +VK L+ +  +  A +   + PLH+A   GH ++ + L+     +DA  ++   P+H A   GH ++VK L   K N ++A      P+H A  +G  +   IL+ +        KK   P+H+AC  G  ++VE+L+    +  A   +G   +H+A      D+ +LL+          +     +H A +    E+   L+    N  +       P+H AS+ G  +   +L+ K+ ++    +N    +HL  ++GH  I  +LV+   +  A +  G +P+ +A
Sbjct:  375 LHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVA 741          

HSP 8 Score: 175.637 bits (444), Expect = 2.101e-44
Identity = 111/428 (25.93%), Postives = 197/428 (46.03%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQ----KCNIDA------------------NDQNSN-------RPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
             +H A  EGH  +V  L++   + ET  +K    +H+A   G EK+V  LI    +  A  +    P++ A +  H EVVK L+    N     ++   PL +A ++GH ++V LLI+     K  + A                  ND N +        P+H+A    +L + + L N+  N+    +    P+H A  +G   +V +L+ +   I+A  K  L P+H A   GH  +VE+L++    ++A   +G   IH+A +  + D  + L+  N +I+        P+H A   GH  +V++L+D  A  N  A + +   P+H A +  H+    +L+     +EA  ++    +H+A   GH  IVK L++   +  A  +K  +P+ +A ++   E+ + L Q   +  +    D+ P
Sbjct:   81 GLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFT--PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTP 506          

HSP 9 Score: 142.51 bits (358), Expect = 5.943e-34
Identity = 86/359 (23.96%), Postives = 158/359 (44.01%), Query Frame = 2
Query:  917 IEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILIT--KKCDIEAP---------------------------EKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            I+   D    ++N    +H A K GH ++V  L++   +LE   K     LH+A   G   +V  LI+   N++A  Q    P+++A  + HL++VK L     N     +  + P+  A  +G + +V +LI    K  +  P                            K    P+H+A    +  + ++L+N   ++     +G   +H+A  +G   + +LL+D    I+   +    P+H A   GH  +V++L+D    ++A  K    PIH A++  H++C + L+    +I+    +    +H+A   GH  +VK+L+       A  L G +P+ +A K      ++LL
Sbjct:   65 IKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLL 423          

HSP 10 Score: 130.183 bits (326), Expect = 3.708e-30
Identity = 78/312 (25.00%), Postives = 146/312 (46.79%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + G+ E     I    ++   ++N    LHLA ++GH  +V  L+    +++   +  N  +H+A   G  K+V  L N   N+ A +Q  + P++ A  +   E+V  L+    +   P +    P+ +A  +GH+ +V +LIN+    +        A+H+A        A +L+ N+ + +V  +    P+H A    +  + QLL++   N+    K    P+H AS  G+V   ++L+ +   I+A  ++E   +H A   GH  +V++L+      +A T  G SPI +A +    + +  L Q
Sbjct:   52 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQ 359          

HSP 11 Score: 125.176 bits (313), Expect = 1.389e-28
Identity = 68/294 (23.13%), Postives = 133/294 (45.24%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDD---------GWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLL 1609
            K +  +H AC  G  D+V++L+ +  N     +    P+H+A       +VK+L+ +     +   N    +H A K+   EV   L+    N  +       PLHLA ++G  D+V LLI ++ N++  ++N   P+HL   +GH+ I   L  Q  ++ AA+++ + P+H AC  G  ++V  L+ ++  + +  + ++    L     +  +  V +   C +               G+  +H A ++G+ DI  LL+ +             P+  A  +G+  ++ +L
Sbjct:  568 KGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSV----LLLDASYTGLFSVSV---CTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 854          

HSP 12 Score: 57.7658 bits (138), Expect = 7.714e-8
Identity = 35/138 (25.36%), Postives = 65/138 (47.10%), Query Frame = 2
Query: 1511 IDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            I N  DI + +Q     +H A + GH ++V  L+    ++E   K     +H A+ AG  +    L+    ++ A +Q     +++A ++ H E+VK L+    N    T  G +P+ +A +   + ++ LL    TK
Sbjct:   65 IKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK 202          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 198.749 bits (504), Expect = 7.656e-52
Identity = 104/379 (27.44%), Postives = 197/379 (51.98%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  +V++L++Q    +   +    PIH+A +  +   V+ L++   + +    ++  P+H A   GH  +VK+L+++     A   N   PLH+AC+K H   + LL+    +++A  ++   P+H+A   GHL IVK+L  +  +  A+N     P+H A   G  E+   L+     ++A  K +  P+H A   GHKE+V++L+ HK + ++    G   +H+A  +G+A   ++L+D N       +    P+H AC+ G  ++V+LL++   N  A  K    P+H A    +++  K+L+ K     + A+N   A+H+A ++   E+   L++   N  + +L+G +P+ LA +  + +++ LL
Sbjct:  217 LHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALL 595          

HSP 2 Score: 198.749 bits (504), Expect = 8.222e-52
Identity = 106/385 (27.53%), Postives = 196/385 (50.91%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ--KCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A    +  + ++L+N+  N     +    P+H+A  +G   +V++L+++    +A  ++   P+H A + GH  VV++L++Q   L+A  KN   P+H+A +  H D VR L+     ID    +   P+H+A   GH ++VK L ++  K N  A N   + P+H AC K     +++L+     +EA  +  L P+H+A   GH  IV+ L+       A +      +H+A   G+ ++AQ L+ NN  ++   +  + P+H A  MGH E+V+LL++   N ++       P+H A+  GH + T+IL+ +        +     +H+AC+ G  ++V+LL+    N  A    G +P+ +A      ++++LL
Sbjct:  147 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALN--GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL 529          

HSP 3 Score: 197.208 bits (500), Expect = 2.482e-51
Identity = 96/380 (25.26%), Postives = 189/380 (49.74%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H A F GH +IVK L+ +  +      K + P+H+A   G+ ++ + L++     +A  +++  P+H A + GHKE+VKLL+  K N ++       PLH+A  +GH    R+L+D+        +    P+H+AC  G + +V+ L  +  N  AA +    P+H A      ++V +L++K     +  +     +H+A  +   E+   L+ +  +  +    G   +HLA ++G  D+  LLI    ++ + ++    P+H   + GH  I  +L+    ++ A  +    P+H A   G+++  K L+ ++  + +  +     +H A ++GH +IV LL++       +T  G SP+ +A++     +I++LK
Sbjct:  349 LHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 728          

HSP 4 Score: 194.126 bits (492), Expect = 2.715e-50
Identity = 101/380 (26.58%), Postives = 185/380 (48.68%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A          +L+    N +  ++    P+H+A       + ++L+ +  +     +N   P+H A +RG+  +V+LL+++   ++A  K+   PLH A   GH  +V +L+DQ   + A  +N   PIH+A    H+  V+ L      I+     +  P+H A   G   +V +L+ K     A       P+H+AC K H   +++L+ H   +EA  + G   +H+A   G+ +I + L+         +   + P+H A   GH E+ Q L+  N  ++A  K ++ P+H A+  GH E  K+LM  K + ++        +H+A  +GHA+  ++L+  +     +T KG +P+ +A K  K +++ELL
Sbjct:  117 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 496          

HSP 5 Score: 192.2 bits (487), Expect = 9.001e-50
Identity = 108/413 (26.15%), Postives = 197/413 (47.70%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILI-----------------------------EQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K +  ++ A  E H ++VK L+    N     E    P+ +A ++G+E +V +LI                             +   + +   +    P+H A    +  V +LL+N+  N+    KN   PLH+A  +G+  +VRLL+D+   IDA  ++   P+H A   GH+++V+ L +Q   ++A  +    PIH A      + V  L+    +I+     +L P+H+A   GH  +V+VL++      A   +G+  +H+AC+K +     LL+ ++  +E   +    P+H A  MGH  IV+ L+    +  A +     P+H A+ AGH E  + L+     ++A A++++  +H A   GH E+VKLL+    N ++ T  G++P+ +A +    +   +L
Sbjct:   51 KGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRIL 463          

HSP 6 Score: 177.948 bits (450), Expect = 3.191e-45
Identity = 93/367 (25.34%), Postives = 172/367 (46.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +H A   GH  +VK+L+++       A     P+H+AC+K + + + +L++     EA  E+   P+H A   GH  +VK L+ +  +  A +   + PLH+A   GH ++ + L+     +DA  ++   P+H A   GH ++VK L   K N ++A      P+H A  +G  +   IL+ +        KK   P+H+AC  G  ++VE+L+    +  A   +G   +H+A      D+ +LL+          +     +H A +    E+   L+    N  +       P+H AS+ G  +   +L+ K+ ++    +N    +HL  ++GH  I  +LV+   +  A +  G +P+ +A
Sbjct:  283 LHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVA 649          

HSP 7 Score: 173.711 bits (439), Expect = 7.946e-44
Identity = 107/407 (26.29%), Postives = 191/407 (46.93%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ----KCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            K   A+H A   G   +V  LIN   N    ++K   P+++A ++ + ++VK L+E   +     E+   P+  A ++GH+ VV LLIN     K  L A        LH+A     T    +L+    N D   +    P+H+A    +L + + L N+  N+    +    P+H A  +G   +V +L+ +   I+A  K  L P+H A   GH  +VE+L++    ++A   +G   IH+A +  + D  + L+  N +I+        P+H A   GH  +V++L+D  A  N  A + +   P+H A +  H+    +L+     +EA  ++    +H+A   GH  IVK L++   +  A  +K  +P+ +A ++   E+ + L Q   +  +    D+ P
Sbjct:   18 KGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPA--------LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFT--PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTP 414          

HSP 8 Score: 140.198 bits (352), Expect = 2.618e-33
Identity = 67/252 (26.59%), Postives = 123/252 (48.81%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H AC  G  D+V++L+ +  N     +    P+H+A       +VK+L+ +     +   N    +H A K+   EV   L+    N  +       PLHLA ++G  D+V LLI ++ N++  ++N   P+HL   +GH+ I   L  Q  ++ AA+++ + P+H AC  G  ++V  L+ ++  + +  +    P+H A  +GH +IV +L+ H         +G   + +A   GY  +  +L
Sbjct:  476 KGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 9 Score: 134.806 bits (338), Expect = 1.196e-31
Identity = 77/331 (23.26%), Postives = 150/331 (45.32%), Query Frame = 2
Query:  914 LIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            L+    D E   +     +H A   G ++VV  LIN   N+ A  +    PL++A ++ H ++V+ L++   N     ++   P+ +A  +GH  +V  L N         ++    +H A          +L+    + +   K    P+H+A    +  + ++L+N   ++     +G   +H+A  +G   + +LL+D    I+   +    P+H A   GH  +V++L+D    ++A  K    PIH A++  H++C + L+    +I+    +    +H+A   GH  +VK+L+       A  L G +P+ +A K      ++LL
Sbjct:    5 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLL 331          

HSP 10 Score: 114.39 bits (285), Expect = 2.873e-25
Identity = 66/267 (24.72%), Postives = 125/267 (46.82%), Query Frame = 2
Query: 1112 LIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            L+    +++   +  N  +H+A   G  K+V  L N   N+ A +Q  + P++ A  +   E+V  L+    +   P +    P+ +A  +GH+ +V +LIN+    +        A+H+A        A +L+ N+ + +V  +    P+H A    +  + QLL++   N+    K    P+H AS  G+V   ++L+ +   I+A  ++E   +H A   GH  +V++L+      +A T  G SPI +A +    + +  L Q
Sbjct:    5 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQ 267          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 198.364 bits (503), Expect = 1.548e-51
Identity = 104/379 (27.44%), Postives = 197/379 (51.98%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  +V++L++Q    +   +    PIH+A +  +   V+ L++   + +    ++  P+H A   GH  +VK+L+++     A   N   PLH+AC+K H   + LL+    +++A  ++   P+H+A   GHL IVK+L  +  +  A+N     P+H A   G  E+   L+     ++A  K +  P+H A   GHKE+V++L+ HK + ++    G   +H+A  +G+A   ++L+D N       +    P+H AC+ G  ++V+LL++   N  A  K    P+H A    +++  K+L+ K     + A+N   A+H+A ++   E+   L++   N  + +L+G +P+ LA +  + +++ LL
Sbjct:  279 LHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALL 657          

HSP 2 Score: 198.364 bits (503), Expect = 1.753e-51
Identity = 106/385 (27.53%), Postives = 196/385 (50.91%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ--KCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A    +  + ++L+N+  N     +    P+H+A  +G   +V++L+++    +A  ++   P+H A + GH  VV++L++Q   L+A  KN   P+H+A +  H D VR L+     ID    +   P+H+A   GH ++VK L ++  K N  A N   + P+H AC K     +++L+     +EA  +  L P+H+A   GH  IV+ L+       A +      +H+A   G+ ++AQ L+ NN  ++   +  + P+H A  MGH E+V+LL++   N ++       P+H A+  GH + T+IL+ +        +     +H+AC+ G  ++V+LL+    N  A    G +P+ +A      ++++LL
Sbjct:  209 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALN--GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL 591          

HSP 3 Score: 196.438 bits (498), Expect = 6.510e-51
Identity = 96/380 (25.26%), Postives = 189/380 (49.74%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H A F GH +IVK L+ +  +      K + P+H+A   G+ ++ + L++     +A  +++  P+H A + GHKE+VKLL+  K N ++       PLH+A  +GH    R+L+D+        +    P+H+AC  G + +V+ L  +  N  AA +    P+H A      ++V +L++K     +  +     +H+A  +   E+   L+ +  +  +    G   +HLA ++G  D+  LLI    ++ + ++    P+H   + GH  I  +L+    ++ A  +    P+H A   G+++  K L+ ++  + +  +     +H A ++GH +IV LL++       +T  G SP+ +A++     +I++LK
Sbjct:  411 LHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 790          

HSP 4 Score: 194.126 bits (492), Expect = 3.825e-50
Identity = 101/380 (26.58%), Postives = 185/380 (48.68%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A          +L+    N +  ++    P+H+A       + ++L+ +  +     +N   P+H A +RG+  +V+LL+++   ++A  K+   PLH A   GH  +V +L+DQ   + A  +N   PIH+A    H+  V+ L      I+     +  P+H A   G   +V +L+ K     A       P+H+AC K H   +++L+ H   +EA  + G   +H+A   G+ +I + L+         +   + P+H A   GH E+ Q L+  N  ++A  K ++ P+H A+  GH E  K+LM  K + ++        +H+A  +GHA+  ++L+  +     +T KG +P+ +A K  K +++ELL
Sbjct:  179 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 558          

HSP 5 Score: 191.815 bits (486), Expect = 2.088e-49
Identity = 108/413 (26.15%), Postives = 197/413 (47.70%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILI-----------------------------EQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K +  ++ A  E H ++VK L+    N     E    P+ +A ++G+E +V +LI                             +   + +   +    P+H A    +  V +LL+N+  N+    KN   PLH+A  +G+  +VRLL+D+   IDA  ++   P+H A   GH+++V+ L +Q   ++A  +    PIH A      + V  L+    +I+     +L P+H+A   GH  +V+VL++      A   +G+  +H+AC+K +     LL+ ++  +E   +    P+H A  MGH  IV+ L+    +  A +     P+H A+ AGH E  + L+     ++A A++++  +H A   GH E+VKLL+    N ++ T  G++P+ +A +    +   +L
Sbjct:  113 KGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRIL 525          

HSP 6 Score: 177.563 bits (449), Expect = 6.010e-45
Identity = 93/367 (25.34%), Postives = 172/367 (46.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +H A   GH  +VK+L+++       A     P+H+AC+K + + + +L++     EA  E+   P+H A   GH  +VK L+ +  +  A +   + PLH+A   GH ++ + L+     +DA  ++   P+H A   GH ++VK L   K N ++A      P+H A  +G  +   IL+ +        KK   P+H+AC  G  ++VE+L+    +  A   +G   +H+A      D+ +LL+          +     +H A +    E+   L+    N  +       P+H AS+ G  +   +L+ K+ ++    +N    +HL  ++GH  I  +LV+   +  A +  G +P+ +A
Sbjct:  345 LHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVA 711          

HSP 7 Score: 174.481 bits (441), Expect = 6.443e-44
Identity = 111/428 (25.93%), Postives = 197/428 (46.03%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQ----KCNIDA------------------NDQNSN-------RPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
             +H A  EGH  +V  L++   + ET  +K    +H+A   G EK+V  LI    +  A  +    P++ A +  H EVVK L+    N     ++   PL +A ++GH ++V LLI+     K  + A                  ND N +        P+H+A    +L + + L N+  N+    +    P+H A  +G   +V +L+ +   I+A  K  L P+H A   GH  +VE+L++    ++A   +G   IH+A +  + D  + L+  N +I+        P+H A   GH  +V++L+D  A  N  A + +   P+H A +  H+    +L+     +EA  ++    +H+A   GH  IVK L++   +  A  +K  +P+ +A ++   E+ + L Q   +  +    D+ P
Sbjct:   51 GLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFT--PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTP 476          

HSP 8 Score: 141.354 bits (355), Expect = 1.651e-33
Identity = 86/359 (23.96%), Postives = 158/359 (44.01%), Query Frame = 2
Query:  917 IEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILIT--KKCDIEAP---------------------------EKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            I+   D    ++N    +H A K GH ++V  L++   +LE   K     LH+A   G   +V  LI+   N++A  Q    P+++A  + HL++VK L     N     +  + P+  A  +G + +V +LI    K  +  P                            K    P+H+A    +  + ++L+N   ++     +G   +H+A  +G   + +LL+D    I+   +    P+H A   GH  +V++L+D    ++A  K    PIH A++  H++C + L+    +I+    +    +H+A   GH  +VK+L+       A  L G +P+ +A K      ++LL
Sbjct:   35 IKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLL 393          

HSP 9 Score: 129.798 bits (325), Expect = 6.103e-30
Identity = 78/312 (25.00%), Postives = 146/312 (46.79%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + G+ E     I    ++   ++N    LHLA ++GH  +V  L+    +++   +  N  +H+A   G  K+V  L N   N+ A +Q  + P++ A  +   E+V  L+    +   P +    P+ +A  +GH+ +V +LIN+    +        A+H+A        A +L+ N+ + +V  +    P+H A    +  + QLL++   N+    K    P+H AS  G+V   ++L+ +   I+A  ++E   +H A   GH  +V++L+      +A T  G SPI +A +    + +  L Q
Sbjct:   22 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQ 329          

HSP 10 Score: 56.9954 bits (136), Expect = 1.100e-7
Identity = 39/167 (23.35%), Postives = 73/167 (43.71%), Query Frame = 2
Query: 1424 CDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
              + +   D   +   A   G  + A   I N  DI + +Q     +H A + GH ++V  L+    ++E   K     +H A+ AG  +    L+    ++ A +Q     +++A ++ H E+VK L+    N    T  G +P+ +A +   + ++ LL    TK
Sbjct:    6 SSLSSPQADATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK 172          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Zebrafish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 195.667 bits (496), Expect = 1.509e-50
Identity = 95/380 (25.00%), Postives = 186/380 (48.95%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H + F GH +IVK+L+ +  +      K + P+H+A   G+ ++ + L++     +A  +++  P+H A + GH E+VKLL+  K N  +       PLH+A  +GHT    +L+D    +    +    P+H+A   G + +   L  +  N  AA ++   P+H A      ++VN+L++K     +  +    P+H+A  +   E+   L+ H     A    G   +HLA ++G  D+  LLI    ++ + ++    P+H   + GH  I  +L+    ++ A  +    P+H A   G+++  K L+ ++ ++    +     +H A ++GH +IV LL++       +T  G S + +A++     +I++LK
Sbjct:  408 LHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLKHGAQPNEVTSNGTSALAIAKRLGYISVIDVLK 787          

HSP 2 Score: 188.734 bits (478), Expect = 2.086e-48
Identity = 105/413 (25.42%), Postives = 198/413 (47.94%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILI-----------------------------EQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K +  ++ A  E H ++VK L++   N     E    P+ +A ++G+E +V +LI                             +   + +   +    P+H A    +  V +LL+N+  ++    KN   PLH+A  +G+  +VRLL+D+   IDA  ++   P+H A   GH++I++ L +Q   I+A  +    PIH A      + +  L+    +I+     +L P+H+A   GH  + +VL++          +G+  +H+AC+K +  +  LL+ ++  +E   +    P+H +  MGH  IV++L+    +  A +     P+H AS AGH E  + L+     ++A A++++  +H A   GH E+VKLL+    N+ + T  G++P+ +A +    +   +L
Sbjct:  110 KGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASIL 522          

HSP 3 Score: 186.422 bits (472), Expect = 1.018e-47
Identity = 95/383 (24.80%), Postives = 186/383 (48.56%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H AC + H  ++ +L+    + E   E    P+H++   G+  IVKIL+++     A +     P+H A + GH EV + L+     ++A  K++Q PLH A   GH ++V+LL++ K N ++     + P+H+A  +GH +    L +    +    +  + P+H A   G+ ++  +L+ +  +  A  K  L P+H+A    + ++V +L++      +   +G+  +H+A ++  A++A  L+ +             P+H A + G  ++V LLI    N+   +K    P+H  ++ GHV    IL+     + A  +     +H+AC  G+ ++VK L++   N    T    +P+  A +    +I+ LL
Sbjct:  371 GFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLL 753          

HSP 4 Score: 183.726 bits (465), Expect = 9.179e-47
Identity = 96/380 (25.26%), Postives = 179/380 (47.11%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A          +L+    N +  ++    P+H+A       + ++L+ +  D     +N   P+H A +RG+  +V+LL+++   ++A  K+   PLH A   GH  I+ +L+DQ   I A  +N   PIH+A    HL  ++ L      I+     +  P+H A   G   +  +L+ K             P+H+AC K H  ++++L+ H   +EA  + G   +H++   G+ +I ++L+         +   + P+H A   GH E+ + L+     ++A  K ++ P+H AS  GH E  K+L+  K +  +        +H+A  +GH +   +L+  +     +T KG +P+ +A K  K ++  LL
Sbjct:  176 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLL 555          

HSP 5 Score: 183.341 bits (464), Expect = 1.075e-46
Identity = 97/379 (25.59%), Postives = 189/379 (49.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  I+++L++Q    +   +    PIH+A +  +   ++ L++   + +    ++  P+H A   GH  V K+L+++         N   PLH+AC+K H  ++ LL+    +++A  ++   P+H++   GHL IVK L  +  +  A+N     P+H A   G  E+   L+     ++A  K +  P+H A   GH E+V++L+ HK +  +    G   +H+A  +G+   A +L+D N  +    +    P+H A + G  ++  LL++   N  A  K    P+H A    +++   +L+ K     + A+N    +H+A ++  AE+   L++   +  A +L+G +P+ LA +  + +++ LL
Sbjct:  276 LHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLL 654          

HSP 6 Score: 182.57 bits (462), Expect = 1.728e-46
Identity = 95/396 (23.99%), Postives = 189/396 (47.73%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            +H A   G+  +V++L+++    +   +    P+H A   G+ +I++IL++Q    +A  +N   PIH A +  H + ++ L+     ++    ++  PLH+A   GH  + ++L+D+    +    N   P+H+AC K H++++  L     ++EA  +    P+H + + G   IV IL+ K     A   K   P+H+A   GH E+ E L+ +   ++A   D    +H A   G+ ++ +LL+++  +          P+H A   GHT+   +L+D N  +    K    P+H A++ G V+   +L+ +  +  A  +     +H+A    + ++V LL+    +  +    G +P+ +A K  + E+   L Q      ++ +Q   P
Sbjct:  243 LHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTP 638          

HSP 7 Score: 179.489 bits (454), Expect = 1.912e-45
Identity = 94/385 (24.42%), Postives = 190/385 (49.35%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ--KCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A    + ++ ++L+N+  +     +    P+H+A  +G   +V++L+++    +A  ++   P+H A + GH  ++++L++Q   ++A  KN   P+H+A +  H D +R L+     ID    +   P+H+A   GH ++ K L ++  K N  A N   + P+H AC K    ++++L+     +EA  +  L P+H++   GH  IV++L+       A +      +H+A   G+ ++A+ L+ N   ++   +  + P+H A  MGH E+V+LL++   N  +       P+H A+  GH +   IL+     +    +     +H+A + G  ++  LL+    N  A    G +P+ +A      +++ LL
Sbjct:  206 GFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALN--GFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLL 588          

HSP 8 Score: 170.244 bits (430), Expect = 1.546e-42
Identity = 89/379 (23.48%), Postives = 177/379 (46.70%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            IH A    H D ++ L+      +     +  P+H+A   G+ ++ K+L+++         N   P+H ACK+ H  V+ LL+    +LEA  ++   PLH++   GH +IV++L+ +  + +A++     P+H+A   GH ++ + L      ++A  + +  P+H A   G  E+V +L+  K +  +       P+H+A  +GH +   +L++    +      G+  +H+A + G  D+A LL++   +     ++   P+H A    + ++V LL+    +  +  +    P+H AS+    E    L+       A +      +HLA ++G  ++V LL+    N       G +P+ L  +     I ++L
Sbjct:  309 IHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADIL 687          

HSP 9 Score: 163.31 bits (412), Expect = 2.424e-40
Identity = 98/401 (24.44%), Postives = 184/401 (45.89%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQ----KCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
             +H A  EGH  +V  L++     ET  +K    +H+A   G E++V  L+    +  A  +    P++ A +  H EVVK L++   N     ++   PL +A ++GH ++V LLI+     K  + A        +H+A      +    L     N +  ++  + P+H A       +  +L+ +  D+    K  + P+H+A  +G+  +V +L++    I+A   D    +H A   G+  I ++L+D    I+   +    PIH A +  H + ++ L+  N  I+     +  P+H A+  GH    K+L+ K       A N    +H+AC+K H  ++ LL++   + EA+T  G +P+ ++       I+++L Q      +  ++ E P
Sbjct:   48 GLHLASKEGHVKMVLELLHHGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTKGKVRLPA--------LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETP 440          

HSP 10 Score: 145.206 bits (365), Expect = 8.724e-35
Identity = 84/363 (23.14%), Postives = 163/363 (44.90%), Query Frame = 2
Query:  818 INQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            I    +  T  +     +HLA ++G+ K+V  L+      E   +     +H A   G ++VV  L+N   N+ A  +    PL++A ++ H ++V+ L+D   N     ++   P+ +A  +GH  +V  L N         ++    +H A          +L+    + +   K    P+H+A    +  + ++L+N   D+     +G   +H+A  +G   + +LL+D    I+   +    P+H A   GH  I+++L+D    I+A  K    PIH A++  H++C + L+    +I+    +    +H+A   GH  + K+L+          L G +P+ +A K     +++LL
Sbjct:   32 IKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHHGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLL 390          

HSP 11 Score: 133.265 bits (334), Expect = 5.657e-31
Identity = 64/252 (25.40%), Postives = 120/252 (47.62%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  D+  +L+ +  N     +    P+H+A       +V +L+ +     +   N   P+H A K+   EV   L+    +  A       PLHLA ++G  D+V LLI ++ N++  +++   P+HL   +GH+ I   L     ++ AA ++ + P+H AC  G  ++V  L+ ++ ++    + +  P+H A  +GH +IV +L+ H         +G  A+ +A   GY  +  +L
Sbjct:  535 KGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLKHGAQPNEVTSNGTSALAIAKRLGYISVIDVL 786          

HSP 12 Score: 54.299 bits (129), Expect = 8.412e-7
Identity = 35/138 (25.36%), Postives = 63/138 (45.65%), Query Frame = 2
Query: 1511 IDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            I N  DI   +Q     +H A + GH ++V  L+     +E   K     +H A+ AG  +    L+    ++ A +Q     +++A ++ H E+VK L+    N    T  G +P+ +A +   + ++ LL    TK
Sbjct:   32 IKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHHGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTK 169          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 194.512 bits (493), Expect = 2.660e-50
Identity = 95/380 (25.00%), Postives = 188/380 (49.47%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H A F GH +IVK L+ +  +      K + P+H+A   G+ ++ + L++     +A  +++  P+H A + GHKE+VKLL+  K N ++       PLH+A  +GH    R+L+D+        +    P+H+AC  G + + + L  +  N  AA +    P+H A      ++V +L++K     +  +     +H+A  +   E+   L+ +  +  +    G   +HLA ++G  D+  LLI    ++ + ++    P+H   + GH  I  +L+    ++ A  +    P+H A   G+++  K L+ ++  + +  +     +H A ++GH +IV LL++       +T  G SP+ +A++     +I++LK
Sbjct:  381 LHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 760          

HSP 2 Score: 186.422 bits (472), Expect = 9.351e-48
Identity = 101/391 (25.83%), Postives = 196/391 (50.13%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQ--------RPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A    +  + ++L+N+  N     + +          PIH+A +  +   V+ L++   + +    ++  P+H A   GH  +VK+L+++     A   N   PLH+AC+K H   + LL+    +++A  ++   P+H+A   GHL IVK+L  +  +  A+N     P+H A   G  E+   L+     ++A  K +  P+H A   GHKE+V++L+ HK + ++    G   +H+A  +G+A   ++L+D N       +    P+H AC+ G  ++ +LL++   N  A  K    P+H A    +++  K+L+ K     + A+N   A+H+A ++   E+   L++   N  + +L+G +P+ LA +  + +++ LL
Sbjct:  237 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALL 627          

HSP 3 Score: 177.178 bits (448), Expect = 9.723e-45
Identity = 104/429 (24.24%), Postives = 195/429 (45.45%), Query Frame = 2
Query:  689 FLLNKYKY*F*SEKSLSKLII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-----------------------------------ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
             LLN+      + K  S LI+      IH A    H D V+ L+      +     +  P+H+A   G+ ++VK+L+++     A   N   P+H ACK+ H   + LL+    +LEA  ++   PLH+A   GH +IV+ L+ +  + +A++     P+H+A   GH ++ + L      ++A  + +  P+H A   G KE+V +L+  K + ++       P+H+A  +GH +   +L++           G+  +H+AC+ G  D+A+LL++   +     +    P+H A    + ++V+LL+                                    AN N E+       P+H AS+ G  +   +L+ K+ ++    +N    +HL  ++GH  I  +LV+   +  A +  G +P+ +A
Sbjct:  255 LLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGIT--PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVA 681          

HSP 4 Score: 160.229 bits (404), Expect = 1.822e-39
Identity = 104/421 (24.70%), Postives = 185/421 (43.94%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDAND-----------------------------QNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQIN--------WRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K   A+H A   G   +V  LIN   N    ++K   P+++A ++ + ++VK L+E   +     E+   P+  A ++GH+ VV LLIN         K     LH+A     T    +L+    N D                                Q    P+H+A    +L + + L N+  N+    +++          PIH A      + V  L+    +I+     +L P+H+A   GH  +V+VL++      A   +G+  +H+AC+K +     LL+ ++  +E   +    P+H A  MGH  IV+ L+    +  A +     P+H A+ AGH E  + L+     ++A A++++  +H A   GH E+VKLL+    N ++ T  G++P+ +A +    +   +L
Sbjct:   79 KGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRIL 495          

HSP 5 Score: 157.147 bits (396), Expect = 1.909e-38
Identity = 98/421 (23.28%), Postives = 179/421 (42.52%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDK-----------------------------NNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQ--------NSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K +  ++ A  E H ++VK L+    N     E    P+ +A ++G+E +V +LI      +         +H A +        +L+    N +   K                                 PLH+A    +  + +LL+++  N++   +        N   PIH+A    H+  V+ L      I+     +  P+H A   G   +V +L+ K     A       P+H+AC K H   +++L+ H   +EA  + G   +H+A   G+ +I + L+         +   + P+H A   GH E+ Q L+  N  ++A  K ++ P+H A+  GH E  K+LM  K + ++        +H+A  +GHA+  ++L+  +     +T KG +P+ +A K  K ++ ELL
Sbjct:  112 KGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKV----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELL 528          

HSP 6 Score: 137.502 bits (345), Expect = 2.305e-32
Identity = 66/252 (26.19%), Postives = 122/252 (48.41%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H AC  G  D+ ++L+ +  N     +    P+H+A       +VK+L+ +     +   N    +H A K+   EV   L+    N  +       PLHLA ++G  D+V LLI ++ N++  ++N   P+HL   +GH+ I   L  Q  ++ AA+++ + P+H AC  G  ++V  L+ ++  + +  +    P+H A  +GH +IV +L+ H         +G   + +A   GY  +  +L
Sbjct:  508 KGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 759          

HSP 7 Score: 120.939 bits (302), Expect = 3.392e-27
Identity = 89/384 (23.18%), Postives = 158/384 (41.15%), Query Frame = 2
Query:  917 IEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACD-----------------------------DDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISK--------RPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            I+   D    ++N    +H A K GH ++V  L++   +LE   K     LH+A   G   +V  LI+   N++A  Q    P+++A  + HL++VK L     N     +  + P+  A  +G + +V +LI          K  L  +H+A          VL+ +  + +                                  G+  +H+A       +AQLL++   ++    ++S          PIH A +  H + V+ L+  N  I+     +  P+H A+  GH    K+L+ K     A A N    +H+AC+K H   + LL++   + EA+T  G +P+ +A       I++ L Q      +  ++ E P
Sbjct:   34 IKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETP 413          

HSP 8 Score: 115.161 bits (287), Expect = 2.064e-25
Identity = 85/402 (21.14%), Postives = 167/402 (41.54%), Query Frame = 2
Query:  869 IHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEK-----------------------------KNLRPIHLACGKGHKEIVEVLINHKCDIEACDD--------DGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            +HLA ++G+ K+V  L+    D E   +     +H A   G ++VV  LIN   N+ A  +    PL++A ++ H ++V+ L++   N     ++   P+ +A  +GH  +V  L N         ++    +H A          +L+    + +   K                                 P+H+A    +  + ++L+N   ++             +G   IH+A +  + D  + L+  N +I+        P+H A   GH  +V++L+D  A  N  A + +   P+H A +  H+    +L+     +EA  ++    +H+A   GH  IVK L++   +  A  +K  +P+ +A ++   E+ + L Q   +  +    D+ P
Sbjct:   51 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFT--PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTP 446          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 189.119 bits (479), Expect = 2.439e-48
Identity = 90/380 (23.68%), Postives = 184/380 (48.42%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L +   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q    +A   +   PLHL+  +GH D+  +L++   +     +    P+H+A   G +++VK L  +  + +AA +    P+H A     +++  +L+ K        K    P+H+A  K   +I   L+ +  D  A    G   +HLA ++G+ D+  LL+  + ++ V ++    P+H A +     + ++L +    I+   K    P+H AS  G+++    L+     + A  +N    +H A ++GH  I+ +L++   +   +T+ GN+ + +A +     +++ LK
Sbjct:  420 IHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLK 799          

HSP 2 Score: 182.956 bits (463), Expect = 1.953e-46
Identity = 101/412 (24.51%), Postives = 191/412 (46.36%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V +L+++     +  +N   P+H A +                                  GH +V K+L+++K N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+      +A    G+  +HL+  +G+ D+A +L+++     +  +    P+H A + G  E+V+LL+  N + +A  K    P+H A+   + +   +L+ K       A+N    +H+A +K   +I   L+    +  A+T +G +P+ LA +    +++ LL
Sbjct:  255 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLL 666          

HSP 3 Score: 181.8 bits (460), Expect = 4.784e-46
Identity = 104/415 (25.06%), Postives = 188/415 (45.30%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGH---------------------------------KEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L+++K N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH                                  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q    DA   +   P+HL+  +GH  +   L     +     +  + P+H A   G+ E+V +L+ K    +A  K  L P+H+A    ++++  +L++          +G+  +H+A +K   DIA  L++   D     +    P+H A + GH ++V LL+  + N+   +K    P+H A++   V   ++L  +   I+   +     +H+A   G+ ++V  L++      A T  G +P+  A +     II +L Q
Sbjct:  353 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 767          

HSP 4 Score: 175.252 bits (443), Expect = 5.572e-44
Identity = 99/413 (23.97%), Postives = 184/413 (44.55%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDK---------------------------------GHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A                                    GH K+ K L ++K N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH  IV  L +H       +  G  A+H+A   G +++ + L+ N   +E   +  + P+H +  +G  +IVQ L+      +A       P+H +S  GH +   +L+          +     +H+A + G  E+VKLL++ + + +A    G +P+ +A     Q++  LL
Sbjct:  188 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLL 600          

HSP 5 Score: 172.94 bits (437), Expect = 2.734e-43
Identity = 93/368 (25.27%), Postives = 180/368 (48.91%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            A+H A  EGH +IV  LI +  + +   +K    +H+A   G  ++V++L+    +  A  +N   P++ A +  H EVVK L++   +     ++   PL +A ++GH  +V LL++     D   +     +H+A  K   K    L     N +  ++  + P+H A   G   +  +L+ +   ++   + ++ P+H+A  +G+  +V++L++    I+A   DG   +H     G+  +  +L+D    I    +    P+H A +  H   VQLL+  N  ++         +H A+  GH +  K+L+ KK +  A A N    +H+AC+K   ++++LL++   + +A+T  G +PI +A
Sbjct:   60 ALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVA 423          

HSP 6 Score: 172.555 bits (436), Expect = 4.268e-43
Identity = 85/347 (24.50%), Postives = 166/347 (47.84%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G +++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q    +A   +   P+H + + GH +V  +L+    +     K    PLH+A + G  ++V+LL+ +  + DA  ++   P+H+A    + K+   L ++  +   A +  + P+H A  K Q +I   L+    D  A  K+ + P+HLA  +GH ++V +L+    ++   +  G   +HLA ++    +A++L +    I+   ++   P+H A   G+ ++V  L+     + A  K    P+H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  452 ALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 798          

HSP 7 Score: 168.318 bits (425), Expect = 7.520e-42
Identity = 88/379 (23.22%), Postives = 176/379 (46.44%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV  L     + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +    +A       P+HL+  +GH ++  VL+ H          G+  +H+A + G  ++ +LL+  N   +   +    P+H A    + ++  LL+D   +     K    P+H A++   ++    L+    D  A  +     +HLA ++GH ++V LL+    N       G +P+ LA +  +  + E+L
Sbjct:  321 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVL 699          

HSP 8 Score: 160.999 bits (406), Expect = 1.662e-39
Identity = 85/354 (24.01%), Postives = 174/354 (49.15%), Query Frame = 2
Query:  845 CAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            C +     +HLA ++G+ +IV  LI++  D +A  +     +H A   G  EVV++L+    N+ A  +N   PL++A ++ H ++V+ L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V +L+D    I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   53 CNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELL 402          

HSP 9 Score: 134.035 bits (336), Expect = 4.115e-31
Identity = 62/256 (24.22%), Postives = 123/256 (48.05%), Query Frame = 2
Query:  743 LII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            ++  K +  +H A   G  ++VK+L+ +  + +   +    P+H+A     +K+  +L+++        +N   P+H A K+   ++   L+    +  A  K    P+HLA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ   I+   ++ + P+H A   G  ++V  L+     + A  K    P+H A  +GH  I+ VL+ H         +G  A+ +A   GY  +   L
Sbjct:  543 IVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 798          

HSP 10 Score: 80.1073 bits (196), Expect = 1.672e-14
Identity = 43/151 (28.48%), Postives = 75/151 (49.67%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  + A   + N  DI +C+Q     +H A + GH EIV  LI    +++A  K     +H AS AG  E  ++L+    ++ A +QN    +++A ++ H E+VK L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   31 AARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 181          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 189.119 bits (479), Expect = 2.622e-48
Identity = 90/380 (23.68%), Postives = 184/380 (48.42%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L +   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q    +A   +   PLHL+  +GH D+  +L++   +     +    P+H+A   G +++VK L  +  + +AA +    P+H A     +++  +L+ K        K    P+H+A  K   +I   L+ +  D  A    G   +HLA ++G+ D+  LL+  + ++ V ++    P+H A +     + ++L +    I+   K    P+H AS  G+++    L+     + A  +N    +H A ++GH  I+ +L++   +   +T+ GN+ + +A +     +++ LK
Sbjct:  411 IHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLK 790          

HSP 2 Score: 182.956 bits (463), Expect = 2.212e-46
Identity = 101/412 (24.51%), Postives = 191/412 (46.36%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V +L+++     +  +N   P+H A +                                  GH +V K+L+++K N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+      +A    G+  +HL+  +G+ D+A +L+++     +  +    P+H A + G  E+V+LL+  N + +A  K    P+H A+   + +   +L+ K       A+N    +H+A +K   +I   L+    +  A+T +G +P+ LA +    +++ LL
Sbjct:  246 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLL 657          

HSP 3 Score: 181.415 bits (459), Expect = 5.965e-46
Identity = 104/415 (25.06%), Postives = 188/415 (45.30%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGH---------------------------------KEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L+++K N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH                                  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q    DA   +   P+HL+  +GH  +   L     +     +  + P+H A   G+ E+V +L+ K    +A  K  L P+H+A    ++++  +L++          +G+  +H+A +K   DIA  L++   D     +    P+H A + GH ++V LL+  + N+   +K    P+H A++   V   ++L  +   I+   +     +H+A   G+ ++V  L++      A T  G +P+  A +     II +L Q
Sbjct:  344 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 758          

HSP 4 Score: 175.252 bits (443), Expect = 6.137e-44
Identity = 99/413 (23.97%), Postives = 184/413 (44.55%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDK---------------------------------GHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A                                    GH K+ K L ++K N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH  IV  L +H       +  G  A+H+A   G +++ + L+ N   +E   +  + P+H +  +G  +IVQ L+      +A       P+H +S  GH +   +L+          +     +H+A + G  E+VKLL++ + + +A    G +P+ +A     Q++  LL
Sbjct:  179 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLL 591          

HSP 5 Score: 172.94 bits (437), Expect = 2.758e-43
Identity = 93/368 (25.27%), Postives = 180/368 (48.91%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            A+H A  EGH +IV  LI +  + +   +K    +H+A   G  ++V++L+    +  A  +N   P++ A +  H EVVK L++   +     ++   PL +A ++GH  +V LL++     D   +     +H+A  K   K    L     N +  ++  + P+H A   G   +  +L+ +   ++   + ++ P+H+A  +G+  +V++L++    I+A   DG   +H     G+  +  +L+D    I    +    P+H A +  H   VQLL+  N  ++         +H A+  GH +  K+L+ KK +  A A N    +H+AC+K   ++++LL++   + +A+T  G +PI +A
Sbjct:   51 ALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVA 414          

HSP 6 Score: 172.17 bits (435), Expect = 5.594e-43
Identity = 85/347 (24.50%), Postives = 166/347 (47.84%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G +++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q    +A   +   P+H + + GH +V  +L+    +     K    PLH+A + G  ++V+LL+ +  + DA  ++   P+H+A    + K+   L ++  +   A +  + P+H A  K Q +I   L+    D  A  K+ + P+HLA  +GH ++V +L+    ++   +  G   +HLA ++    +A++L +    I+   ++   P+H A   G+ ++V  L+     + A  K    P+H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  443 ALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 789          

HSP 7 Score: 168.318 bits (425), Expect = 7.783e-42
Identity = 88/379 (23.22%), Postives = 176/379 (46.44%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV  L     + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +    +A       P+HL+  +GH ++  VL+ H          G+  +H+A + G  ++ +LL+  N   +   +    P+H A    + ++  LL+D   +     K    P+H A++   ++    L+    D  A  +     +HLA ++GH ++V LL+    N       G +P+ LA +  +  + E+L
Sbjct:  312 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVL 690          

HSP 8 Score: 160.999 bits (406), Expect = 1.603e-39
Identity = 85/354 (24.01%), Postives = 174/354 (49.15%), Query Frame = 2
Query:  845 CAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            C +     +HLA ++G+ +IV  LI++  D +A  +     +H A   G  EVV++L+    N+ A  +N   PL++A ++ H ++V+ L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V +L+D    I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   44 CNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELL 393          

HSP 9 Score: 134.035 bits (336), Expect = 4.306e-31
Identity = 62/256 (24.22%), Postives = 123/256 (48.05%), Query Frame = 2
Query:  743 LII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            ++  K +  +H A   G  ++VK+L+ +  + +   +    P+H+A     +K+  +L+++        +N   P+H A K+   ++   L+    +  A  K    P+HLA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ   I+   ++ + P+H A   G  ++V  L+     + A  K    P+H A  +GH  I+ VL+ H         +G  A+ +A   GY  +   L
Sbjct:  534 IVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 789          

HSP 10 Score: 108.997 bits (271), Expect = 2.205e-23
Identity = 68/294 (23.13%), Postives = 136/294 (46.26%), Query Frame = 2
Query: 1118 DQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLI-------------------------------DANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            D  C  D +D N++     A   G+L+          +I   NQ     +H A  +G  EIV+ LI +  D++A  KK    +H+A   G  E+V VL+ +  ++ A   +G+  +++A ++ + ++ + L+DN     +  +    P+  A + GH ++V LL+                               D N ++E+  K    P+H A+  G++    +L+ +   ++  A+N+   +H+A ++G+A +VKLL+      +A T  G +P+    +S  ++++ +L
Sbjct:    5 DGDCLSDQSDTNAS--YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVES--KSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGML 294          

HSP 11 Score: 80.1073 bits (196), Expect = 1.660e-14
Identity = 43/151 (28.48%), Postives = 75/151 (49.67%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  + A   + N  DI +C+Q     +H A + GH EIV  LI    +++A  K     +H AS AG  E  ++L+    ++ A +QN    +++A ++ H E+VK L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   22 AARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 172          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 188.734 bits (478), Expect = 2.713e-48
Identity = 90/380 (23.68%), Postives = 184/380 (48.42%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L +   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q    +A   +   PLHL+  +GH D+  +L++   +     +    P+H+A   G +++VK L  +  + +AA +    P+H A     +++  +L+ K        K    P+H+A  K   +I   L+ +  D  A    G   +HLA ++G+ D+  LL+  + ++ V ++    P+H A +     + ++L +    I+   K    P+H AS  G+++    L+     + A  +N    +H A ++GH  I+ +L++   +   +T+ GN+ + +A +     +++ LK
Sbjct:  411 IHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLK 790          

HSP 2 Score: 182.956 bits (463), Expect = 2.309e-46
Identity = 101/412 (24.51%), Postives = 191/412 (46.36%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V +L+++     +  +N   P+H A +                                  GH +V K+L+++K N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+      +A    G+  +HL+  +G+ D+A +L+++     +  +    P+H A + G  E+V+LL+  N + +A  K    P+H A+   + +   +L+ K       A+N    +H+A +K   +I   L+    +  A+T +G +P+ LA +    +++ LL
Sbjct:  246 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLL 657          

HSP 3 Score: 181.415 bits (459), Expect = 5.557e-46
Identity = 104/415 (25.06%), Postives = 188/415 (45.30%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGH---------------------------------KEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L+++K N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH                                  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q    DA   +   P+HL+  +GH  +   L     +     +  + P+H A   G+ E+V +L+ K    +A  K  L P+H+A    ++++  +L++          +G+  +H+A +K   DIA  L++   D     +    P+H A + GH ++V LL+  + N+   +K    P+H A++   V   ++L  +   I+   +     +H+A   G+ ++V  L++      A T  G +P+  A +     II +L Q
Sbjct:  344 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 758          

HSP 4 Score: 175.252 bits (443), Expect = 6.190e-44
Identity = 99/413 (23.97%), Postives = 184/413 (44.55%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDK---------------------------------GHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A                                    GH K+ K L ++K N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH  IV  L +H       +  G  A+H+A   G +++ + L+ N   +E   +  + P+H +  +G  +IVQ L+      +A       P+H +S  GH +   +L+          +     +H+A + G  E+VKLL++ + + +A    G +P+ +A     Q++  LL
Sbjct:  179 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLL 591          

HSP 5 Score: 172.94 bits (437), Expect = 2.958e-43
Identity = 93/368 (25.27%), Postives = 180/368 (48.91%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            A+H A  EGH +IV  LI +  + +   +K    +H+A   G  ++V++L+    +  A  +N   P++ A +  H EVVK L++   +     ++   PL +A ++GH  +V LL++     D   +     +H+A  K   K    L     N +  ++  + P+H A   G   +  +L+ +   ++   + ++ P+H+A  +G+  +V++L++    I+A   DG   +H     G+  +  +L+D    I    +    P+H A +  H   VQLL+  N  ++         +H A+  GH +  K+L+ KK +  A A N    +H+AC+K   ++++LL++   + +A+T  G +PI +A
Sbjct:   51 ALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVA 414          

HSP 6 Score: 172.17 bits (435), Expect = 4.908e-43
Identity = 85/347 (24.50%), Postives = 166/347 (47.84%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G +++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q    +A   +   P+H + + GH +V  +L+    +     K    PLH+A + G  ++V+LL+ +  + DA  ++   P+H+A    + K+   L ++  +   A +  + P+H A  K Q +I   L+    D  A  K+ + P+HLA  +GH ++V +L+    ++   +  G   +HLA ++    +A++L +    I+   ++   P+H A   G+ ++V  L+     + A  K    P+H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  443 ALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 789          

HSP 7 Score: 168.318 bits (425), Expect = 7.992e-42
Identity = 88/379 (23.22%), Postives = 176/379 (46.44%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV  L     + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +    +A       P+HL+  +GH ++  VL+ H          G+  +H+A + G  ++ +LL+  N   +   +    P+H A    + ++  LL+D   +     K    P+H A++   ++    L+    D  A  +     +HLA ++GH ++V LL+    N       G +P+ LA +  +  + E+L
Sbjct:  312 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVL 690          

HSP 8 Score: 160.999 bits (406), Expect = 1.908e-39
Identity = 85/354 (24.01%), Postives = 174/354 (49.15%), Query Frame = 2
Query:  845 CAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            C +     +HLA ++G+ +IV  LI++  D +A  +     +H A   G  EVV++L+    N+ A  +N   PL++A ++ H ++V+ L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V +L+D    I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   44 CNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELL 393          

HSP 9 Score: 133.65 bits (335), Expect = 4.671e-31
Identity = 62/256 (24.22%), Postives = 123/256 (48.05%), Query Frame = 2
Query:  743 LII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            ++  K +  +H A   G  ++VK+L+ +  + +   +    P+H+A     +K+  +L+++        +N   P+H A K+   ++   L+    +  A  K    P+HLA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ   I+   ++ + P+H A   G  ++V  L+     + A  K    P+H A  +GH  I+ VL+ H         +G  A+ +A   GY  +   L
Sbjct:  534 IVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 789          

HSP 10 Score: 108.997 bits (271), Expect = 2.358e-23
Identity = 68/294 (23.13%), Postives = 136/294 (46.26%), Query Frame = 2
Query: 1118 DQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLI-------------------------------DANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            D  C  D +D N++     A   G+L+          +I   NQ     +H A  +G  EIV+ LI +  D++A  KK    +H+A   G  E+V VL+ +  ++ A   +G+  +++A ++ + ++ + L+DN     +  +    P+  A + GH ++V LL+                               D N ++E+  K    P+H A+  G++    +L+ +   ++  A+N+   +H+A ++G+A +VKLL+      +A T  G +P+    +S  ++++ +L
Sbjct:    5 DGDCLSDQSDTNAS--YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVES--KSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGML 294          

HSP 11 Score: 80.1073 bits (196), Expect = 1.678e-14
Identity = 43/151 (28.48%), Postives = 75/151 (49.67%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  + A   + N  DI +C+Q     +H A + GH EIV  LI    +++A  K     +H AS AG  E  ++L+    ++ A +QN    +++A ++ H E+VK L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   22 AARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 172          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 188.734 bits (478), Expect = 3.039e-48
Identity = 90/380 (23.68%), Postives = 184/380 (48.42%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L +   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q    +A   +   PLHL+  +GH D+  +L++   +     +    P+H+A   G +++VK L  +  + +AA +    P+H A     +++  +L+ K        K    P+H+A  K   +I   L+ +  D  A    G   +HLA ++G+ D+  LL+  + ++ V ++    P+H A +     + ++L +    I+   K    P+H AS  G+++    L+     + A  +N    +H A ++GH  I+ +L++   +   +T+ GN+ + +A +     +++ LK
Sbjct:  422 IHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLK 801          

HSP 2 Score: 182.57 bits (462), Expect = 2.409e-46
Identity = 101/412 (24.51%), Postives = 191/412 (46.36%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V +L+++     +  +N   P+H A +                                  GH +V K+L+++K N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+      +A    G+  +HL+  +G+ D+A +L+++     +  +    P+H A + G  E+V+LL+  N + +A  K    P+H A+   + +   +L+ K       A+N    +H+A +K   +I   L+    +  A+T +G +P+ LA +    +++ LL
Sbjct:  257 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLL 668          

HSP 3 Score: 181.415 bits (459), Expect = 6.272e-46
Identity = 104/415 (25.06%), Postives = 188/415 (45.30%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGH---------------------------------KEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L+++K N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH                                  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q    DA   +   P+HL+  +GH  +   L     +     +  + P+H A   G+ E+V +L+ K    +A  K  L P+H+A    ++++  +L++          +G+  +H+A +K   DIA  L++   D     +    P+H A + GH ++V LL+  + N+   +K    P+H A++   V   ++L  +   I+   +     +H+A   G+ ++V  L++      A T  G +P+  A +     II +L Q
Sbjct:  355 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 769          

HSP 4 Score: 174.866 bits (442), Expect = 7.040e-44
Identity = 99/413 (23.97%), Postives = 184/413 (44.55%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDK---------------------------------GHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A                                    GH K+ K L ++K N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH  IV  L +H       +  G  A+H+A   G +++ + L+ N   +E   +  + P+H +  +G  +IVQ L+      +A       P+H +S  GH +   +L+          +     +H+A + G  E+VKLL++ + + +A    G +P+ +A     Q++  LL
Sbjct:  190 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLL 602          

HSP 5 Score: 172.94 bits (437), Expect = 3.392e-43
Identity = 93/368 (25.27%), Postives = 180/368 (48.91%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            A+H A  EGH +IV  LI +  + +   +K    +H+A   G  ++V++L+    +  A  +N   P++ A +  H EVVK L++   +     ++   PL +A ++GH  +V LL++     D   +     +H+A  K   K    L     N +  ++  + P+H A   G   +  +L+ +   ++   + ++ P+H+A  +G+  +V++L++    I+A   DG   +H     G+  +  +L+D    I    +    P+H A +  H   VQLL+  N  ++         +H A+  GH +  K+L+ KK +  A A N    +H+AC+K   ++++LL++   + +A+T  G +PI +A
Sbjct:   62 ALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVA 425          

HSP 6 Score: 172.17 bits (435), Expect = 5.726e-43
Identity = 85/347 (24.50%), Postives = 166/347 (47.84%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G +++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q    +A   +   P+H + + GH +V  +L+    +     K    PLH+A + G  ++V+LL+ +  + DA  ++   P+H+A    + K+   L ++  +   A +  + P+H A  K Q +I   L+    D  A  K+ + P+HLA  +GH ++V +L+    ++   +  G   +HLA ++    +A++L +    I+   ++   P+H A   G+ ++V  L+     + A  K    P+H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  454 ALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 800          

HSP 7 Score: 168.318 bits (425), Expect = 9.399e-42
Identity = 88/379 (23.22%), Postives = 176/379 (46.44%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV  L     + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +    +A       P+HL+  +GH ++  VL+ H          G+  +H+A + G  ++ +LL+  N   +   +    P+H A    + ++  LL+D   +     K    P+H A++   ++    L+    D  A  +     +HLA ++GH ++V LL+    N       G +P+ LA +  +  + E+L
Sbjct:  323 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVL 701          

HSP 8 Score: 160.614 bits (405), Expect = 2.019e-39
Identity = 85/354 (24.01%), Postives = 174/354 (49.15%), Query Frame = 2
Query:  845 CAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            C +     +HLA ++G+ +IV  LI++  D +A  +     +H A   G  EVV++L+    N+ A  +N   PL++A ++ H ++V+ L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V +L+D    I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   55 CNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELL 404          

HSP 9 Score: 134.035 bits (336), Expect = 4.672e-31
Identity = 62/256 (24.22%), Postives = 123/256 (48.05%), Query Frame = 2
Query:  743 LII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            ++  K +  +H A   G  ++VK+L+ +  + +   +    P+H+A     +K+  +L+++        +N   P+H A K+   ++   L+    +  A  K    P+HLA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ   I+   ++ + P+H A   G  ++V  L+     + A  K    P+H A  +GH  I+ VL+ H         +G  A+ +A   GY  +   L
Sbjct:  545 IVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 800          

HSP 10 Score: 79.7221 bits (195), Expect = 1.842e-14
Identity = 43/151 (28.48%), Postives = 75/151 (49.67%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  + A   + N  DI +C+Q     +H A + GH EIV  LI    +++A  K     +H AS AG  E  ++L+    ++ A +QN    +++A ++ H E+VK L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   33 AARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 183          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 188.734 bits (478), Expect = 3.115e-48
Identity = 90/380 (23.68%), Postives = 184/380 (48.42%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L +   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q    +A   +   PLHL+  +GH D+  +L++   +     +    P+H+A   G +++VK L  +  + +AA +    P+H A     +++  +L+ K        K    P+H+A  K   +I   L+ +  D  A    G   +HLA ++G+ D+  LL+  + ++ V ++    P+H A +     + ++L +    I+   K    P+H AS  G+++    L+     + A  +N    +H A ++GH  I+ +L++   +   +T+ GN+ + +A +     +++ LK
Sbjct:  411 IHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLK 790          

HSP 2 Score: 182.57 bits (462), Expect = 2.558e-46
Identity = 101/412 (24.51%), Postives = 191/412 (46.36%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V +L+++     +  +N   P+H A +                                  GH +V K+L+++K N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+      +A    G+  +HL+  +G+ D+A +L+++     +  +    P+H A + G  E+V+LL+  N + +A  K    P+H A+   + +   +L+ K       A+N    +H+A +K   +I   L+    +  A+T +G +P+ LA +    +++ LL
Sbjct:  246 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLL 657          

HSP 3 Score: 181.415 bits (459), Expect = 6.487e-46
Identity = 104/415 (25.06%), Postives = 188/415 (45.30%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGH---------------------------------KEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L+++K N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH                                  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q    DA   +   P+HL+  +GH  +   L     +     +  + P+H A   G+ E+V +L+ K    +A  K  L P+H+A    ++++  +L++          +G+  +H+A +K   DIA  L++   D     +    P+H A + GH ++V LL+  + N+   +K    P+H A++   V   ++L  +   I+   +     +H+A   G+ ++V  L++      A T  G +P+  A +     II +L Q
Sbjct:  344 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 758          

HSP 4 Score: 174.866 bits (442), Expect = 6.852e-44
Identity = 99/413 (23.97%), Postives = 184/413 (44.55%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDK---------------------------------GHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A                                    GH K+ K L ++K N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH  IV  L +H       +  G  A+H+A   G +++ + L+ N   +E   +  + P+H +  +G  +IVQ L+      +A       P+H +S  GH +   +L+          +     +H+A + G  E+VKLL++ + + +A    G +P+ +A     Q++  LL
Sbjct:  179 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLL 591          

HSP 5 Score: 172.94 bits (437), Expect = 3.189e-43
Identity = 93/368 (25.27%), Postives = 180/368 (48.91%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            A+H A  EGH +IV  LI +  + +   +K    +H+A   G  ++V++L+    +  A  +N   P++ A +  H EVVK L++   +     ++   PL +A ++GH  +V LL++     D   +     +H+A  K   K    L     N +  ++  + P+H A   G   +  +L+ +   ++   + ++ P+H+A  +G+  +V++L++    I+A   DG   +H     G+  +  +L+D    I    +    P+H A +  H   VQLL+  N  ++         +H A+  GH +  K+L+ KK +  A A N    +H+AC+K   ++++LL++   + +A+T  G +PI +A
Sbjct:   51 ALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVA 414          

HSP 6 Score: 172.17 bits (435), Expect = 5.824e-43
Identity = 85/347 (24.50%), Postives = 166/347 (47.84%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G +++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q    +A   +   P+H + + GH +V  +L+    +     K    PLH+A + G  ++V+LL+ +  + DA  ++   P+H+A    + K+   L ++  +   A +  + P+H A  K Q +I   L+    D  A  K+ + P+HLA  +GH ++V +L+    ++   +  G   +HLA ++    +A++L +    I+   ++   P+H A   G+ ++V  L+     + A  K    P+H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  443 ALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 789          

HSP 7 Score: 168.318 bits (425), Expect = 8.318e-42
Identity = 88/379 (23.22%), Postives = 176/379 (46.44%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV  L     + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +    +A       P+HL+  +GH ++  VL+ H          G+  +H+A + G  ++ +LL+  N   +   +    P+H A    + ++  LL+D   +     K    P+H A++   ++    L+    D  A  +     +HLA ++GH ++V LL+    N       G +P+ LA +  +  + E+L
Sbjct:  312 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVL 690          

HSP 8 Score: 160.999 bits (406), Expect = 1.743e-39
Identity = 85/354 (24.01%), Postives = 174/354 (49.15%), Query Frame = 2
Query:  845 CAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            C +     +HLA ++G+ +IV  LI++  D +A  +     +H A   G  EVV++L+    N+ A  +N   PL++A ++ H ++V+ L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V +L+D    I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   44 CNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELL 393          

HSP 9 Score: 133.65 bits (335), Expect = 4.853e-31
Identity = 62/256 (24.22%), Postives = 123/256 (48.05%), Query Frame = 2
Query:  743 LII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            ++  K +  +H A   G  ++VK+L+ +  + +   +    P+H+A     +K+  +L+++        +N   P+H A K+   ++   L+    +  A  K    P+HLA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ   I+   ++ + P+H A   G  ++V  L+     + A  K    P+H A  +GH  I+ VL+ H         +G  A+ +A   GY  +   L
Sbjct:  534 IVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 789          

HSP 10 Score: 108.997 bits (271), Expect = 2.285e-23
Identity = 68/294 (23.13%), Postives = 136/294 (46.26%), Query Frame = 2
Query: 1118 DQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLI-------------------------------DANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            D  C  D +D N++     A   G+L+          +I   NQ     +H A  +G  EIV+ LI +  D++A  KK    +H+A   G  E+V VL+ +  ++ A   +G+  +++A ++ + ++ + L+DN     +  +    P+  A + GH ++V LL+                               D N ++E+  K    P+H A+  G++    +L+ +   ++  A+N+   +H+A ++G+A +VKLL+      +A T  G +P+    +S  ++++ +L
Sbjct:    5 DGDCLSDQSDTNAS--YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVES--KSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGML 294          

HSP 11 Score: 80.1073 bits (196), Expect = 1.625e-14
Identity = 43/151 (28.48%), Postives = 75/151 (49.67%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  + A   + N  DI +C+Q     +H A + GH EIV  LI    +++A  K     +H AS AG  E  ++L+    ++ A +QN    +++A ++ H E+VK L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   22 AARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 172          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 198.364 bits (503), Expect = 1.572e-51
Identity = 91/380 (23.95%), Postives = 188/380 (49.47%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L++   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q  +  A   +   PLHLA  +GH D+   L+D   ++    +    P+H+A   G L++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   +I   L+ +  D  A    G  ++HLA ++G+ D+  LL+  N ++ + ++    P+H A +     + ++L++   +++A  K    P+H     G+++    L+     + A  +N   A+H A ++GH  I+ +L++ + +   LT+ GN+ + +A +     +++ LK
Sbjct:  420 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 2 Score: 187.963 bits (476), Expect = 3.242e-48
Identity = 95/383 (24.80%), Postives = 188/383 (49.09%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A   +   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K L ++K +  A     + P+H AC K +  ++ +L+     I+A  +  L PIH+A   GH  IV  L++H       +  G  A+H+A   G A++ + L+ +   +E   +  + P+H +  +G  +IVQ L+    +  A       P+H A+  GH +    L+     +    +     +H+A + G  E+  LL++   + +A    G +P+ +A     Q++  LL
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLL 600          

HSP 3 Score: 181.415 bits (459), Expect = 4.472e-46
Identity = 95/385 (24.68%), Postives = 182/385 (47.27%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+  IV  L+         +      +H A + G  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q  + +A   +   P+HLA  +GH  +   L +   ++    +  + P+H A   G+ E+ ++L+ K    +A  K  L P+H+A    ++++  +L++      A   +G+  +H+A +K   DIA  L++   D     +     +H A + GH ++V LL+  N N+   +K    P+H A++   V   ++L+ +   ++A  +     +H+ C  G+ +IV  L++      A T  G + +  A +     II +L Q
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 767          

HSP 4 Score: 178.718 bits (452), Expect = 3.247e-45
Identity = 99/412 (24.03%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V++L+++     +  +N   P+H A +                                  GH +V K+L+++K +  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+       A    G+  +HLA  +G+ D+A  L+D+   + +  +    P+H A + G  E+  LL+  + + +A  K    P+H A+   + +   +L+ +     A A+N    +H+A +K   +I   L+    +  A+T +G + + LA +    +++ LL
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 666          

HSP 5 Score: 176.792 bits (447), Expect = 1.403e-44
Identity = 86/347 (24.78%), Postives = 168/347 (48.41%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G A++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q     A   +   P+H A + GH++V   L++   +L    K    PLH+A + G  ++  LL+ +  + DA  ++   P+H+A    + K+   L +Q  +  AA +  + P+H A  K Q +I   L+    D  A  ++ +  +HLA  +GH ++V +L++   ++   +  G   +HLA ++   ++A++L++    ++   ++   P+H  C  G+ +IV  L+  +  + A  K     +H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  452 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 6 Score: 176.792 bits (447), Expect = 1.415e-44
Identity = 94/382 (24.61%), Postives = 175/382 (45.81%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A    HL  V+ L      ++         +H A   G  ++  +L+ KK    A       P+H+AC K    ++E+L+ H   I+A  + G   IH+A   G+ +I   L+ +       +   +  +H A   G  E+V+ L+     +EA  K ++ P+H ++  G  +  + L+ +     A   +    +HLA  +GH ++   L+    +    T KG +P+ +A K  K E+  LL Q
Sbjct:  188 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQ 569          

HSP 7 Score: 176.407 bits (446), Expect = 1.792e-44
Identity = 96/428 (22.43%), Postives = 200/428 (46.73%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLID-----------------------------QKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  EGH ++V  L+ ++ N +   +K    +H+A   G  ++VK+L+    +  A  +N   P++ A +  H EVV+ L++   +     ++   PL +A ++GH  +V LL++                                N D   ++   P+H+A   G++ +   L N+   ++   + +  P+H A  +G   +V +L+ +   I+A  +  L P+H     GH+++VE+L++    I +   +G   +H+A +  + +  QLL+ +N  ++         +H A   GH ++ ++L+D  A+ N +A + +   P+H A +   +   ++L+     I+A  ++    IH+A   GH  IV  L+    +     ++G + + +A +S + E++  L Q   + ++    D+ P
Sbjct:   60 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFT--PLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTP 485          

HSP 8 Score: 174.096 bits (440), Expect = 8.807e-44
Identity = 89/379 (23.48%), Postives = 179/379 (47.23%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K    A   N   P+H ACK+    V++LL+    +++A  ++   P+H+A   GH +IV  L+    + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +     A       P+HLA  +GH+++   L++H   +      G+  +H+A + G  ++A LL+  +   +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   ++    L+    D  A  +    ++HLA ++GH ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  321 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVL 699          

HSP 9 Score: 169.474 bits (428), Expect = 2.452e-42
Identity = 84/365 (23.01%), Postives = 169/365 (46.30%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPI 1861
            A+H A   GH  + K+L+++K +    A     P+H+AC+K   +++++L++     +A  E+   PIH A   GH  +V  L++   +    +   +  LH+A   G  ++VR L+     ++A  ++   P+H++   G   IV+ L  Q  +  AA    + P+H A  +G +++   L+     +    KK   P+H+A   G  E+  +L+      +A    G   +H+A       +A LL+D         +    P+H A +    +I   L++   +  A  +     +H A++ GHV+   +L+ +  ++    ++    +HLA ++    + ++LV    + +A T  G +P+
Sbjct:  353 ALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL 717          

HSP 10 Score: 162.925 bits (411), Expect = 2.767e-40
Identity = 87/376 (23.14%), Postives = 182/376 (48.40%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   GH +     I    +   C +     +HLA ++G+ ++V  L++++ + +A  +     +H A   G  EVVK+L+    N+ A  +N   PL++A ++ H ++VR L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V++L+D +  I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    +  A  L G +P+ +A K  +  ++ELL
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELL 402          

HSP 11 Score: 135.191 bits (339), Expect = 1.262e-31
Identity = 78/315 (24.76%), Postives = 150/315 (47.62%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDG---WRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + GH E     I    ++  C++N    LHLA ++GH ++V  L+ ++ N+DA  +  N  +H+A   G  ++VK L     N+ A +Q  + P++ A  +   E+V  L+          +    P+ +A  +GH ++V +L+ +       D  G     A+H+A  K     A LL+ N+ + +V  +    P+H A   G+  +  LL++    ++   + +  P+H AS+ G+    K+L+ +   I+A  ++    +H     GH ++V++L+       + T  G SP+ +A +      ++LL Q
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN-------DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 338          

HSP 12 Score: 131.339 bits (329), Expect = 1.997e-30
Identity = 67/284 (23.59%), Postives = 128/284 (45.07%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLH---------------------------------LACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
             +  +H A  EGH D+   L++   +     +K   P+H+A + G  ++  +L+++    +A  ++   P+H A    +++V  LL++Q  +  A  KN   PLH                                 LA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ  +++A  ++ + P+H  C  G  +IVN L+     + A  K     +H A  +GH  I+ VL+ +         +G  A+ +A   GY  +   L
Sbjct:  515 GYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 13 Score: 81.6481 bits (200), Expect = 4.194e-15
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G+ + A   I N  D+ +C+Q     +H A + GH E+V  L+    N++A  K     +H AS AG  E  K+L+    ++ A +QN    +++A ++ H E+V+ L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 181          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 197.978 bits (502), Expect = 2.117e-51
Identity = 91/380 (23.95%), Postives = 188/380 (49.47%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L++   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q  +  A   +   PLHLA  +GH D+   L+D   ++    +    P+H+A   G L++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   +I   L+ +  D  A    G  ++HLA ++G+ D+  LL+  N ++ + ++    P+H A +     + ++L++   +++A  K    P+H     G+++    L+     + A  +N   A+H A ++GH  I+ +L++ + +   LT+ GN+ + +A +     +++ LK
Sbjct:  431 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 810          

HSP 2 Score: 187.963 bits (476), Expect = 3.952e-48
Identity = 95/383 (24.80%), Postives = 188/383 (49.09%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A   +   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K L ++K +  A     + P+H AC K +  ++ +L+     I+A  +  L PIH+A   GH  IV  L++H       +  G  A+H+A   G A++ + L+ +   +E   +  + P+H +  +G  +IVQ L+    +  A       P+H A+  GH +    L+     +    +     +H+A + G  E+  LL++   + +A    G +P+ +A     Q++  LL
Sbjct:  229 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLL 611          

HSP 3 Score: 181.03 bits (458), Expect = 5.689e-46
Identity = 95/385 (24.68%), Postives = 182/385 (47.27%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+  IV  L+         +      +H A + G  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q  + +A   +   P+HLA  +GH  +   L +   ++    +  + P+H A   G+ E+ ++L+ K    +A  K  L P+H+A    ++++  +L++      A   +G+  +H+A +K   DIA  L++   D     +     +H A + GH ++V LL+  N N+   +K    P+H A++   V   ++L+ +   ++A  +     +H+ C  G+ +IV  L++      A T  G + +  A +     II +L Q
Sbjct:  394 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 778          

HSP 4 Score: 178.333 bits (451), Expect = 4.202e-45
Identity = 99/412 (24.03%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V++L+++     +  +N   P+H A +                                  GH +V K+L+++K +  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+       A    G+  +HLA  +G+ D+A  L+D+   + +  +    P+H A + G  E+  LL+  + + +A  K    P+H A+   + +   +L+ +     A A+N    +H+A +K   +I   L+    +  A+T +G + + LA +    +++ LL
Sbjct:  266 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 677          

HSP 5 Score: 176.407 bits (446), Expect = 1.706e-44
Identity = 94/382 (24.61%), Postives = 175/382 (45.81%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A    HL  V+ L      ++         +H A   G  ++  +L+ KK    A       P+H+AC K    ++E+L+ H   I+A  + G   IH+A   G+ +I   L+ +       +   +  +H A   G  E+V+ L+     +EA  K ++ P+H ++  G  +  + L+ +     A   +    +HLA  +GH ++   L+    +    T KG +P+ +A K  K E+  LL Q
Sbjct:  199 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQ 580          

HSP 6 Score: 176.407 bits (446), Expect = 1.798e-44
Identity = 86/347 (24.78%), Postives = 168/347 (48.41%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G A++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q     A   +   P+H A + GH++V   L++   +L    K    PLH+A + G  ++  LL+ +  + DA  ++   P+H+A    + K+   L +Q  +  AA +  + P+H A  K Q +I   L+    D  A  ++ +  +HLA  +GH ++V +L++   ++   +  G   +HLA ++   ++A++L++    ++   ++   P+H  C  G+ +IV  L+  +  + A  K     +H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  463 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 809          

HSP 7 Score: 176.022 bits (445), Expect = 2.180e-44
Identity = 96/428 (22.43%), Postives = 200/428 (46.73%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLID-----------------------------QKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  EGH ++V  L+ ++ N +   +K    +H+A   G  ++VK+L+    +  A  +N   P++ A +  H EVV+ L++   +     ++   PL +A ++GH  +V LL++                                N D   ++   P+H+A   G++ +   L N+   ++   + +  P+H A  +G   +V +L+ +   I+A  +  L P+H     GH+++VE+L++    I +   +G   +H+A +  + +  QLL+ +N  ++         +H A   GH ++ ++L+D  A+ N +A + +   P+H A +   +   ++L+     I+A  ++    IH+A   GH  IV  L+    +     ++G + + +A +S + E++  L Q   + ++    D+ P
Sbjct:   71 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFT--PLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTP 496          

HSP 8 Score: 173.711 bits (439), Expect = 1.099e-43
Identity = 89/379 (23.48%), Postives = 179/379 (47.23%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K    A   N   P+H ACK+    V++LL+    +++A  ++   P+H+A   GH +IV  L+    + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +     A       P+HLA  +GH+++   L++H   +      G+  +H+A + G  ++A LL+  +   +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   ++    L+    D  A  +    ++HLA ++GH ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  332 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVL 710          

HSP 9 Score: 169.088 bits (427), Expect = 3.366e-42
Identity = 84/365 (23.01%), Postives = 169/365 (46.30%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPI 1861
            A+H A   GH  + K+L+++K +    A     P+H+AC+K   +++++L++     +A  E+   PIH A   GH  +V  L++   +    +   +  LH+A   G  ++VR L+     ++A  ++   P+H++   G   IV+ L  Q  +  AA    + P+H A  +G +++   L+     +    KK   P+H+A   G  E+  +L+      +A    G   +H+A       +A LL+D         +    P+H A +    +I   L++   +  A  +     +H A++ GHV+   +L+ +  ++    ++    +HLA ++    + ++LV    + +A T  G +P+
Sbjct:  364 ALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL 728          

HSP 10 Score: 162.54 bits (410), Expect = 3.538e-40
Identity = 87/376 (23.14%), Postives = 182/376 (48.40%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   GH +     I    +   C +     +HLA ++G+ ++V  L++++ + +A  +     +H A   G  EVVK+L+    N+ A  +N   PL++A ++ H ++VR L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V++L+D +  I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    +  A  L G +P+ +A K  +  ++ELL
Sbjct:   42 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELL 413          

HSP 11 Score: 135.191 bits (339), Expect = 1.352e-31
Identity = 78/315 (24.76%), Postives = 150/315 (47.62%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDG---WRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + GH E     I    ++  C++N    LHLA ++GH ++V  L+ ++ N+DA  +  N  +H+A   G  ++VK L     N+ A +Q  + P++ A  +   E+V  L+          +    P+ +A  +GH ++V +L+ +       D  G     A+H+A  K     A LL+ N+ + +V  +    P+H A   G+  +  LL++    ++   + +  P+H AS+ G+    K+L+ +   I+A  ++    +H     GH ++V++L+       + T  G SP+ +A +      ++LL Q
Sbjct:   42 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN-------DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 349          

HSP 12 Score: 130.954 bits (328), Expect = 2.350e-30
Identity = 67/284 (23.59%), Postives = 128/284 (45.07%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLH---------------------------------LACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
             +  +H A  EGH D+   L++   +     +K   P+H+A + G  ++  +L+++    +A  ++   P+H A    +++V  LL++Q  +  A  KN   PLH                                 LA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ  +++A  ++ + P+H  C  G  +IVN L+     + A  K     +H A  +GH  I+ VL+ +         +G  A+ +A   GY  +   L
Sbjct:  526 GYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 809          

HSP 13 Score: 81.2629 bits (199), Expect = 4.867e-15
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G+ + A   I N  D+ +C+Q     +H A + GH E+V  L+    N++A  K     +H AS AG  E  K+L+    ++ A +QN    +++A ++ H E+V+ L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   42 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 192          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 197.978 bits (502), Expect = 2.773e-51
Identity = 91/380 (23.95%), Postives = 188/380 (49.47%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L++   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q  +  A   +   PLHLA  +GH D+   L+D   ++    +    P+H+A   G L++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   +I   L+ +  D  A    G  ++HLA ++G+ D+  LL+  N ++ + ++    P+H A +     + ++L++   +++A  K    P+H     G+++    L+     + A  +N   A+H A ++GH  I+ +L++ + +   LT+ GN+ + +A +     +++ LK
Sbjct:  420 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 2 Score: 187.578 bits (475), Expect = 5.024e-48
Identity = 95/383 (24.80%), Postives = 188/383 (49.09%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A   +   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K L ++K +  A     + P+H AC K +  ++ +L+     I+A  +  L PIH+A   GH  IV  L++H       +  G  A+H+A   G A++ + L+ +   +E   +  + P+H +  +G  +IVQ L+    +  A       P+H A+  GH +    L+     +    +     +H+A + G  E+  LL++   + +A    G +P+ +A     Q++  LL
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLL 600          

HSP 3 Score: 180.644 bits (457), Expect = 7.472e-46
Identity = 95/385 (24.68%), Postives = 182/385 (47.27%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+  IV  L+         +      +H A + G  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q  + +A   +   P+HLA  +GH  +   L +   ++    +  + P+H A   G+ E+ ++L+ K    +A  K  L P+H+A    ++++  +L++      A   +G+  +H+A +K   DIA  L++   D     +     +H A + GH ++V LL+  N N+   +K    P+H A++   V   ++L+ +   ++A  +     +H+ C  G+ +IV  L++      A T  G + +  A +     II +L Q
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 767          

HSP 4 Score: 178.333 bits (451), Expect = 4.876e-45
Identity = 99/412 (24.03%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V++L+++     +  +N   P+H A +                                  GH +V K+L+++K +  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+       A    G+  +HLA  +G+ D+A  L+D+   + +  +    P+H A + G  E+  LL+  + + +A  K    P+H A+   + +   +L+ +     A A+N    +H+A +K   +I   L+    +  A+T +G + + LA +    +++ LL
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 666          

HSP 5 Score: 176.022 bits (445), Expect = 2.217e-44
Identity = 94/382 (24.61%), Postives = 175/382 (45.81%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A    HL  V+ L      ++         +H A   G  ++  +L+ KK    A       P+H+AC K    ++E+L+ H   I+A  + G   IH+A   G+ +I   L+ +       +   +  +H A   G  E+V+ L+     +EA  K ++ P+H ++  G  +  + L+ +     A   +    +HLA  +GH ++   L+    +    T KG +P+ +A K  K E+  LL Q
Sbjct:  188 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQ 569          

HSP 6 Score: 176.022 bits (445), Expect = 2.316e-44
Identity = 86/347 (24.78%), Postives = 168/347 (48.41%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G A++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q     A   +   P+H A + GH++V   L++   +L    K    PLH+A + G  ++  LL+ +  + DA  ++   P+H+A    + K+   L +Q  +  AA +  + P+H A  K Q +I   L+    D  A  ++ +  +HLA  +GH ++V +L++   ++   +  G   +HLA ++   ++A++L++    ++   ++   P+H  C  G+ +IV  L+  +  + A  K     +H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  452 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 7 Score: 175.637 bits (444), Expect = 3.146e-44
Identity = 96/428 (22.43%), Postives = 200/428 (46.73%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLID-----------------------------QKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  EGH ++V  L+ ++ N +   +K    +H+A   G  ++VK+L+    +  A  +N   P++ A +  H EVV+ L++   +     ++   PL +A ++GH  +V LL++                                N D   ++   P+H+A   G++ +   L N+   ++   + +  P+H A  +G   +V +L+ +   I+A  +  L P+H     GH+++VE+L++    I +   +G   +H+A +  + +  QLL+ +N  ++         +H A   GH ++ ++L+D  A+ N +A + +   P+H A +   +   ++L+     I+A  ++    IH+A   GH  IV  L+    +     ++G + + +A +S + E++  L Q   + ++    D+ P
Sbjct:   60 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFT--PLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTP 485          

HSP 8 Score: 173.711 bits (439), Expect = 1.378e-43
Identity = 89/379 (23.48%), Postives = 179/379 (47.23%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K    A   N   P+H ACK+    V++LL+    +++A  ++   P+H+A   GH +IV  L+    + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +     A       P+HLA  +GH+++   L++H   +      G+  +H+A + G  ++A LL+  +   +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   ++    L+    D  A  +    ++HLA ++GH ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  321 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVL 699          

HSP 9 Score: 169.088 bits (427), Expect = 4.031e-42
Identity = 84/365 (23.01%), Postives = 169/365 (46.30%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPI 1861
            A+H A   GH  + K+L+++K +    A     P+H+AC+K   +++++L++     +A  E+   PIH A   GH  +V  L++   +    +   +  LH+A   G  ++VR L+     ++A  ++   P+H++   G   IV+ L  Q  +  AA    + P+H A  +G +++   L+     +    KK   P+H+A   G  E+  +L+      +A    G   +H+A       +A LL+D         +    P+H A +    +I   L++   +  A  +     +H A++ GHV+   +L+ +  ++    ++    +HLA ++    + ++LV    + +A T  G +P+
Sbjct:  353 ALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL 717          

HSP 10 Score: 162.54 bits (410), Expect = 4.375e-40
Identity = 87/376 (23.14%), Postives = 182/376 (48.40%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   GH +     I    +   C +     +HLA ++G+ ++V  L++++ + +A  +     +H A   G  EVVK+L+    N+ A  +N   PL++A ++ H ++VR L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V++L+D +  I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    +  A  L G +P+ +A K  +  ++ELL
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELL 402          

HSP 11 Score: 134.806 bits (338), Expect = 1.594e-31
Identity = 78/315 (24.76%), Postives = 150/315 (47.62%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDG---WRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + GH E     I    ++  C++N    LHLA ++GH ++V  L+ ++ N+DA  +  N  +H+A   G  ++VK L     N+ A +Q  + P++ A  +   E+V  L+          +    P+ +A  +GH ++V +L+ +       D  G     A+H+A  K     A LL+ N+ + +V  +    P+H A   G+  +  LL++    ++   + +  P+H AS+ G+    K+L+ +   I+A  ++    +H     GH ++V++L+       + T  G SP+ +A +      ++LL Q
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN-------DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 338          

HSP 12 Score: 130.954 bits (328), Expect = 3.119e-30
Identity = 67/284 (23.59%), Postives = 128/284 (45.07%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLH---------------------------------LACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
             +  +H A  EGH D+   L++   +     +K   P+H+A + G  ++  +L+++    +A  ++   P+H A    +++V  LL++Q  +  A  KN   PLH                                 LA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ  +++A  ++ + P+H  C  G  +IVN L+     + A  K     +H A  +GH  I+ VL+ +         +G  A+ +A   GY  +   L
Sbjct:  515 GYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 13 Score: 81.2629 bits (199), Expect = 5.464e-15
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G+ + A   I N  D+ +C+Q     +H A + GH E+V  L+    N++A  K     +H AS AG  E  K+L+    ++ A +QN    +++A ++ H E+V+ L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 181          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 197.593 bits (501), Expect = 3.076e-51
Identity = 91/380 (23.95%), Postives = 188/380 (49.47%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L++   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q  +  A   +   PLHLA  +GH D+   L+D   ++    +    P+H+A   G L++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   +I   L+ +  D  A    G  ++HLA ++G+ D+  LL+  N ++ + ++    P+H A +     + ++L++   +++A  K    P+H     G+++    L+     + A  +N   A+H A ++GH  I+ +L++ + +   LT+ GN+ + +A +     +++ LK
Sbjct:  420 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 2 Score: 187.578 bits (475), Expect = 5.291e-48
Identity = 95/383 (24.80%), Postives = 188/383 (49.09%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A   +   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K L ++K +  A     + P+H AC K +  ++ +L+     I+A  +  L PIH+A   GH  IV  L++H       +  G  A+H+A   G A++ + L+ +   +E   +  + P+H +  +G  +IVQ L+    +  A       P+H A+  GH +    L+     +    +     +H+A + G  E+  LL++   + +A    G +P+ +A     Q++  LL
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLL 600          

HSP 3 Score: 180.644 bits (457), Expect = 8.374e-46
Identity = 95/385 (24.68%), Postives = 182/385 (47.27%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+  IV  L+         +      +H A + G  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q  + +A   +   P+HLA  +GH  +   L +   ++    +  + P+H A   G+ E+ ++L+ K    +A  K  L P+H+A    ++++  +L++      A   +G+  +H+A +K   DIA  L++   D     +     +H A + GH ++V LL+  N N+   +K    P+H A++   V   ++L+ +   ++A  +     +H+ C  G+ +IV  L++      A T  G + +  A +     II +L Q
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 767          

HSP 4 Score: 177.948 bits (450), Expect = 5.467e-45
Identity = 99/412 (24.03%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V++L+++     +  +N   P+H A +                                  GH +V K+L+++K +  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+       A    G+  +HLA  +G+ D+A  L+D+   + +  +    P+H A + G  E+  LL+  + + +A  K    P+H A+   + +   +L+ +     A A+N    +H+A +K   +I   L+    +  A+T +G + + LA +    +++ LL
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 666          

HSP 5 Score: 176.022 bits (445), Expect = 2.298e-44
Identity = 94/382 (24.61%), Postives = 175/382 (45.81%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A    HL  V+ L      ++         +H A   G  ++  +L+ KK    A       P+H+AC K    ++E+L+ H   I+A  + G   IH+A   G+ +I   L+ +       +   +  +H A   G  E+V+ L+     +EA  K ++ P+H ++  G  +  + L+ +     A   +    +HLA  +GH ++   L+    +    T KG +P+ +A K  K E+  LL Q
Sbjct:  188 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQ 569          

HSP 6 Score: 176.022 bits (445), Expect = 2.422e-44
Identity = 86/347 (24.78%), Postives = 168/347 (48.41%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G A++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q     A   +   P+H A + GH++V   L++   +L    K    PLH+A + G  ++  LL+ +  + DA  ++   P+H+A    + K+   L +Q  +  AA +  + P+H A  K Q +I   L+    D  A  ++ +  +HLA  +GH ++V +L++   ++   +  G   +HLA ++   ++A++L++    ++   ++   P+H  C  G+ +IV  L+  +  + A  K     +H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  452 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 7 Score: 175.637 bits (444), Expect = 2.936e-44
Identity = 96/428 (22.43%), Postives = 200/428 (46.73%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLID-----------------------------QKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  EGH ++V  L+ ++ N +   +K    +H+A   G  ++VK+L+    +  A  +N   P++ A +  H EVV+ L++   +     ++   PL +A ++GH  +V LL++                                N D   ++   P+H+A   G++ +   L N+   ++   + +  P+H A  +G   +V +L+ +   I+A  +  L P+H     GH+++VE+L++    I +   +G   +H+A +  + +  QLL+ +N  ++         +H A   GH ++ ++L+D  A+ N +A + +   P+H A +   +   ++L+     I+A  ++    IH+A   GH  IV  L+    +     ++G + + +A +S + E++  L Q   + ++    D+ P
Sbjct:   60 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFT--PLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTP 485          

HSP 8 Score: 173.326 bits (438), Expect = 1.601e-43
Identity = 89/379 (23.48%), Postives = 179/379 (47.23%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K    A   N   P+H ACK+    V++LL+    +++A  ++   P+H+A   GH +IV  L+    + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +     A       P+HLA  +GH+++   L++H   +      G+  +H+A + G  ++A LL+  +   +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   ++    L+    D  A  +    ++HLA ++GH ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  321 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVL 699          

HSP 9 Score: 168.703 bits (426), Expect = 4.408e-42
Identity = 84/365 (23.01%), Postives = 169/365 (46.30%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPI 1861
            A+H A   GH  + K+L+++K +    A     P+H+AC+K   +++++L++     +A  E+   PIH A   GH  +V  L++   +    +   +  LH+A   G  ++VR L+     ++A  ++   P+H++   G   IV+ L  Q  +  AA    + P+H A  +G +++   L+     +    KK   P+H+A   G  E+  +L+      +A    G   +H+A       +A LL+D         +    P+H A +    +I   L++   +  A  +     +H A++ GHV+   +L+ +  ++    ++    +HLA ++    + ++LV    + +A T  G +P+
Sbjct:  353 ALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL 717          

HSP 10 Score: 162.54 bits (410), Expect = 3.991e-40
Identity = 87/376 (23.14%), Postives = 182/376 (48.40%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   GH +     I    +   C +     +HLA ++G+ ++V  L++++ + +A  +     +H A   G  EVVK+L+    N+ A  +N   PL++A ++ H ++VR L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V++L+D +  I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    +  A  L G +P+ +A K  +  ++ELL
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELL 402          

HSP 11 Score: 134.806 bits (338), Expect = 1.668e-31
Identity = 78/315 (24.76%), Postives = 150/315 (47.62%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDG---WRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + GH E     I    ++  C++N    LHLA ++GH ++V  L+ ++ N+DA  +  N  +H+A   G  ++VK L     N+ A +Q  + P++ A  +   E+V  L+          +    P+ +A  +GH ++V +L+ +       D  G     A+H+A  K     A LL+ N+ + +V  +    P+H A   G+  +  LL++    ++   + +  P+H AS+ G+    K+L+ +   I+A  ++    +H     GH ++V++L+       + T  G SP+ +A +      ++LL Q
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN-------DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 338          

HSP 12 Score: 130.568 bits (327), Expect = 3.267e-30
Identity = 67/284 (23.59%), Postives = 128/284 (45.07%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLH---------------------------------LACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
             +  +H A  EGH D+   L++   +     +K   P+H+A + G  ++  +L+++    +A  ++   P+H A    +++V  LL++Q  +  A  KN   PLH                                 LA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ  +++A  ++ + P+H  C  G  +IVN L+     + A  K     +H A  +GH  I+ VL+ +         +G  A+ +A   GY  +   L
Sbjct:  515 GYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 13 Score: 81.2629 bits (199), Expect = 4.940e-15
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G+ + A   I N  D+ +C+Q     +H A + GH E+V  L+    N++A  K     +H AS AG  E  K+L+    ++ A +QN    +++A ++ H E+V+ L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 181          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 197.593 bits (501), Expect = 3.203e-51
Identity = 91/380 (23.95%), Postives = 188/380 (49.47%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L++   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q  +  A   +   PLHLA  +GH D+   L+D   ++    +    P+H+A   G L++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   +I   L+ +  D  A    G  ++HLA ++G+ D+  LL+  N ++ + ++    P+H A +     + ++L++   +++A  K    P+H     G+++    L+     + A  +N   A+H A ++GH  I+ +L++ + +   LT+ GN+ + +A +     +++ LK
Sbjct:  420 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 2 Score: 187.578 bits (475), Expect = 5.500e-48
Identity = 95/383 (24.80%), Postives = 188/383 (49.09%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A   +   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K L ++K +  A     + P+H AC K +  ++ +L+     I+A  +  L PIH+A   GH  IV  L++H       +  G  A+H+A   G A++ + L+ +   +E   +  + P+H +  +G  +IVQ L+    +  A       P+H A+  GH +    L+     +    +     +H+A + G  E+  LL++   + +A    G +P+ +A     Q++  LL
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLL 600          

HSP 3 Score: 180.644 bits (457), Expect = 8.322e-46
Identity = 95/385 (24.68%), Postives = 182/385 (47.27%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+  IV  L+         +      +H A + G  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q  + +A   +   P+HLA  +GH  +   L +   ++    +  + P+H A   G+ E+ ++L+ K    +A  K  L P+H+A    ++++  +L++      A   +G+  +H+A +K   DIA  L++   D     +     +H A + GH ++V LL+  N N+   +K    P+H A++   V   ++L+ +   ++A  +     +H+ C  G+ +IV  L++      A T  G + +  A +     II +L Q
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 767          

HSP 4 Score: 177.948 bits (450), Expect = 5.244e-45
Identity = 99/412 (24.03%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V++L+++     +  +N   P+H A +                                  GH +V K+L+++K +  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+       A    G+  +HLA  +G+ D+A  L+D+   + +  +    P+H A + G  E+  LL+  + + +A  K    P+H A+   + +   +L+ +     A A+N    +H+A +K   +I   L+    +  A+T +G + + LA +    +++ LL
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 666          

HSP 5 Score: 176.022 bits (445), Expect = 2.363e-44
Identity = 94/382 (24.61%), Postives = 175/382 (45.81%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A    HL  V+ L      ++         +H A   G  ++  +L+ KK    A       P+H+AC K    ++E+L+ H   I+A  + G   IH+A   G+ +I   L+ +       +   +  +H A   G  E+V+ L+     +EA  K ++ P+H ++  G  +  + L+ +     A   +    +HLA  +GH ++   L+    +    T KG +P+ +A K  K E+  LL Q
Sbjct:  188 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQ 569          

HSP 6 Score: 176.022 bits (445), Expect = 2.363e-44
Identity = 86/347 (24.78%), Postives = 168/347 (48.41%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G A++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q     A   +   P+H A + GH++V   L++   +L    K    PLH+A + G  ++  LL+ +  + DA  ++   P+H+A    + K+   L +Q  +  AA +  + P+H A  K Q +I   L+    D  A  ++ +  +HLA  +GH ++V +L++   ++   +  G   +HLA ++   ++A++L++    ++   ++   P+H  C  G+ +IV  L+  +  + A  K     +H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  452 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 7 Score: 175.637 bits (444), Expect = 3.628e-44
Identity = 92/368 (25.00%), Postives = 181/368 (49.18%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            A+H A  EGH ++V  L+ ++ N +   +K    +H+A   G  ++VK+L+    +  A  +N   P++ A +  H EVV+ L++   +     ++   PL +A ++GH  +V LL++     D   +     +H+A  K   K    L     N +  ++  + P+H A   G   +  +L+ +   ++   + ++ P+H+A  +G+  +V++L++    I+A   DG   +H     G+  + ++L+D +  I    +    P+H A +  H   VQLL+  N  ++         +H A+  GH +  K+L+ KK    A A N    +H+AC+K    +++LL++   + +A+T  G +PI +A
Sbjct:   60 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVA 423          

HSP 8 Score: 173.326 bits (438), Expect = 1.603e-43
Identity = 89/379 (23.48%), Postives = 179/379 (47.23%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K    A   N   P+H ACK+    V++LL+    +++A  ++   P+H+A   GH +IV  L+    + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +     A       P+HLA  +GH+++   L++H   +      G+  +H+A + G  ++A LL+  +   +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   ++    L+    D  A  +    ++HLA ++GH ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  321 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVL 699          

HSP 9 Score: 168.703 bits (426), Expect = 4.607e-42
Identity = 84/365 (23.01%), Postives = 169/365 (46.30%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPI 1861
            A+H A   GH  + K+L+++K +    A     P+H+AC+K   +++++L++     +A  E+   PIH A   GH  +V  L++   +    +   +  LH+A   G  ++VR L+     ++A  ++   P+H++   G   IV+ L  Q  +  AA    + P+H A  +G +++   L+     +    KK   P+H+A   G  E+  +L+      +A    G   +H+A       +A LL+D         +    P+H A +    +I   L++   +  A  +     +H A++ GHV+   +L+ +  ++    ++    +HLA ++    + ++LV    + +A T  G +P+
Sbjct:  353 ALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL 717          

HSP 10 Score: 162.155 bits (409), Expect = 4.828e-40
Identity = 87/376 (23.14%), Postives = 182/376 (48.40%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   GH +     I    +   C +     +HLA ++G+ ++V  L++++ + +A  +     +H A   G  EVVK+L+    N+ A  +N   PL++A ++ H ++VR L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V++L+D +  I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    +  A  L G +P+ +A K  +  ++ELL
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELL 402          

HSP 11 Score: 134.806 bits (338), Expect = 1.700e-31
Identity = 78/315 (24.76%), Postives = 150/315 (47.62%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDG---WRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + GH E     I    ++  C++N    LHLA ++GH ++V  L+ ++ N+DA  +  N  +H+A   G  ++VK L     N+ A +Q  + P++ A  +   E+V  L+          +    P+ +A  +GH ++V +L+ +       D  G     A+H+A  K     A LL+ N+ + +V  +    P+H A   G+  +  LL++    ++   + +  P+H AS+ G+    K+L+ +   I+A  ++    +H     GH ++V++L+       + T  G SP+ +A +      ++LL Q
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN-------DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 338          

HSP 12 Score: 130.568 bits (327), Expect = 3.269e-30
Identity = 67/284 (23.59%), Postives = 128/284 (45.07%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLH---------------------------------LACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
             +  +H A  EGH D+   L++   +     +K   P+H+A + G  ++  +L+++    +A  ++   P+H A    +++V  LL++Q  +  A  KN   PLH                                 LA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ  +++A  ++ + P+H  C  G  +IVN L+     + A  K     +H A  +GH  I+ VL+ +         +G  A+ +A   GY  +   L
Sbjct:  515 GYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 13 Score: 81.2629 bits (199), Expect = 5.592e-15
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G+ + A   I N  D+ +C+Q     +H A + GH E+V  L+    N++A  K     +H AS AG  E  K+L+    ++ A +QN    +++A ++ H E+V+ L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 181          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 3.290e-50
Identity = 91/380 (23.95%), Postives = 188/380 (49.47%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L++   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q  +  A   +   PLHLA  +GH D+   L+D   ++    +    P+H+A   G L++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   +I   L+ +  D  A    G  ++HLA ++G+ D+  LL+  N ++ + ++    P+H A +     + ++L++   +++A  K    P+H     G+++    L+     + A  +N   A+H A ++GH  I+ +L++ + +   LT+ GN+ + +A +     +++ LK
Sbjct:  420 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 2 Score: 187.193 bits (474), Expect = 5.252e-47
Identity = 95/383 (24.80%), Postives = 188/383 (49.09%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A   +   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K L ++K +  A     + P+H AC K +  ++ +L+     I+A  +  L PIH+A   GH  IV  L++H       +  G  A+H+A   G A++ + L+ +   +E   +  + P+H +  +G  +IVQ L+    +  A       P+H A+  GH +    L+     +    +     +H+A + G  E+  LL++   + +A    G +P+ +A     Q++  LL
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLL 600          

HSP 3 Score: 180.259 bits (456), Expect = 8.217e-45
Identity = 95/385 (24.68%), Postives = 182/385 (47.27%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+  IV  L+         +      +H A + G  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q  + +A   +   P+HLA  +GH  +   L +   ++    +  + P+H A   G+ E+ ++L+ K    +A  K  L P+H+A    ++++  +L++      A   +G+  +H+A +K   DIA  L++   D     +     +H A + GH ++V LL+  N N+   +K    P+H A++   V   ++L+ +   ++A  +     +H+ C  G+ +IV  L++      A T  G + +  A +     II +L Q
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 767          

HSP 4 Score: 177.563 bits (449), Expect = 5.220e-44
Identity = 99/412 (24.03%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+A++VK+L+++    +        P+H     G+E++V++L+++     +  +N   P+H A +                                  GH +V K+L+++K +  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+       A    G+  +HLA  +G+ D+A  L+D+   + +  +    P+H A + G  E+  LL+  + + +A  K    P+H A+   + +   +L+ +     A A+N    +H+A +K   +I   L+    +  A+T +G + + LA +    +++ LL
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 666          

HSP 5 Score: 175.637 bits (444), Expect = 2.251e-43
Identity = 94/382 (24.61%), Postives = 175/382 (45.81%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A    HL  V+ L      ++         +H A   G  ++  +L+ KK    A       P+H+AC K    ++E+L+ H   I+A  + G   IH+A   G+ +I   L+ +       +   +  +H A   G  E+V+ L+     +EA  K ++ P+H ++  G  +  + L+ +     A   +    +HLA  +GH ++   L+    +    T KG +P+ +A K  K E+  LL Q
Sbjct:  188 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQ 569          

HSP 6 Score: 175.637 bits (444), Expect = 2.271e-43
Identity = 86/347 (24.78%), Postives = 168/347 (48.41%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G A++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q     A   +   P+H A + GH++V   L++   +L    K    PLH+A + G  ++  LL+ +  + DA  ++   P+H+A    + K+   L +Q  +  AA +  + P+H A  K Q +I   L+    D  A  ++ +  +HLA  +GH ++V +L++   ++   +  G   +HLA ++   ++A++L++    ++   ++   P+H  C  G+ +IV  L+  +  + A  K     +H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  452 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 7 Score: 175.252 bits (443), Expect = 3.193e-43
Identity = 92/368 (25.00%), Postives = 181/368 (49.18%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            A+H A  EGH ++V  L+ ++ N +   +K    +H+A   G  ++VK+L+    +  A  +N   P++ A +  H EVV+ L++   +     ++   PL +A ++GH  +V LL++     D   +     +H+A  K   K    L     N +  ++  + P+H A   G   +  +L+ +   ++   + ++ P+H+A  +G+  +V++L++    I+A   DG   +H     G+  + ++L+D +  I    +    P+H A +  H   VQLL+  N  ++         +H A+  GH +  K+L+ KK    A A N    +H+AC+K    +++LL++   + +A+T  G +PI +A
Sbjct:   60 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVA 423          

HSP 8 Score: 172.94 bits (437), Expect = 1.580e-42
Identity = 89/379 (23.48%), Postives = 179/379 (47.23%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K    A   N   P+H ACK+    V++LL+    +++A  ++   P+H+A   GH +IV  L+    + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +     A       P+HLA  +GH+++   L++H   +      G+  +H+A + G  ++A LL+  +   +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   ++    L+    D  A  +    ++HLA ++GH ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  321 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVL 699          

HSP 9 Score: 168.318 bits (425), Expect = 4.342e-41
Identity = 84/365 (23.01%), Postives = 169/365 (46.30%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPI 1861
            A+H A   GH  + K+L+++K +    A     P+H+AC+K   +++++L++     +A  E+   PIH A   GH  +V  L++   +    +   +  LH+A   G  ++VR L+     ++A  ++   P+H++   G   IV+ L  Q  +  AA    + P+H A  +G +++   L+     +    KK   P+H+A   G  E+  +L+      +A    G   +H+A       +A LL+D         +    P+H A +    +I   L++   +  A  +     +H A++ GHV+   +L+ +  ++    ++    +HLA ++    + ++LV    + +A T  G +P+
Sbjct:  353 ALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL 717          

HSP 10 Score: 162.155 bits (409), Expect = 4.466e-39
Identity = 87/376 (23.14%), Postives = 182/376 (48.40%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   GH +     I    +   C +     +HLA ++G+ ++V  L++++ + +A  +     +H A   G  EVVK+L+    N+ A  +N   PL++A ++ H ++VR L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V++L+D +  I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    +  A  L G +P+ +A K  +  ++ELL
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELL 402          

HSP 11 Score: 134.42 bits (337), Expect = 1.485e-30
Identity = 78/315 (24.76%), Postives = 150/315 (47.62%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDG---WRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + GH E     I    ++  C++N    LHLA ++GH ++V  L+ ++ N+DA  +  N  +H+A   G  ++VK L     N+ A +Q  + P++ A  +   E+V  L+          +    P+ +A  +GH ++V +L+ +       D  G     A+H+A  K     A LL+ N+ + +V  +    P+H A   G+  +  LL++    ++   + +  P+H AS+ G+    K+L+ +   I+A  ++    +H     GH ++V++L+       + T  G SP+ +A +      ++LL Q
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN-------DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 338          

HSP 12 Score: 130.183 bits (326), Expect = 2.954e-29
Identity = 67/284 (23.59%), Postives = 128/284 (45.07%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLH---------------------------------LACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
             +  +H A  EGH D+   L++   +     +K   P+H+A + G  ++  +L+++    +A  ++   P+H A    +++V  LL++Q  +  A  KN   PLH                                 LA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ  +++A  ++ + P+H  C  G  +IVN L+     + A  K     +H A  +GH  I+ VL+ +         +G  A+ +A   GY  +   L
Sbjct:  515 GYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 13 Score: 80.8777 bits (198), Expect = 4.423e-14
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G+ + A   I N  D+ +C+Q     +H A + GH E+V  L+    N++A  K     +H AS AG  E  K+L+    ++ A +QN    +++A ++ H E+V+ L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 181          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. UniProt/SwissProt
Match: sp|Q4UMH6|Y381_RICFE (Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0381 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 3.210e-46
Identity = 107/380 (28.16%), Postives = 178/380 (46.84%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H+A ++G+ D+V +LI+   +        +  ++ A + G   +V +LI    D  A  +N    +H+A + G+ ++V LLI+   N+     N +  LH A + G+ ++V  LI  K +I A   +    +H A + G+L +V  L   K +I A        +HFA   G   +VN LI  K DI A        +H A   G+  +V  LI +K DI A  + G   +H A E G  ++  LLI N  DI          +HYA E G+  +V LLI    ++ A        +H+A + G ++   +LM++  D+ A   +   A+H A E  +  +V LL+    +  A    G +P+  A      +++ LL
Sbjct:  740 ALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVN----NAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLL 1115          

HSP 2 Score: 171.4 bits (433), Expect = 3.054e-42
Identity = 103/380 (27.11%), Postives = 173/380 (45.53%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +H+A   G+  +VK LI  + N     +  +  +H A       +V +LI    D  A  +N    +H+A   G+ ++V LLI+   ++ A   + +  L+ A + G  D+V LLI    +++A   N    +H A + G+L +V  L +   N+  A  I    +HFA   G   +VN LI  K DI A        +H A   G+  +V  LI +K DI A  + G   +H A + G  ++   LI N  DI       +  +H+A + G+  +V  LI    +I A        +H+A+E+G++    +L+    DI     +   A+H A E G+  +V LL+    +  A T  G + +  A      +++ LL
Sbjct:  674 VLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVNNAKTI----LHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLL 1049          

HSP 3 Score: 143.665 bits (361), Expect = 1.420e-33
Identity = 93/359 (25.91%), Postives = 158/359 (44.01%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVK--LLVRAHCNTEAL 1837
             +H+A   G+ D+V +LI+   N        +  +H A + G   +V  LI+ K D  A   +    +HFA + G+  +V  LI  K ++ A   + +  LH A + G+ ++V  LI  K +I A   +    +H A   G+L +V  L   K +I A        +HFA   G   +V++LI    DI       L  +H A   G+  +V +LI+   D+ A  + G   +H A + G  D+  LL+    D+          +HYA E  +  +V LL+    ++ A +     P+HYA     ++   +L+    DI     +    ++   E  +  I+K  +L  A  N E +
Sbjct:  806 VLHYAVESGNLDLVSLLIHNGANVNNA----KTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEFNNCNILKSFILGGADINLETM 1160          

HSP 4 Score: 137.887 bits (346), Expect = 9.441e-32
Identity = 85/334 (25.45%), Postives = 153/334 (45.81%), Query Frame = 2
Query:  905 VKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            V +LI    +  A + +    +H A K G+ ++ KLL     ++ A   N +  LH A + G+  +V+ LI+ + NI A   N    +H A    +  +V  L     ++ A        +H+A + G  ++V++LI+   D+ A        ++ A   G  ++V +LI +  D+ A  D+G   +H A E G  D+  LLI N  ++     I    +H+A + G+  +V  LI    +I A        +H+A+E+G++     L+  K DI A   +    +H A + G+  +V  L++   +  A T  G + +  A KS    ++  L
Sbjct:  621 VPLLITHGANPNATNCHGVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVNNAKTI----LHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWL 950          

HSP 5 Score: 135.576 bits (340), Expect = 6.028e-31
Identity = 82/303 (27.06%), Postives = 140/303 (46.20%), Query Frame = 2
Query:  998 EVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            E V LLI    N  A + +    LH A + G+ D+ +LL     +++A   N    +H A   G+L +VK L   + NI A        +H+A      ++V +LI    D+ A     L  +H A   G+ ++V +LI+H  D+ A  + G   ++ A + G  D+  LLI    D+       +  +HYA E G+ ++V LLI    N+       +  +H+A+++G++     L+  K DI A   +    +H A E G+  +V  L++   +  A T  G + +  A KS    ++  L
Sbjct:  619 ESVPLLITHGANPNATNCHGVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVNNA----KTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWL 917          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 184.882 bits (468), Expect = 3.432e-46
Identity = 89/380 (23.42%), Postives = 187/380 (49.21%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L++   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q  +  A   +   PLHL+  +GH D+   L+D   ++    +    P+H+A   G L++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   +I   L+ +  D  A    G  ++HLA ++G+ D+  LL+  N ++ + ++    P+H A +     + ++L++   +++A  K    P+H     G+++    L+     + A  +N    +H A ++GH  I+ +L++ + +   LT+ GN+ + +A +     +++ LK
Sbjct:  445 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 824          

HSP 2 Score: 181.03 bits (458), Expect = 5.792e-45
Identity = 95/379 (25.07%), Postives = 187/379 (49.34%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A   +   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K L ++K N  A     + P+H AC K +  ++ +L+     I+A  +  L PIH+A   GH  IV  L++H       +  G  A+H+A   G A++ + L+ +   +E   +  + P+H +  +G  +IVQ L+    +  A       P+H ++  GH +    L+     +    +     +H+A + G  E+  LL++   + +A    G +P+ +A     Q++  LL
Sbjct:  247 LHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLL 625          

HSP 3 Score: 177.178 bits (448), Expect = 7.735e-44
Identity = 103/415 (24.82%), Postives = 193/415 (46.51%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGH---------------------------------KEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L+++K N    A     P+H+AC+K   +++++L++     +A  E+   PIH A   GH                                  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q  + +A   +   P+HL+  +GH  +   L +   ++    +  + P+H A   G+ E+ ++L+ K    +A  K  L P+H+A    ++++  +L++      A   +G+  +H+A +K   DIA  L++   D     +     +H A + GH ++V LL+  N N+   +K    P+H A++   V   ++L+ +   ++A  +     +H+ C  G+ +IV  L++      A T  G +P+  A +     II +L Q
Sbjct:  378 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 792          

HSP 4 Score: 171.014 bits (432), Expect = 7.058e-42
Identity = 95/379 (25.07%), Postives = 182/379 (48.02%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H     GH  +V+ML+++     +  +    P+H+A +  +   V++L++     +    +    +H A   GH +V K+L+++K N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+       A    G+  +HL+  +G+ D+A  L+D+   + +  +    P+H A + G  E+  LL+  + + +A  K    P+H A+   + +   +L+ +     A A+N    +H+A +K   +I   L+    +  A+T +G + + LA +    +++ LL
Sbjct:  313 LHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 691          

HSP 5 Score: 170.244 bits (430), Expect = 1.299e-41
Identity = 102/436 (23.39%), Postives = 205/436 (47.02%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQ----KCNIDA------------------NDQNS--------NR-------PIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  EGH ++V  L+ ++ N +   +K    +H+A   G  ++VK+L+    +  A  +N   P++ A +  H EVV+ L++   +     ++   PL +A ++GH  +V LL++     K  + A                  ND N+        NR       P+H+A   G++ +   L N+   ++   + +  P+H A  +G   +V +L+ +   I+A  +  L P+H     GH+++VE+L++    I +   +G   +H+A +  + +  QLL+ +N  ++         +H A   GH ++ ++L+D  AN N +A + +   P+H A +   +   ++L+     I+A  ++    IH+A   GH  IV  L+    +     ++G + + +A +S + E++  L Q   + ++    D+ P
Sbjct:   77 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFT--PLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTP 510          

HSP 6 Score: 167.548 bits (423), Expect = 8.291e-41
Identity = 86/347 (24.78%), Postives = 169/347 (48.70%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G A++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q     A   +   P+H + + GH++V   L++   +L    K    PLH+A + G  ++  LL+ +  + DA  ++   P+H+A    + K+   L +Q  +  AA +  + P+H A  K Q +I   L+    D  A  ++ +  +HLA  +GH ++V +L++   ++   +  G   +HLA ++   ++A++L++    ++   ++   P+H  C  G+ +IV  L+  +  + A  K    P+H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  477 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 7 Score: 166.392 bits (420), Expect = 2.139e-40
Identity = 95/374 (25.40%), Postives = 175/374 (46.79%), Query Frame = 2
Query:  794 HADI-VKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            +ADI  KM++N+        E    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A    HL  V+ L      ++         +H A   G  ++  +L+ KK +  A       P+H+AC K    ++E+L+ H   I+A  + G   IH+A   G+ +I   L+ +       +   +  +H A   G  E+V+ L+     +EA  K ++ P+H ++  G  +  + L+ +     A   +    +HL+  +GH ++   L+    +    T KG +P+ +A K  K E+  LL Q
Sbjct:  227 NADIESKMVVNR------ATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQ 594          

HSP 8 Score: 166.007 bits (419), Expect = 2.924e-40
Identity = 88/379 (23.22%), Postives = 180/379 (47.49%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K +  A   N   P+H ACK+    V++LL+    +++A  ++   P+H+A   GH +IV  L+    + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +     A       P+HL+  +GH+++   L++H   +      G+  +H+A + G  ++A LL+  +   +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   ++    L+    D  A  +    ++HLA ++GH ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  346 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVL 724          

HSP 9 Score: 155.606 bits (392), Expect = 4.614e-37
Identity = 89/380 (23.42%), Postives = 182/380 (47.89%), Query Frame = 2
Query:  791 GHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITK--KCDIEA------PEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            GH +     I    +   C +     +HLA ++G+ ++V  L++++ + +A  +     +H A   G  EVVK+L+    N+ A  +N   PL++A ++ H ++VR L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+      DIE+        +    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V++L+D    I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    N  A  L G +P+ +A K  +  ++ELL
Sbjct:   52 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELL 427          

HSP 10 Score: 129.028 bits (323), Expect = 8.104e-29
Identity = 82/323 (25.39%), Postives = 154/323 (47.68%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDG---WRAIHLACEKGYADIAQLLI--DNNCDIE---VCDQISKR---PIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + GH E     I    ++  C++N    LHLA ++GH ++V  L+ ++ N+DA  +  N  +H+A   G  ++VK L     N+ A +Q  + P++ A  +   E+V  L+          +    P+ +A  +GH ++V +L+ +       D  G     A+H+A  K     A LL+  D N DIE   V ++ ++    P+H A   G+  +  LL++    ++   + +  P+H AS+ G+    K+L+ +   I+A  ++    +H     GH ++V++L+       + T  G SP+ +A +      ++LL Q
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN-------DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 363          

HSP 11 Score: 126.331 bits (316), Expect = 6.354e-28
Identity = 61/252 (24.21%), Postives = 122/252 (48.41%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  ++  +L+ +  + +   +    P+H+A     +K+  +L++Q     A  +N   P+H A K+   ++   L+    +  A  +     +HLA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ  +++A  ++ + P+H  C  G  +IVN L+     + A  K    P+H A  +GH  I+ VL+ +         +G  A+ +A   GY  +   L
Sbjct:  572 KGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 12 Score: 80.8777 bits (198), Expect = 4.386e-14
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G+ + A   I N  D+ +C+Q     +H A + GH E+V  L+    N++A  K     +H AS AG  E  K+L+    ++ A +QN    +++A ++ H E+V+ L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 198          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 184.496 bits (467), Expect = 3.582e-46
Identity = 93/380 (24.47%), Postives = 185/380 (48.68%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H A F GH  IVK L+ +  +      K + P+H+A   G+ ++ K L++ K    A  +++  P+H A + GH  +VKLL+    N          PLH+A  +GH + V  L++++ +     +    P+H+A   G +++ + L  +  +  AA +    P+H A      +IV +L+ +     +P      P+H+A  +   E+   L+ +     A    G   +HLA ++G+A++  LL+    +  + ++    P+H   + GH  +  +LI     ++A  +    P+H AS  G+++  K L+  + D+ A  +     +H A ++GH +IV LL++   +   ++  G +P+ +A++     + ++LK
Sbjct:  408 LHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLK 787          

HSP 2 Score: 182.57 bits (462), Expect = 1.304e-45
Identity = 100/396 (25.25%), Postives = 190/396 (47.98%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            +H A   G+  +V++L+++    ET  +    P+H A   G+ +I +IL++     +A  +N   PIH A +  H + V+LL+     ++    ++  PLH+A   GH  + ++L+D+    ++   N   P+H+AC K H+++++ L     +I+A  +    P+H A + G   IV  L+ +         K   P+H+A   GH E+ + L+ +K  + A   D    +H A   G+ ++ +LL++NN +  +       P+H A   GH E V  L++   +     K    P+H A++ G V   ++L+ +     A  +N    +H+A    + +IVKLL+    +  +    G +P+ +A K  + E+   L Q      ++ +Q   P
Sbjct:  243 LHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTP 638          

HSP 3 Score: 179.489 bits (454), Expect = 1.288e-44
Identity = 101/410 (24.63%), Postives = 190/410 (46.34%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVK-----------------------------ILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEII 1897
            K +  ++ A  E H ++VK L+    N     E    P+ +A ++G+E +V                              +L++   + +   +    P+H A    +  V +LL+N+  ++    +N   PLH+A  +G+  +VRLL+D+   I+   ++   P+H A   GH++I + L +    I+A  +    PIH A      + V +L+    +I+     +L P+H+A   GH  + +VL++      +   +G+  +H+AC+K +  + +LL+     I+   +    P+H A  MGH  IV+ L+    +    +     P+H A+ AGH E  K L+  K  + A A++++  +H A   GH  +VKLL+  + N    T  G++P+ +A +    E +
Sbjct:  110 KGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETV 519          

HSP 4 Score: 175.252 bits (443), Expect = 2.688e-43
Identity = 98/380 (25.79%), Postives = 171/380 (45.00%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A          +L+    N +  ++    P+H+A       + ++L+ +        +N   P+H A +RG+  +V+LL+++   +E   K+   PLH A   GH  I  +L+D    I A  +N   PIH+A    HL  V+ L      I+     +  P+H A   G   +  +L+ K     +       P+H+AC K H  ++E+L+     I+A  + G   +H+A   G+  I + L+       V +   + P+H A   GHTE+ + L+     + A  K ++ P+H A+  GH    K+L+    +           +H+A  +GH E V  L+    +   +T KG +P+ +A K  K  + ELL
Sbjct:  176 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELL 555          

HSP 5 Score: 169.859 bits (429), Expect = 1.466e-41
Identity = 96/390 (24.62%), Postives = 179/390 (45.90%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDV 1939
            +H A   GH  + K+L+++     + A     P+H+AC+K + +++++L++     +A  E+   P+H A   GH  +VK L+ +  +    +   + PLH+A   GHT++ + L+  K  ++A  ++   P+H A   GH  +VK L     N   A      P+H A  +G  E V  L+ K+       KK   P+H+A   G   + E+L+       A   +G   +H+A      DI +LL+               P+H A +    E+ + L+    +  A       P+H A++ GH E   +L+ K+ +     ++    +HL  ++GH  +  +L++     +A T  G +P+ +A      ++++ L Q     Q+DV
Sbjct:  342 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQ----HQADV 727          

HSP 6 Score: 165.236 bits (417), Expect = 4.222e-40
Identity = 92/379 (24.27%), Postives = 182/379 (48.02%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  I ++L++     +   +    PIH+A +  +   V++L++   + +    ++  P+H A   GH  V K+L+++     +   N   PLH+AC+K H  ++ LL+    +IDA  ++   P+H+A   GHL IVK L  +  +   +N     P+H A   G  E+   L+  K  + A  K +  P+H A   GH  +V++L+ +  +       G   +H+A  +G+ +    L++         +    P+H A + G   + +LL++ + +  A  K    P+H A    +++  K+L+ +     + A N    +H+A ++   E+ + L++   +  A +++G +P+ LA +    E++ LL
Sbjct:  276 LHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALL 654          

HSP 7 Score: 158.688 bits (400), Expect = 5.172e-38
Identity = 92/382 (24.08%), Postives = 180/382 (47.12%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +H A  EGH  +V  L++++   ET  +K    +H+A   G +++V+ L+    +  A  +    P++ A +  H EVVK L+    N     ++   PL +A ++GH ++V  LI    N     +     +H+A      +    L     N +  ++  + P+H A       +  +L+ +   +    +  + P+H+A  +G+  +V +L++    IE    D    +H A   G+  I+++L+D+   I+   +    PIH A +  H + V+LL+  +  I+     +  P+H A+  GH    K+L+ K     + A N    +H+AC+K H  +++LL++   + +A+T  G +P+ +A       I++ L Q
Sbjct:   48 GLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQ 425          

HSP 8 Score: 150.599 bits (379), Expect = 1.583e-35
Identity = 89/379 (23.48%), Postives = 173/379 (45.65%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQT 1915
            A   G+ D     +    +  TC +     +HLA ++G+ K+V  L+ ++   E   +     +H A   G  EVV+ L+N   N+ A  +    PL++A ++ H ++V+ L++   N +   ++   P+ +A  +GH  +V  L N         ++    +H A          +L+    + +   K    P+H+A    +  + ++L+N    +     +G   +H+A  +G   + +LL+D    IE   +    P+H A   GH  I ++L+D    I+A  K    PIH A++  H++C ++L+    +I+    +    +H+A   GH  + K+L+       +  L G +P+ +A K     ++ELL +T
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT 393          

HSP 9 Score: 127.872 bits (320), Expect = 1.799e-28
Identity = 65/267 (24.34%), Postives = 125/267 (46.82%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGY---ADIAQLLIDNNCDIEVCDQ 1546
            K +  +H A   G   + ++L+ +  +     +    P+H+A       IVK+L+ +     +   N   P+H A K+   EV + L+    +  A       PLHLA ++GH ++V LL+ ++ N +  +++   P+HL   +GH+ +   L      ++A  ++ + P+H A   G  ++V  L+  + D+ A  K    P+H A  +GH +IV +L+ +         DG   + +A   GY    D+ +++ D    + V D+
Sbjct:  535 KGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDK 801          

HSP 10 Score: 58.5362 bits (140), Expect = 3.552e-7
Identity = 39/151 (25.83%), Postives = 68/151 (45.03%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  D A   + N  DI  C+Q     +H A + GH ++V  L+     +E   K     +H A+ AG  E  + L+    ++ A +Q     +++A ++ H E+VK L+    N    T  G +P+ +A +   + ++  L    TK
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTK 169          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 181.8 bits (460), Expect = 3.385e-45
Identity = 89/380 (23.42%), Postives = 187/380 (49.21%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV  L++   +  T   + +  +H+A   G  ++V+ L++     EA  +++  P+H + + G  ++V+ L+ Q  +  A   +   PLHL+  +GH D+   L+D   ++    +    P+H+A   G L++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   +I   L+ +  D  A    G  ++HLA ++G+ D+  LL+  N ++ + ++    P+H A +     + ++L++   +++A  K    P+H     G+++    L+     + A  +N    +H A ++GH  I+ +L++ + +   LT+ GN+ + +A +     +++ LK
Sbjct:  437 IHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 816          

HSP 2 Score: 178.333 bits (451), Expect = 3.761e-44
Identity = 95/379 (25.07%), Postives = 188/379 (49.60%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A   +   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K L ++K N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH  IV  L++H       +  G  A+H+A   G A++ + L+ +   +E   +  + P+H +  +G  +IVQ L+    +  A       P+H ++  GH +    L+     +    +     +H+A + G  E+  LL++   + +A    G +P+ +A     Q++  LL
Sbjct:  239 LHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLL 617          

HSP 3 Score: 177.563 bits (449), Expect = 7.439e-44
Identity = 105/415 (25.30%), Postives = 193/415 (46.51%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGH---------------------------------KEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L+++K N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH                                  EVV+ L+     +EA  K++Q PLH++   G  DIV+ L+ Q  + +A   +   P+HL+  +GH  +   L +   ++    +  + P+H A   G+ E+ N+L+ K    +A  K  L P+H+A    ++++  +L++      A   +G+  +H+A +K   DIA  L++   D     +     +H A + GH ++V LL+  N N+   +K    P+H A++   V   ++L+ +   ++A  +     +H+ C  G+ +IV  L++      A T  G +P+  A +     II +L Q
Sbjct:  370 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 784          

HSP 4 Score: 171.785 bits (434), Expect = 5.351e-42
Identity = 98/428 (22.90%), Postives = 201/428 (46.96%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC-----------------------------NIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  EGH ++V  L+ ++ N +   +K    +H+A   G  ++VK+L+    +  A  +N   P++ A +  H EVVK L++   +     ++   PL +A ++GH  +V LL++                                N D   ++   P+H+A   G++ +   L N+   ++   + +  P+H A  +G   +V +L+ +   I+A  +  L P+H     GH+++VE+L++    I +   +G   +H+A +  + +  QLL+ +N  ++         +H A   GH ++ ++L+D  AN N +A + +   P+H A +   ++  ++L+     I+A  ++    IH+A   GH  IV  L+    +     ++G + + +A +S + E++  L Q   + ++    D+ P
Sbjct:   77 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFT--PLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTP 502          

HSP 5 Score: 169.088 bits (427), Expect = 2.998e-41
Identity = 95/379 (25.07%), Postives = 182/379 (48.02%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H     GH  +V+ML+++     +  +    P+H+A +  +   V++L++     +    +    +H A   GH +V K+L+++K N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH+ IV  L +   +    N      +H A   GQ E+V  L+     +EA  K +  P+H++   G  +IV+ L+       A    G+  +HL+  +G+ D+A  L+D+   + +  +    P+H A + G  E+  LL+  + + +A  K    P+H A+   + +   +L+ +     A A+N    +H+A +K   +I   L+    +  A+T +G + + LA +    +++ LL
Sbjct:  305 LHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 683          

HSP 6 Score: 166.392 bits (420), Expect = 2.118e-40
Identity = 93/382 (24.35%), Postives = 177/382 (46.34%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+++   ++A  ++   PLH     GH  +V +L+D+   I +  +N   P+H+A    HL  V+ L      ++         +H A   G  ++  +L+ KK +  A       P+H+AC K   +++E+L+ H   I+A  + G   IH+A   G+ +I   L+ +       +   +  +H A   G  E+V+ L+     +EA  K ++ P+H ++  G  +  + L+ +     A   +    +HL+  +GH ++   L+    +    T KG +P+ +A K  K E+  LL Q
Sbjct:  205 ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQ 586          

HSP 7 Score: 165.236 bits (417), Expect = 5.135e-40
Identity = 86/347 (24.78%), Postives = 168/347 (48.41%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G A++V+ L+      E  A+ +Q P+H++   G   IV+ L++Q     A   +   P+H + + GH++V   L++   +L    K    PLH+A + G  ++  LL+ +  + DA  ++   P+H+A    + K+   L +Q  +  AA +  + P+H A  K Q +I   L+    D  A  ++ +  +HLA  +GH ++V +L+    ++   +  G   +HLA ++   ++A++L++    ++   ++   P+H  C  G+ +IV  L+  +  + A  K    P+H A++ GH     +L+           N   A+ +A   G+  +V  L
Sbjct:  469 ALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 8 Score: 163.696 bits (413), Expect = 1.505e-39
Identity = 88/379 (23.22%), Postives = 181/379 (47.76%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+L+++K +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV  L+    + +  +      +H+A   G  ++V+ L      +EA  + +  P+H +   G+ +IV  L+ +     A       P+HL+  +GH+++   L++H   +      G+  +H+A + G  ++A LL+  +   +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   ++    L+    D  A  +    ++HLA ++GH ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  338 LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVL 716          

HSP 9 Score: 158.303 bits (399), Expect = 7.152e-38
Identity = 86/372 (23.12%), Postives = 181/372 (48.66%), Query Frame = 2
Query:  791 GHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            GH +     I    +   C +     +HLA ++G+ ++V  L++++ + +A  +     +H A   G  EVVK+L+    N+ A  +N   PL++A ++ H ++V+ L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G A++ +LL+D    I+   +    P+H     GH ++V++L+D    I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K+L+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   52 GHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELL 419          

HSP 10 Score: 130.183 bits (326), Expect = 4.120e-29
Identity = 81/317 (25.55%), Postives = 151/317 (47.63%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDG---WRAIHLACEKGYADIAQLLI--DNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A + GH E     I    ++  C++N    LHLA ++GH ++V  L+ ++ N+DA  +  N  +H+A   G  ++VK L     N+ A +Q  + P++ A  +   E+V  L+          +    P+ +A  +GH ++V +L+ +       D  G     A+H+A  K     A LL+  DNN D+E     +  P+H A   G+  +  LL++    ++   + +  P+H AS+ G+    K+L+ +   I+A  ++    +H     GH ++V++L+       + T  G SP+ +A +      ++LL Q
Sbjct:   48 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN-------DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFT--PLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 355          

HSP 11 Score: 124.02 bits (310), Expect = 2.862e-27
Identity = 61/252 (24.21%), Postives = 122/252 (48.41%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  ++  +L+ +  + +   +    P+H+A     +K+  +L++Q     A  +N   P+H A K+   ++   L+    +  A  +     +HLA ++GH D+V LL+ +  N++ ++++   P+HLA  +  + + + L NQ  +++A  ++ + P+H  C  G  +IVN L+     + A  K    P+H A  +GH  I+ VL+ +         +G  A+ +A   GY  +   L
Sbjct:  564 KGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 12 Score: 81.2629 bits (199), Expect = 3.543e-14
Identity = 44/151 (29.14%), Postives = 76/151 (50.33%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G+ + A   I N  DI +C+Q     +H A + GH E+V  L+    N++A  K     +H AS AG  E  K+L+    ++ A +QN    +++A ++ H E+VK L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   48 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 198          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. TrEMBL
Match: A0A182GGY8 (ANK_REP_REGION domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG009719 PE=4 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 4.813e-99
Identity = 165/384 (42.97%), Postives = 256/384 (66.67%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K +  +H AC  GH ++V++LI +K N +   EK   P+HLAC+ G++++V+ILI  K + EA ++ N  P+HFAC  GHKEVV++LI +K N+EA +++N  PLHL+C  GH ++V +LI +K NI+A +Q++  P+HLAC  GH ++V+ L  ++ NIEA NQ N+ P+H A W G +++V ILI +K +IEA  ++N  P+HLAC  GHKE+VE+LI  K +IEA   D W  +H AC+ G+A++ ++L+    +I+   +    P+H AC+ GH E+V++LI    NI+A  +    P+H A + GH E  +IL+ +K +IEA  Q+    +HLACEKGH E+VK+L+    N +ALT K N+P+ LA +   +E++E+ 
Sbjct: 1365 KKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIF 1748          

HSP 2 Score: 348.977 bits (894), Expect = 5.612e-98
Identity = 165/383 (43.08%), Postives = 249/383 (65.01%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            NW  +H AC  GH ++V++LI +  N +   E    P+HLAC +G+++ V+ILI +K + +A DEN   P+H AC+ GH EVV++L+ +K N++A  +    PLHLAC+ GH ++V +LI +K NIDA  +  + P+HLAC  GH ++V+ L   K NIEA NQ+NW P+HFAC  G KE+V ILI +K +IEA  + N  P+HL+C  GHKE+VE+LI  K +IEA + D W  +HLAC+ G+ ++ ++LI    +IE  +Q +  P+H A   GH ++V++LI    NIEA  + N  P+H A   GH E  +IL+  K +IEA  Q+    +H AC+ GHAE+V++LV+   N +AL  K  +P+ LA ++  +E++E+L
Sbjct: 1267 NWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEIL 1649          

HSP 3 Score: 335.88 bits (860), Expect = 1.642e-93
Identity = 159/379 (41.95%), Postives = 244/379 (64.38%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +HFAC  G  ++V++LI +K N E   + N  P+HLAC+ G++++V+ILI++  + +A  E+   P+H AC RGHKE V++LI +K N++A D+N   PLH AC+ GH ++V +L+ +K NIDA  +    P+HLAC  GH ++V+ L  +K NI+A  +    P+H AC  G KE+V ILI  K +IEA  + N  P+H AC  GHKE+VE+LI  K +IEA + D W  +HL+C  G+ ++ ++LI    +IE  +Q +  P+H AC+ GH E+V++LI    NIEA +++N  P+H AS  GH +  +IL+ +K +IEA  Q     +HLAC  GH E+V++L+R   N EALT    +P+  A ++   E++E+L
Sbjct: 1238 LHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEIL 1616          

HSP 4 Score: 329.331 bits (843), Expect = 2.438e-91
Identity = 154/381 (40.42%), Postives = 249/381 (65.35%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            +H AC  GH ++V++LI  K N E   + N  P+H AC  G++++V+ILI +K + EA +++N  P+H +C+ GHKEVV++LI +K N+EA +++N  PLHLAC+ GH ++V +LI ++ NI+A +Q +  P+H+A   GH K+V+ L  +K NIEA  Q NW P+H AC  G KE+V ILI  K +IEA  + N  P+H AC  GH E+VE+L+  K +I+A  +  +  +HLAC+ G+ ++ ++LI    +I+   +    P+H AC+ GH E+V++L+    NIEA ++ N  P+H A E GH E  KIL+ +K +I+A  Q +   +HLAC++GH E+V++ +R + N  AL  +  +P+ LA ++   E+ +++K+
Sbjct: 1403 LHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIMKE 1783          

HSP 5 Score: 324.324 bits (830), Expect = 1.138e-89
Identity = 156/382 (40.84%), Postives = 245/382 (64.14%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +  +H AC  GH + V++LI +K N +   E    P+H AC+ G+ ++V+IL+++K + +A  E    P+H AC+ GHKEVV++LI +K N++A  +    PLHLAC+ GH ++V +LI  K NI+A +Q +  P+H AC  GH ++V+ L  +K NIEA NQ NW P+H +C  G KE+V ILI +K +IEA  + N  P+HLAC  GHKE+VE+LI  + +IEA +   +  +H+A   G+  + ++LI    +IE   Q +  P+H AC  GH E+V++LI    NIEA  + N  P+H A + GH E  +IL+ +K +I+A A+ +   +HLAC+ GH E+V++L+    N +ALT K ++P+ LA ++  +E++E+L
Sbjct: 1301 YTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEIL 1682          

HSP 6 Score: 319.316 bits (817), Expect = 6.413e-88
Identity = 152/382 (39.79%), Postives = 245/382 (64.14%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +  +H+AC  G  ++V++LI  K N +  A+    P+H AC+ G +++V+ILI +K + EA +++N  P+H AC+ GHKEVV++LI +  N++A  ++   PLHLAC +GH + V++LI +K NIDA D+N   P+H AC  GH ++V+ L  +K NI+A  +  + P+H AC  G KE+V ILI +K +I+A  +K   P+HLAC  GHKE+VE+LI  K +IEA +   W  +H AC  G+ ++ ++LI    +IE  +Q +  P+H +C  GH E+V++LI    NIEA ++ N  P+H A + GH E  +IL+ ++ +IEA  Q     +H+A   GH ++V++L+R   N EAL  +  +P+ LA ++  +E++E+L
Sbjct: 1202 YTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEIL 1583          

HSP 7 Score: 313.923 bits (803), Expect = 3.355e-86
Identity = 149/382 (39.01%), Postives = 242/382 (63.35%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            + A+H +   GH  IV++L++   N          P+H AC  G +++V+ILI  K + +A  +N   P+HFAC+ G KEVV++LI +K N+EA +++N  PLHLAC+ GH ++V +LI +  NIDA  ++   P+HLAC +GH + V+ L  +K NI+A ++  + P+H AC  G  E+V IL+ +K +I+A  +K   P+HLAC  GHKE+VE+LI  K +I+A  +     +HLAC+ G+ ++ ++LI    +IE  +Q++  P+H+AC  GH E+V++LI    NIEA ++ N  P+H +   GH E  +IL+ +K +IEA  Q+    +HLAC+ GH E+V++L+R   N EAL     +P+ +A  +  ++++E+L
Sbjct: 1169 YTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEIL 1550          

HSP 8 Score: 288.5 bits (737), Expect = 1.252e-77
Identity = 141/379 (37.20%), Postives = 229/379 (60.42%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A  +G  + VK LIN   N    +      +H++   G+  IV++L++   +  A D N   P+H+AC  G KEVV++LI  K N++A  KN   PLH AC+ G  ++V +LI +K NI+A +Q++  P+HLAC  GH ++V+ L  +  NI+A  +  + P+H AC +G KE V ILI +K +I+A ++    P+H AC  GH E+VE+L+  K +I+A  +  +  +HLAC+ G+ ++ ++LI    +I+   +    P+H AC+ GH E+V++LI    NIEA ++ N  P+H+A   GH E  +IL+ +K +IEA  Q+    +HL+C  GH E+V++L+R   N EAL     +P+ LA +   +E++E+L
Sbjct: 1139 MHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEIL 1517          

HSP 9 Score: 287.73 bits (735), Expect = 2.062e-77
Identity = 133/317 (41.96%), Postives = 205/317 (64.67%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKIL 1708
            NW  +H +C  GH ++V++LI +K N E   + N  P+HLAC+ G++++V+ILI ++ + EA ++ N  P+H A   GH++VV++LI +K N+EA  + N  PLHLAC  GH ++V +LI  K NI+A  Q++  P+H AC  GH ++V+ L  +K NI+A  +  + P+H AC  G KE+V ILI +K +I+A  +K   P+HLAC  GHKE+VE+L+  K +IEA + D W  +HLACEKG+ ++ ++LI    +I+   Q    P+H AC+ GH E+V++ +  N NI A D     P++ AS+ GH E  KI+
Sbjct: 1465 NWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIM 1781          

HSP 10 Score: 248.825 bits (634), Expect = 1.732e-64
Identity = 139/415 (33.49%), Postives = 220/415 (53.01%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIE--------------------------------QKCDTEAYDENNCRPI-HFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            W A+H+A       I K LI++  N      + + P++LA  +G+ ++V +LIE                                +K    A+ ++   P+ H A   G  E VK LIN   N+ A        LH++   GH  IV LL+D   N++A D N   P+H AC  G  ++V+ L   K NI+A  +    P+HFAC  G+KE+V ILI +K +IEA  + N  P+HLAC  GHKE+VE+LI    +I+A  +  +  +HLAC +G+ +  Q+LI    +I+  D+    P+H AC+ GH E+V++L+    NI+A  +    P+H A + GH E  +IL+ +K +I+A  + +   +HLAC+ GH E+V++L+R   N EAL     +P+  A  +  +E++E+L
Sbjct: 1037 WSALHYAVHHKRIAISKFLIDKGINVNYQTREGKTPLNLAAARGHTEVVILLIEKLIEQFPSRNIIDSAFQTAVQYGHSSVQDMLKRKFPEHAFTKDIDGPLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEIL 1451          

HSP 11 Score: 171.785 bits (434), Expect = 1.020e-39
Identity = 94/339 (27.73%), Postives = 174/339 (51.33%), Query Frame = 2
Query:  890 GYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            G++ +V+IL+E+  D    +      +H+A       + K LI++  N+    +  + PL+LA  +GHT++V LLI++      +    +     A   GH  +   L  +         I+   +H A   G  E V  LI    ++ AP       +H++   GH+ IVE+L+++  ++ A D + +  +H AC  G  ++ ++LI    +I+   +    P+H+AC+ G  E+V++LI    NIEA ++ N  P+H A + GH E  +IL+ +  +I+A  +++   +HLAC +GH E V++L+    N +AL     +P+  A ++   E++E+L
Sbjct: 1014 GHKNLVRILLEKGADINIRNTEGWSALHYAVHHKRIAISKFLIDKGINVNYQTREGKTPLNLAAARGHTEVVILLIEKLIEQFPSRNIIDSAFQTAVQYGHSSVQDMLKRKFPEHAFTKDIDGPLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEIL 1352          

HSP 12 Score: 118.242 bits (295), Expect = 5.231e-23
Identity = 93/372 (25.00%), Postives = 166/372 (44.62%), Query Frame = 2
Query:  896 EKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQ-KCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCD-------IEAC---------------------------DDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            EK +K+ + +     ++   +   I +AC+    E++K ++ Q   +     N  + L +A E G   I   LI+  K + D         +  A   GH  +V+ L  +  +I   N   W  +H+A    +  I   LI K  ++    ++   P++LA  +GH E+V +LI    +       I++                            D DG   +H+A   G  +  + LI+N  ++          +H +   GH  IV+LL+D   N+ A D     P+H+A  +G  E  +IL+  K +I+A A+N+   +H AC+ G  E+V++L+R   N EAL     +P+ LA ++  +E++E+L
Sbjct:  921 EKNIKLFVSKLAQETSFVSKDV--ILWACECNAVELLKYVLPQ---IYFFRPNGTKMLKIAIENGSDKICAYLINDCKVHPDVKFDGGLAALIWAVIYGHKNLVRILLEKGADINIRNTEGWSALHYAVHHKRIAISKFLIDKGINVNYQTREGKTPLNLAAARGHTEVVILLIEKLIEQFPSRNIIDSAFQTAVQYGHSSVQDMLKRKFPEHAFTKDIDG-PLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEIL 1286          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. TrEMBL
Match: A0A1X7T5X6 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 3.553e-86
Identity = 177/393 (45.04%), Postives = 248/393 (63.10%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQ-KCNFETCAEKNQRPIHLACEKGYEKIVK-ILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIVR-LLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIAQ-LLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKK-CDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +  +H+AC +GH +IVK+L N  +CN E     N RP+H ACE G   IV+ ++I + CD  A D     P+H+AC++GH E VK+L N  +CN+EA D  N RPLH ACE G+ DIVR L+ID+ C+++A  +N   P+H AC+KGH +IVK LTN  +CNIEA +    RP+H AC  G  +IV +++I K CD+ A  +    P+H AC KGH EIV++L NH +C++EA      R +H ACE G  DI + L+I+ +CD+   D+I   P+HYACE GH E V++L +   CNIEA D WN RP+H A E+G+V+  + L++ K CD+ A   N    +H ACEKGH EIVK+L   + CN EA     + P+  A +S   +I+  L
Sbjct:  317 YTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHL 709          

HSP 2 Score: 307.76 bits (787), Expect = 5.104e-85
Identity = 176/393 (44.78%), Postives = 248/393 (63.10%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQ-KCNFETCAEKNQRPIHLACEKGYEKIVK-ILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIVR-LLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIAQ-LLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKK-CDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +  +H+AC +GH +IVK+L N  +CN E       RP+H ACE G   IV+ ++I++ CD  A       P+H+AC++GH E+VK+L N  +CNLEA    N RPLH ACE G+ DIVR L+I++ C+++A D+    P+H AC+KGH + VK LTN  +CNIEA +  N RP+H AC  G  +IV +++I K CD+ A       P+H AC KGH EIV++L NH +C++EA      R +H ACE G  DI + L+ID +CD+   D+I   P+HYACE GH E V++L +   CNIEA D WN RP+H A E+G+V+  + L++ K CD+ A  +N    +H ACEKGH EIVK L     CNT+A  +  + P+  A KS+  +I+  L
Sbjct:  453 YTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYL 845          

HSP 3 Score: 292.352 bits (747), Expect = 1.225e-79
Identity = 177/428 (41.36%), Postives = 247/428 (57.71%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIV-KMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKIL-----------------------------------IEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIV-RLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIAQ-LLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKK-CDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            N R +H AC  G+ DIV  ++I++ CN          P+H ACEKG+ +IVKIL                                   I++ CD  A   N   P+H+AC++GH E+VK+L N  +CNLEA    N RPLH ACE G+ DIV  L+ID+ C+++A  ++   P+H AC+KGH +IVK LTN  +CNIEA +  N RP+H AC  G  +IV +++I K CD+ A       P+H AC KGH EIV++L NH +C++EA      R +H ACE G  DI + L+I+ +CD+   D+I   P+HYACE GH E V++L +   CNIEA D WN RP+H A E+G+V+  + L++ K CD+ A  +N    +H ACEKGH EIVK+L     CN EA     + P+  A +S   +I+  L
Sbjct:   78 NDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHL 505          

HSP 4 Score: 291.967 bits (746), Expect = 1.514e-79
Identity = 171/393 (43.51%), Postives = 243/393 (61.83%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQ-KCNFETCAEKNQRPIHLACEKGYEKIV-KILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIVR-LLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIAQ-LLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKK-CDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +  +H+AC EG  +IV++L +  +CN E     N RP+H ACE G   IV  ++I++ C+  A   N   P+H+AC++GH E+VK+L N  +CN+E     N RPLH ACE G+ DIVR L+ID+ C+++A   N   P+H AC+KGH +IVK LTN  +CN+EA    N RP+H AC  G  +IV +++I K CD+ A  K    P+H AC KGH EIV++L NH +C+IEA D+   R +H ACE G  DI + L+ID +CD+         P+HYACE GH EIV++L + + CN+EA   +N RP+H A E+G+V+  + L++ K CD+ A  +     +H ACEKGH E VK+L     CN EA     N P+  A +S   +I+  L
Sbjct:   45 YTPLHYACEEGCFEIVRILTDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHL 437          

HSP 5 Score: 291.197 bits (744), Expect = 2.750e-79
Identity = 176/447 (39.37%), Postives = 252/447 (56.38%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQ-KCNFETCAEKNQRPIHLACEKGYEKIVK-ILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIVR-LLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIAQ-LLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLL-----------------------------------IDANCNIEACDKWNRRPIHYASEAGHVECTKILM-LKKCDIEACAQNERRAIHLACEKGHAEIVK-LLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTP--TKRQSDVMQDEIPH 1960
            +  +H+AC +GH + VK+L N  +CN E     N RP+H ACE G   IV+ ++I++ CD  A   N   P+H+AC++GH E+VK+L N  +CN+EA D +  RPLH ACE G+ DIVR L+ID+ C+++A  +    P+H AC+KGH +IVK LTN  +CN+EA    N RP+H AC  G  +IV +++I K CD+ A ++    P+H AC KGH E V++L NH +C+IEA D+   R +H ACE G  DI + L+ID +CD+         P+HYACE GH EIV++L                                   ID +C++ A D+    P+HYA E GH E  KIL    +C+IEA      R +H ACE G+ +IV+ L++  HC+  A    G +P+  A +    EI++ L   P    +  DV  D   H
Sbjct:  385 YTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLH 831          

HSP 6 Score: 281.182 bits (718), Expect = 9.239e-76
Identity = 168/390 (43.08%), Postives = 238/390 (61.03%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQ-KCNFETCAEKNQRPIHLACEKGYEKIVK-ILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIVR-LLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEA---CDDDGWRAIHLACEKGYADIAQ-LLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKC-DIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQ 1888
            +  +H+AC +GH + VK+L N  +CN E     N RP+H ACE G   IV+ ++I++ CD  A   N   P+H+AC++GH E+VK+L N  +CNLEA    N RPLH ACE G+ DIVR L+ID+ C+++A D+    P+H AC+KGH + VK LTN  +CNIEA +  N RP+H AC  G  +IV +++I K CD+ A  +    P+H AC KGH EIV+ L NH +C+ +A   CDD   R +H AC+    DI + L+ID + D+    +    P+HYACE GH EIV++L +   CN EA D ++ R +H A E G ++  + L++ K  D+ A  +N    +H ACEKGH EIVK+L     CN EA       P+ LA +S+  
Sbjct:  589 YTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDD---RPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAENNDNKWPLHLAIRSRSS 975          

HSP 7 Score: 265.774 bits (678), Expect = 1.384e-70
Identity = 155/361 (42.94%), Postives = 223/361 (61.77%), Query Frame = 2
Query:  854 KNQRPIHLACEKGYEKIVK-ILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIV-RLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIA-QLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKK-CDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +++R +  AC+     IV+ ++I++ CD  A   N   P+H+AC+ G  E+V++L +  +CN+E  D +N RPLH ACE G+ DIV  L+ID+ CN++A  +N   P+H AC+KGH +IVK LTN  +CNIE     N RP+H AC  G  +IV +++I K CD+ A       P+H AC KGH EIV++L NH +C++EA  +   R +H ACE G  DI   L+ID +CD+    +    P+HYACE GH EIV++L +   CNIEA D WN RP+H A E+G+V+  + L++ K CD+ A   N    +H ACEKGH EIVK+L   + CN EA     + P+  A +S   +I+  L
Sbjct:    9 EDRRSLVYACKFRNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEEGCFEIVRILTDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHL 369          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. TrEMBL
Match: A0A1X7TD77 (ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 3.030e-83
Identity = 174/390 (44.62%), Postives = 250/390 (64.10%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQ-KCNFETCAEKNQRPIHLACEKGYEKIVK-ILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIV-RLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIAQ-LLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECT-KILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H+AC +GH +IVK+L N  +CN E   + N RP+H ACE G   IV+ ++I++ CD  A   N   P+H+AC++GH E+VK+L N  +CN+EA +K+N RPLH A + G+ DIV  L+ID+ C+++A   N   P+H AC+KGH +IVK LTN  +CNIEA ++ N RP+H AC  G  +IV +++I K CD+      +L P+H AC KGH EIV++L NH +C+IEA DD  +R +H ACE G  DI + L+ID +CD+         P+HYAC+ GH EIV++L +   CNIEA DK N RP+H A ++G+++    +++ K CD+ A  +N    +H ACEKGH EIVK+L     CN EA       P+  A +S   +I+  L
Sbjct:  253 LHYACKKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGILDIVRHLVIDKHCDVNAKRWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAENKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKACESGNVDIVRHLVIGKHCDVSVTGSNDLTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGKLDIVRHLVIDKHCDVNAKGWNGLTPLHYACKKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGRNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGNVDIVRHL 642          

HSP 2 Score: 286.574 bits (732), Expect = 1.487e-78
Identity = 176/430 (40.93%), Postives = 247/430 (57.44%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVK-MLINQKCNFETCAEKNQRPIHLACEKGYEKIVKIL-----------------------------------IEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIVR-LLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIA-QLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKK---CDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            N+R +H AC  G  DIV+ ++I++ C+          P+H ACEKG+ +IVKIL                                   I++ CD  A   N   P+H+AC++GH E+VK+L N  +CN+EA DK+N RPLH ACE G+ DIVR L+I + C++     N   P+H AC+KGH +IVK LTN  +CNIEA +  N+RP+H AC  G+ +IV +++I K CD+ A     L P+H AC KGH EIV++L NH +C+IEA D    R +H A + G  DI   L+ID +CD+    +    P+HYACE GH EIV++L +   CNIEA D +N RP+H A E+G+V+  + L++ K   CD+ A   N    +H AC+KGH EIVK+L    H N EA     + P+  A  SK  + +  L
Sbjct:  283 NYRPLHKACESGILDIVRHLVIDKHCDVNAKRWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAENKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKACESGNVDIVRHLVIGKHCDVSVTGSNDLTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGKLDIVRHLVIDKHCDVNAKGWNGLTPLHYACKKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGRNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGNVDIVRHLVIDKKKHCDVNAKGGNGLTPLHYACKKGHFEIVKILTNHPHFNIEAKDNSNDRPLHKACASKNLDSVRHL 712          

HSP 3 Score: 286.574 bits (732), Expect = 1.758e-78
Identity = 167/380 (43.95%), Postives = 236/380 (62.11%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQ-KCNFETCAEKNQRPIHLACEKGYEKIVK-ILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIV-RLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIVNILITKK---CDIEAPEKKNLRPIHLACGKGHKEIVEVLINHK-CDIEACDDDGWRAIHLAC-EKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKK-CDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLA 1870
            +H+AC +GH +IVK+L N  +CN E   + N RP+H ACE G   IV+ ++I++ CD  A   N   P+H+ACK+GH E+VK+L N  +CN+EA DK+N RPLH A + G+ DIV  L+ID+ C+++A  +N   P+H AC+KGH +IVK LTN  +CNIEA +  N+RP+H AC  G  +IV  L+  K   CD+ A     L P+H AC KGH EIV++L NH   +IEA D+   R +H AC  K    +  L+ID +CD+         P+HYAC+ GH E V++L D   CNIEA D +N RP+H A ++ +V+  + L++ K CD+ A  +N    +H AC+ GH EIVK+L     CN E+       P+ LA
Sbjct:  457 LHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGKLDIVRHLVIDKHCDVNAKGWNGLTPLHYACKKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGRNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGNVDIVRHLVIDKKKHCDVNAKGGNGLTPLHYACKKGHFEIVKILTNHPHFNIEAKDNSNDRPLHKACASKNLDSVRHLVIDKHCDVNAKGMDGYTPLHYACKTGHFENVKILTDHPQCNIEAEDDYNDRPLHEACKSINVDIVRHLVIDKHCDVNAKGRNGYTPLHYACKVGHFEIVKILTNHPQCNIESEDNNLEKPLHLA 836          

HSP 4 Score: 280.411 bits (716), Expect = 2.328e-76
Identity = 164/395 (41.52%), Postives = 239/395 (60.51%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLIN----QKCNFETCAEKNQRPIHLACEKGYEKIVK-ILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIVR-LLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIAQ-LLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECT-KILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +  +H ACF G+  IV+ L +     +CN E       RP+HLAC+ G   IV  ++I++ CD  A   +   P+H AC+  H E VK+L N  +CN EA D++N RPLH  C+ G+ DIV  L+ID+ C+++A   +   P+H AC+KGH +IVK L+N++   EA ++ N RP+H AC  G  +IV +++I K CD+      +L P+H AC KGH EIV++L NH +C+IEA DD  +R +H ACE G  DI + L+ID +CD+         P+HYACE GH EIV++L +   CNIEA +K N RP+H A ++G+++    +++ K CD+ A   N    +H ACEKGH EIVK+L     CN EA     + P+  A +S   +I+  L
Sbjct:   45 FTPLHVACFNGNFKIVQFLTSCTEITECNIEAKDNGQNRPLHLACQSGNVDIVHHLMIDKHCDVNAKRRDGLSPLHVACENSHFETVKVLTNYPQCNTEAEDESNDRPLHKVCQSGNVDIVHHLVIDKHCHVNAKGMDGYTPLHYACEKGHFEIVKILSNRR-QFEAKDKSNDRPLHKACESGNVDIVHHLVIGKHCDVSVTGSNDLTPLHYACKKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGILDIVRHLVIDKHCDVNAKRWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAENKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKACESGNVDIVRHL 438          

HSP 5 Score: 276.174 bits (705), Expect = 7.049e-75
Identity = 172/425 (40.47%), Postives = 242/425 (56.94%), Query Frame = 2
Query:  764 RAIHFACFEGHADIV-KMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQ-KCDTEAYDENNCR----------------------------------PIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIV-RLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIA-QLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECTKILML-KKCDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            R +H AC  G+ DIV  ++I++ C+          P+H+ACE  + + VK+L    +C+TEA DE+N R                                  P+H+AC++GH E+VK+L N++   EA DK+N RPLH ACE G+ DIV  L+I + C++     N   P+H AC KGH +IVK LTN  +CNIEA +  N+RP+H AC  G  +IV +++I K CD+ A     L P+H AC KGH EIV++L NH +C+IEA +    R +H A + G  DI   L+ID +CD+         P+HYACE GH EIV++L +   CNIEA DK N RP+H A E+G+V+  + L++ K CD+     N+   +H ACEKGH EIVK+L     CN EA       P+  A +S K +I+  L
Sbjct:   83 RPLHLACQSGNVDIVHHLMIDKHCDVNAKRRDGLSPLHVACENSHFETVKVLTNYPQCNTEAEDESNDRPLHKVCQSGNVDIVHHLVIDKHCHVNAKGMDGYTPLHYACEKGHFEIVKILSNRR-QFEAKDKSNDRPLHKACESGNVDIVHHLVIGKHCDVSVTGSNDLTPLHYACKKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGILDIVRHLVIDKHCDVNAKRWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAENKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKACESGNVDIVRHLVIGKHCDVSVTGSNDLTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGKLDIVRHL 506          

HSP 6 Score: 246.899 bits (629), Expect = 9.654e-65
Identity = 162/424 (38.21%), Postives = 233/424 (54.95%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVK-MLINQKCNFETCAEKNQRPIHLACEKGYEKIVKIL-----------------------------------IEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIVR-LLIDQK--CNIDANDQNSNRPIHLACDKGHLKIVKALTNQK-CNIEAANQINWRPIHFACW-KGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIAQ-LLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASE--AGHVECTKILML-KKCDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSK 1882
            N+R +H AC  G  DIV+ ++I++ C+          P+H AC+KG+ +IVKIL                                   I++ CD  A   N   P+H+AC++GH E+VK+L N  +CN+EA D  N RPLH ACE G+ DIVR L+ID+K  C+++A   N   P+H AC KGH +IVK LTN    NIEA +  N RP+H AC  K    + +++I K CD+ A       P+H AC  GH E V++L +H +C+IEA DD   R +H AC+    DI + L+ID +CD+    +    P+HYAC++GH EIV++L +   CNIE+ D    +P+H A      +V   + L++ K+CD+ A  +N    +H ACE+ H +IVK+L     CN EA       P+ LA   K
Sbjct:  487 NYRPLHKACESGKLDIVRHLVIDKHCDVNAKGWNGLTPLHYACKKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGRNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGNVDIVRHLVIDKKKHCDVNAKGGNGLTPLHYACKKGHFEIVKILTNHPHFNIEAKDNSNDRPLHKACASKNLDSVRHLVIDKHCDVNAKGMDGYTPLHYACKTGHFENVKILTDHPQCNIEAEDDYNDRPLHEACKSINVDIVRHLVIDKHCDVNAKGRNGYTPLHYACKVGHFEIVKILTNHPQCNIESEDNNLEKPLHLACTCIFKNVNIVRHLLIDKRCDVNAKERNGYTPLHYACEESHFKIVKILTNHPQCNIEAENKNNKRPLHLAFSHK 910          

HSP 7 Score: 231.876 bits (590), Expect = 1.440e-59
Identity = 147/380 (38.68%), Postives = 218/380 (57.37%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQ-KCNFETCAEKNQRPIHLACEKGYEKIVKILIEQK---CDTEAYDENNCRPIHFACKRGHKEVVKLLINQK-CNLEACDKNNQRPLHLACEKGHTDIVR-LLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACE---KGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYA------SEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHA--EIVKLLVRAHCNTEALTLK 1846
            +H+AC +GH +IVK+L N  +CN E   + N RP+H ACE G   IV+ L+  K   CD  A   N   P+H+ACK+GH E+VK+L N    N+EA D +N RPLH AC   + D VR L+ID+ C+++A   +   P+H AC  GH + VK LT+  +CNIEA +  N RP+H AC     +IV +++I K CD+ A  +    P+H AC  GH EIV++L NH +C+IE+ D++  + +HLAC    K    +  LLID  CD+   ++    P+HYACE  H +IV++L +   CNIEA +K N+RP+H A      +E+     + ++  K C+ +   +     +H+    G A   +VK ++         TLK
Sbjct:  593 LHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGNVDIVRHLVIDKKKHCDVNAKGGNGLTPLHYACKKGHFEIVKILTNHPHFNIEAKDNSNDRPLHKACASKNLDSVRHLVIDKHCDVNAKGMDGYTPLHYACKTGHFENVKILTDHPQCNIEAEDDYNDRPLHEACKSINVDIVRHLVIDKHCDVNAKGRNGYTPLHYACKVGHFEIVKILTNHPQCNIESEDNNLEKPLHLACTCIFKNVNIVRHLLIDKRCDVNAKERNGYTPLHYACEESHFKIVKILTNHPQCNIEAENKNNKRPLHLAFSHKPLTESQWDIASYLVQDKGCNTQGIDKKATTYLHIRQSSGIALLRVVKCILTGPPGAGKSTLK 972          

HSP 8 Score: 229.18 bits (583), Expect = 1.141e-58
Identity = 136/341 (39.88%), Postives = 200/341 (58.65%), Query Frame = 2
Query:  908 KILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLIN----QKCNLEACDKNNQRPLHLACEKGHTDIV-RLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIA-QLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKK-CDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQEII 1897
            +I+I ++ D  A   +   P+H AC  G+ ++V+ L +     +CN+EA D    RPLHLAC+ G+ DIV  L+ID+ C+++A  ++   P+H+AC+  H + VK LTN  +CN EA ++ N RP+H  C  G  +IV +++I K C + A       P+H AC KGH EIV++L N +   EA D    R +H ACE G  DI   L+I  +CD+ V       P+HYAC+ GH EIV++L +   CNIEA D +N RP+H A E+G ++  + L++ K CD+ A   N    +H ACEKGH EIVK+L     CN EA     + P+  A +S   +I+
Sbjct:   28 QIVIYKQYDVNAKGRDGFTPLHVACFNGNFKIVQFLTSCTEITECNIEAKDNGQNRPLHLACQSGNVDIVHHLMIDKHCDVNAKRRDGLSPLHVACENSHFETVKVLTNYPQCNTEAEDESNDRPLHKVCQSGNVDIVHHLVIDKHCHVNAKGMDGYTPLHYACEKGHFEIVKILSNRR-QFEAKDKSNDRPLHKACESGNVDIVHHLVIGKHCDVSVTGSNDLTPLHYACKKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGILDIVRHLVIDKHCDVNAKRWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAENKSNDRPLHKAFQSGNLDIV 367          

HSP 9 Score: 174.481 bits (441), Expect = 7.371e-41
Identity = 108/287 (37.63%), Postives = 166/287 (57.84%), Query Frame = 2
Query: 1076 ACEKGHTDIV-RLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTN----QKCNIEAANQINWRPIHFACWKGQKEIV-NILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACEKGYADIA-QLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILML-KKCDIEACAQNERRAIHLACEKGHAEIVKLLV-RAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            AC+  + DI+ +++I ++ +++A  ++   P+H+AC  G+ KIV+ LT+     +CNIEA +    RP+H AC  G  +IV +++I K CD+ A  +  L P+H+AC   H E V+VL N+ +C+ EA D+   R +H  C+ G  DI   L+ID +C +         P+HYACE GH EIV++L +     EA DK N RP+H A E+G+V+    L++ K CD+     N+   +H AC+KGH EIVK+L     CN EA       P+  A +S   +I+  L
Sbjct:   17 ACKSNNLDILHQIVIYKQYDVNAKGRDGFTPLHVACFNGNFKIVQFLTSCTEITECNIEAKDNGQNRPLHLACQSGNVDIVHHLMIDKHCDVNAKRRDGLSPLHVACENSHFETVKVLTNYPQCNTEAEDESNDRPLHKVCQSGNVDIVHHLVIDKHCHVNAKGMDGYTPLHYACEKGHFEIVKILSNRR-QFEAKDKSNDRPLHKACESGNVDIVHHLVIGKHCDVSVTGSNDLTPLHYACKKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGILDIVRHL 302          

HSP 10 Score: 173.711 bits (439), Expect = 1.197e-40
Identity = 114/321 (35.51%), Postives = 172/321 (53.58%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQK---CNFETCAEKNQRPIHLACEKGYEKIVKIL-----------------------------------IEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIVR-LLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFAC---WKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH-KCDIEACDDDGWRAIHLACE-----KGYADIAQLLI-DNNCDIEVCDQISKRPIH 1567
            N+R +H AC  G+ DIV+ L+  K   C+          P+H AC+KG+ +IVKIL                                   I++ CD  A   +   P+H+ACK GH E VK+L +  +CN+EA D  N RPLH AC+  + DIVR L+ID+ C+++A  +N   P+H AC  GH +IVK LTN  +CNIE+ +    +P+H AC   +K    + ++LI K+CD+ A E+    P+H AC + H +IV++L NH +C+IEA + +  R +HLA       +   DIA  L+ D  C+ +  D+ +   +H
Sbjct:  623 NYRPLHKACESGNVDIVRHLVIDKKKHCDVNAKGGNGLTPLHYACKKGHFEIVKILTNHPHFNIEAKDNSNDRPLHKACASKNLDSVRHLVIDKHCDVNAKGMDGYTPLHYACKTGHFENVKILTDHPQCNIEAEDDYNDRPLHEACKSINVDIVRHLVIDKHCDVNAKGRNGYTPLHYACKVGHFEIVKILTNHPQCNIESEDNNLEKPLHLACTCIFKNVNIVRHLLIDKRCDVNAKERNGYTPLHYACEESHFKIVKILTNHPQCNIEAENKNNKRPLHLAFSHKPLTESQWDIASYLVQDKGCNTQGIDKKATTYLH 943          

HSP 11 Score: 95.9005 bits (237), Expect = 2.544e-16
Identity = 62/204 (30.39%), Postives = 103/204 (50.49%), Query Frame = 2
Query: 1373 ACGKGHKEIV-EVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLID----NNCDIEVCDQISKRPIHYACEMGHTEIVQ-LLIDANCNIEACDKWNRRPIHYASEAGHVECTKILM-LKKCDIEACAQNERRAIHLACEKGHAEIVK-LLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIPH 1960
            AC   + +I+ +++I  + D+ A   DG+  +H+AC  G   I Q L        C+IE  D    RP+H AC+ G+ +IV  L+ID +C++ A  +    P+H A E  H E  K+L    +C+ EA  ++  R +H  C+ G+ +IV  L++  HC+  A  + G +P+  A +    EI+++L         D   D   H
Sbjct:   17 ACKSNNLDILHQIVIYKQYDVNAKGRDGFTPLHVACFNGNFKIVQFLTSCTEITECNIEAKDNGQNRPLHLACQSGNVDIVHHLMIDKHCDVNAKRRDGLSPLHVACENSHFETVKVLTNYPQCNTEAEDESNDRPLHKVCQSGNVDIVHHLVIDKHCHVNAKGMDGYTPLHYACEKGHFEIVKILSNRRQFEAKDKSNDRPLH 220          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. TrEMBL
Match: A0A182GJR2 (Uncharacterized protein OS=Aedes albopictus OX=7160 GN=RP20_CCG011139 PE=4 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 4.555e-83
Identity = 147/382 (38.48%), Postives = 232/382 (60.73%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            WR +H AC  G  + V++ + +  N  T   K   P+HLAC  G++++V+IL+ +K + +A + N+  P+HFAC+ GHKE+V++LI +  N+++  +N   PLHLACEKGH ++V + I +K NI+A  +N   P+HLAC  GH ++V+ L  +K NI+A    N+ P+H+ C  G KE+V ILI  K  I+A  +    P+H AC  GHKE++E+LI  K +I+A     +  +H AC  G+ ++ ++LI    +I+   +    P+H+AC  GH EIV+ LI    NI+A    N  P+H+A   GH E  +IL+ K  +I+A        +H AC  GH E+VK L+R   N +ALT K ++P+  A ++  +E++E+L
Sbjct: 1306 WRPLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTLLREKANIDALTHKNSTPLHWACRNGHKEVVEIL 1687          

HSP 2 Score: 292.352 bits (747), Expect = 5.910e-79
Identity = 137/355 (38.59%), Postives = 217/355 (61.13%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEA 1834
            +H AC  GH ++V++L+ +K N +     +  P+H AC+ G++++V+ILI +  + ++  +N   P+H AC++GHKEVV++ I +K N+EA  +N   PLHLAC  GH ++V +LI +K NIDA    +  P+H  C  GH ++VK L   K +I+A  +  + P+HFAC  G KE++ ILI +K +I+A   KN  P+H AC  GHKE+VE+LI  K +I+A  +  +  +H AC  G+ +I + LI    +I+     +  P+H+AC  GH EIV++L+  N NI+A    N  P+H+A   GH E  K L+ +K +I+A        +H AC  GH E+V++L++   N +A
Sbjct: 1342 LHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTLLREKANIDALTHKNSTPLHWACRNGHKEVVEILIKEKANIDA 1696          

HSP 3 Score: 292.352 bits (747), Expect = 6.190e-79
Identity = 146/379 (38.52%), Postives = 225/379 (59.37%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +HFAC  GH  I ++L+ +K N +     N  P+ LAC+ G++KI +IL+ +K    A D    RP+H AC  G KE V++ + +  N+   D     PLHLAC  GH ++V++L+ +K NIDA++ NS  P+H AC  GH ++V+ L  +  NI++  Q    P+H AC KG KE+V I I +K +IEA  +    P+HLAC  GHKE+VE+LI  K +I+A     +  +H  C  G+ ++ ++LI     I+   +    P+H+ACE GH E++++LI    NI+A    N  P+H+A   GH E  +IL+  K +I+A A+ +   +H AC  GH EIVK L+R   N +ALT +  +P+  A ++  +EI+E+L
Sbjct: 1243 LHFACQNGHKKIAEILLRKKANIDALNGWNCTPLLLACQNGHKKIAEILLREKAKIAALDHMRWRPLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEIL 1621          

HSP 4 Score: 290.426 bits (742), Expect = 2.959e-78
Identity = 142/377 (37.67%), Postives = 224/377 (59.42%), Query Frame = 2
Query:  776 FACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             AC  GH  I ++L+ +K           RP+HLAC  G ++ V+I + +  +    D     P+H AC  GHKEVV++L+ +K N++A + N+  PLH AC+ GH ++V +LI +  NID+  QN   P+HLAC+KGH ++V+    +K NIEA  +  + P+H AC  G KE+V ILI +K +I+A   KN  P+H  C  GHKE+V++LI  K  I+A  ++ +  +H ACE G+ ++ ++LI    +I+     +  P+H+AC  GH E+V++LI    NI+A  +    P+H+A   GH E  K L+ KK +I+A        +H AC  GH EIV++LVR + N +ALT +  +P+  A ++  +E+++ L
Sbjct: 1278 LACQNGHKKIAEILLREKAKIAALDHMRWRPLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTL 1654          

HSP 5 Score: 290.041 bits (741), Expect = 3.463e-78
Identity = 138/343 (40.23%), Postives = 216/343 (62.97%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIV 1798
            +HFAC  GH ++V++LI +  N ++ A+    P+HLACEKG++++V+I I +K + EA  EN   P+H AC  GHKEVV++LI +K N++A    N  PLH  C  GH ++V++LI  K +IDA  +N   P+H AC+ GH ++++ L  +K NI+A    N+ P+H+AC  G KE+V ILI  K +I+A  +K   P+H AC  GHKEIV+ LI  K +I+A   + +  +H AC  G+ +I ++L+  N +I+     +  P+H+AC  GH E+V+ L+    NI+A    N  P+H+A   GH E  +IL+ +K +I+A A+N+  ++H AC  G  ++V
Sbjct: 1375 LHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTLLREKANIDALTHKNSTPLHWACRNGHKEVVEILIKEKANIDASAENKFTSLHKACSNGLEDVV 1717          

HSP 6 Score: 277.33 bits (708), Expect = 5.808e-74
Identity = 134/380 (35.26%), Postives = 227/380 (59.74%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +H +  +G+  +V++L++   N          P+H AC+ G++KI +IL+ +K + +A +  NC P+  AC+ GHK++ ++L+ +K  + A D    RPLHLAC  G  + V + + +  NI  ND   + P+HLAC  GH ++V+ L  +K NI+A+N  +  P+HFAC  G KE+V ILI +  +I++  +  + P+HLAC KGHKE+VE+ I  K +IEA  ++ +  +HLAC  G+ ++ ++LI    +I+     +  P+H+ C  GH E+V++LI    +I+A  +    P+H+A E GH E  +IL+ +K +I+A        +H AC  GH E+V++L+R   N +AL  K  +P+  A ++  +EI++ L
Sbjct: 1209 VLHLSSSKGYCLVVELLLSNGANVNAVDTNKCTPLHFACQNGHKKIAEILLRKKANIDALNGWNCTPLLLACQNGHKKIAEILLREKAKIAALDHMRWRPLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKL 1588          

HSP 7 Score: 261.922 bits (668), Expect = 7.773e-69
Identity = 141/400 (35.25%), Postives = 223/400 (55.75%), Query Frame = 2
Query:  731 SLSKLII*KNWRAIHFACF--------EGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            SL K++I +  +     CF        EG    ++ LIN   N           +HL+  KGY  +V++L+    +  A D N C P+HFAC+ GHK++ ++L+ +K N++A +  N  PL LAC+ GH  I  +L+ +K  I A D    RP+HLAC  G  + V+    +  NI   +     P+H AC  G KE+V IL+ +K +I+A    +L P+H AC  GHKE+VE+LI    +I++   +    +HLACEKG+ ++ ++ I    +IE   +    P+H AC  GH E+V++LI    NI+A    N  P+H+    GH E  KIL+  K  I+A A+N+   +H ACE GH E++++L++   N +ALT K  +P+  A ++  +E++E+L
Sbjct: 1156 SLKKMLIREYIKLPALGCFVDLDILAWEGIIKKLERLINDGANVNAPNSTGCTVLHLSSSKGYCLVVELLLSNGANVNAVDTNKCTPLHFACQNGHKKIAEILLRKKANIDALNGWNCTPLLLACQNGHKKIAEILLREKAKIAALDHMRWRPLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEIL 1555          

HSP 8 Score: 230.72 bits (587), Expect = 1.263e-58
Identity = 110/280 (39.29%), Postives = 166/280 (59.29%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIV 1600
            +  +H AC  GH ++V++LI +K N +    KN  P+H  C  G++++VKILI  K   +A  EN   P+HFAC+ GHKEV+++LI +K N++A    N  PLH AC  GH ++V +LI  K NIDA  +    P+H AC  GH +IVK L  +K NI+A    N+ P+H+AC  G +EIV IL+ K  +I+A   +N  P+H AC  GHKE+V+ L+  K +I+A        +H AC  G+ ++ ++LI    +I+   +     +H AC  G  ++V
Sbjct: 1438 FTPLHLACVNGHKEVVEILIKEKANIDALTHKNFTPLHWTCRNGHKEVVKILIRGKASIDALAENKFTPLHFACENGHKEVIEILIKEKANIDALTHKNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTLLREKANIDALTHKNSTPLHWACRNGHKEVVEILIKEKANIDASAENKFTSLHKACSNGLEDVV 1717          

HSP 9 Score: 212.616 bits (540), Expect = 9.019e-53
Identity = 131/414 (31.64%), Postives = 205/414 (49.52%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCR-PIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDA-----------------------ND-QNSNRP-------IHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            W A+H+A       I K+LI++  +  +  +K    +H+AC  G   + ++LI QKC  +    N  + P+  A   GH EVV +LI                L      GH  + ++LI +   + A                       ND  N N P       +HL+  KG+  +V+ L +   N+ A +     P+HFAC  G K+I  IL+ KK +I+A    N  P+ LAC  GHK+I E+L+  K  I A D   WR +HLAC  G  +  ++ +    +I   D     P+H AC  GH E+VQ+L+    NI+A +  +  P+H+A + GH E  +IL+ +  +I++ AQN+   +HLACEKGH E+V++ +R   N EAL     +P+ LA  +  +E++E+L
Sbjct: 1044 WSALHYAVHNKQITITKLLIDKGTDVNSITKKKWNALHIACNSGDADMTRMLI-QKCARDDVTTNKGKTPLDLAAAGGHTEVVIILIENMIETFLLSWKTDDVLWNVVINGHDSLKKMLIREYIKLPALGCFVDLDILAWEGIIKKLERLINDGANVNAPNSTGCTVLHLSSSKGYCLVVELLLSNGANVNAVDTNKCTPLHFACQNGHKKIAEILLRKKANIDALNGWNCTPLLLACQNGHKKIAEILLREKAKIAALDHMRWRPLHLACMSGLKEAVEIFLAEGVNICTNDYKYSTPLHLACLYGHKEVVQILLREKANIDASNNNSLTPLHFACQNGHKELVEILIRENANIDSEAQNKITPLHLACEKGHKEVVEIFIREKANIEALAENKFTPLHLACVNGHKEVVEIL 1456          

HSP 10 Score: 158.303 bits (399), Expect = 1.561e-35
Identity = 72/184 (39.13%), Postives = 118/184 (64.13%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVN 1306
            KN+  +H+AC  GH ++V++LI  K N +  AEK   P+H AC  G+++IVK LI +K + +A    N  P+H+AC+ GH+E+V++L+ +  N++A    N  PLH AC  GH ++V+ L+ +K NIDA    ++ P+H AC  GH ++V+ L  +K NI+A+ +  +  +H AC  G +++VN
Sbjct: 1535 KNFTPLHWACRNGHKEVVEILIRGKANIDALAEKKFTPLHFACRNGHKEIVKKLIRKKANIDALTHENFTPLHWACRNGHREIVEILVRKNSNIDALTHRNFTPLHWACRNGHKEVVKTLLREKANIDALTHKNSTPLHWACRNGHKEVVEILIKEKANIDASAENKFTSLHKACSNGLEDVVN 1718          

HSP 11 Score: 99.7525 bits (247), Expect = 2.336e-17
Identity = 86/376 (22.87%), Postives = 165/376 (43.88%), Query Frame = 2
Query:  896 EKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ-KCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQ-KCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDN----------------NCDIEVCDQISKRPIHYACEM---------------GHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            EK +K+ +E+     ++D  +   + +AC+     ++K ++++ + N     K   + LH+A + G   I   LI+  K + D        P+H A   GH+ +V+ L  +  +I   N   W  +H+A    Q  I  +LI K  D+ +  KK    +H+AC  G  ++  +LI      +   + G   + LA   G+ ++  +LI+N                N  I   D + K  I    ++               G  + ++ LI+   N+ A +      +H +S  G+    ++L+    ++ A   N+   +H AC+ GH +I ++L+R   N +AL     +P+ LA ++  ++I E+L +   K
Sbjct:  925 EKNIKLFVEKIAHETSFDSKDV--VFWACESNAVGLLKYVLSKIRINFLFKPKP-AKMLHIAIKNGSDKICSYLIEDCKVHPDVKYHGGLAPLHSAIIYGHINLVQLLLRKGADIHCRNTEGWSALHYAVHNKQITITKLLIDKGTDVNSITKKKWNALHIACNSGDADMTRMLIQKCARDDVTTNKGKTPLDLAAAGGHTEVVIILIENMIETFLLSWKTDDVLWNVVINGHDSLKKMLIREYIKLPALGCFVDLDILAWEGIIKKLERLINDGANVNAPNSTGCTVLHLSSSKGYCLVVELLLSNGANVNAVDTNKCTPLHFACQNGHKKIAEILLRKKANIDALNGWNCTPLLLACQNGHKKIAEILLREKAK 1297          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. TrEMBL
Match: A0A182H2I6 (Uncharacterized protein OS=Aedes albopictus OX=7160 GN=RP20_CCG020406 PE=4 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 8.450e-83
Identity = 152/384 (39.58%), Postives = 237/384 (61.72%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            KN   +H AC  GH ++V++LI  K N +  A +N  P+HLAC+ G +++VK+L+ +K +  A    NC P+H AC  GHKEVV++L+ +K N++A D+    PLHLAC+ GH ++V +LI +K NIDA    +  P+HLAC  G  ++V+ L  +K NI+A    N  PIH A   G KE+V IL  +K +I+A + +N  P+HLAC  GHKE+ EVLI    ++ A D+     +HLAC+ G+ ++ ++LI    +I   D  +  P+H AC  GH E+V++L+    NI+A +  N  P+H A + GH+E  +IL+ +K +++A A      +HLAC  GH E+ ++L+R   N  AL  K  +P+ LA ++  +E++E+L
Sbjct: 1266 KNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEIL 1649          

HSP 2 Score: 303.138 bits (775), Expect = 1.928e-82
Identity = 155/384 (40.36%), Postives = 235/384 (61.20%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +N   +H AC  GH ++ ++LI +K N +    KN  P+HLAC  G+ ++V+ILI  K + +A    N  P+H AC+ G KEVVK+L+ +K N+ A    N  PLHLAC  GH ++V +L+ +K NIDA D+  + P+HLAC  GH ++V+ L  +K NI+A    N+ P+H AC  GQKE+V +LI +K +I+A   +N  PIHLA   GHKE+VE+L   K +I+A D      +HLAC  G+ ++A++LI    ++   D+    P+H AC+ GH E+V++LI    NI A D  N  P+H A   GH E  +IL+ +K +I+A        +HLAC+ GH E+V++L+R   N +AL  +  +P+ LA  +  +E+ E+L
Sbjct: 1233 ENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVL 1616          

HSP 3 Score: 300.442 bits (768), Expect = 1.301e-81
Identity = 152/384 (39.58%), Postives = 236/384 (61.46%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K    +H AC  GH ++V++LI +K N +  A +N  P+HLAC  G +++V++LI +K + +A    NC PIH A   GHKEVV++L  +K N++A D  N  PLHLAC  GH ++  +LI +  N++A D+    P+HLAC  GH ++V+ L   K NI A +  N  P+H AC+ G KE+V IL+ +K +I+A E +N  P+HLAC  GH E+VE+LI  K +++A   +    +HLAC  G+ ++A++LI    ++   D+    P+H AC+ GH E+V++LI    NI+A D  N  P+H A   GH E  +IL+ +K +I+A        +HLAC+ GH E+V++L+R   N +AL  +  +P+ LA  +  +E+ E+L
Sbjct: 1365 KKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVL 1748          

HSP 4 Score: 298.13 bits (762), Expect = 8.447e-81
Identity = 154/384 (40.10%), Postives = 235/384 (61.20%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +N   +H AC  GH ++V++LI +K N +T  E+   P+H AC KG++++V++LI ++ +  A    N  P+H AC  GHKEVVK+LI +K N+EA    N  PLHLAC  GH ++  +LI +K NIDA +  +  P+HLAC  GH ++V+ L   K NI+A    N+ P+H AC  GQKE+V +L+ +K +I A   +N  P+HLAC  GHKE+VE+L+  K +I+A D+     +HLAC+ G+ ++ ++LI    +I+     +  P+H AC  G  E+V++LI    NI+A    N  PIH AS  GH E  +IL  +K +I+A        +HLAC  GH E+ ++L+R   N  AL  K  +P+ LA ++  +E++E+L
Sbjct: 1134 ENSTPLHLACLNGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEIL 1517          

HSP 5 Score: 298.13 bits (762), Expect = 9.528e-81
Identity = 150/401 (37.41%), Postives = 242/401 (60.35%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            +N   +H ACF GH ++V++L+ +K N +    +N  P+HLAC+ G+ ++V+ILI +K + +A    NC P+H AC  GHKEV ++LI +  N+ A D+    PLHLAC+ GH ++V +LI  K +IDA    +  P+HLAC  G  ++V+ L  +K NI+A    N  PIH A   G KE+V IL  +K +I+A + +N  P+HLAC  GHKE+ EVLI    ++ A D+     +HLAC+ G+ ++ ++LI    +I+  D  +  P+H AC  GH E+V++L+    NI+A +  N  P+H A + GH+E  +IL+ +K +++A A      +HLAC  GH E+ ++L+R   N  AL  K  +P+ LA ++  +E++E+L +      +  +++  P
Sbjct: 1662 RNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTP 2062          

HSP 6 Score: 297.36 bits (760), Expect = 1.486e-80
Identity = 151/384 (39.32%), Postives = 236/384 (61.46%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K    +H AC  GH ++V++LI  K N +    +N  P+HLAC  G++++V+IL+ +K + +A +  NC P+H AC+ GH EVV++LI +K N++A    N  PLHLAC  GH ++  +LI +  N++A D+    P+HLAC  GH ++V+ L   K +I+A    N+ P+H AC  GQKE+V +LI +K +I+A   +N  PIHLA   GHKE+VE+L   K +I+A D      +HLAC  G+ ++A++LI    ++   D+    P+H AC+ GH E+V++LI    NI+A D  N  P+H A   GH E  +IL+ +K +I+A        +HLAC+ GH E+V++L+R   N +AL  +  +P+ LA  +  +E+ E+L
Sbjct: 1629 KKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVL 2012          

HSP 7 Score: 296.975 bits (759), Expect = 1.873e-80
Identity = 151/401 (37.66%), Postives = 242/401 (60.35%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            +N+  +H AC  G  ++V++LI +K N +  A +N  PIHLA   G++++V+IL  +K + +A D  NC P+H AC  GHKEV ++LI +  N+ A D+    PLHLAC+ GH ++V +LI  K NI A D  +  P+HLAC  GH ++V+ L  +K NI+A    N  P+H AC  G  E+V ILI +K +++A   +N  P+HLAC  GHKE+ EVLI    ++ A D+     +HLAC+ G+ ++ ++LI    +I+  D  +  P+H AC  GH E+V++L+    NI+A +  N  P+H A + GH+E  +IL+ +K +++A A      +HLAC  GH E+ ++L+R   N  AL  K  +P+ LA ++  +E++E+L +      +  +++  P
Sbjct: 1398 ENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTP 1798          

HSP 8 Score: 296.975 bits (759), Expect = 2.073e-80
Identity = 151/379 (39.84%), Postives = 232/379 (61.21%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +HFAC +GH ++V++LI ++ N    A +N  P+HLAC  G++++VK+LI +K + EA    NC P+H AC  GHKEV ++LI +K N++A +  N  PLHLAC  GH ++V +LI  K NIDA    +  P+HLAC  G  ++VK L  +K NI A    N  P+H AC  G KE+V IL+ +K +I+A ++K   P+HLAC  GHKE+VE+LI  K +I+A   + +  +HLAC  G  ++ ++LI    +I+     +  PIH A   GH E+V++L     NI+A D  N  P+H A   GH E  ++L+ K  ++ A  + +   +HLAC+ GH E+V++L+R   N  A   +  +P+ LA  +  +E++E+L
Sbjct: 1172 LHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEIL 1550          

HSP 9 Score: 296.59 bits (758), Expect = 3.002e-80
Identity = 147/386 (38.08%), Postives = 234/386 (60.62%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            +N   +H AC  GH ++ ++LI +  N     EK   P+HLAC+ G++++V+ILI  K +  A D  NC P+H AC  GHKEVV++L+ +K N++A +  N  PLHLAC+ GH ++V +LI +K N+DA    +  P+HLAC  GH ++ + L  +  N+ A ++    P+H AC  G KE+V ILI  K +I+A + +N  P+HLAC  GHKE+VE+L+  K +I+A +      +HLAC+ G+ ++ ++LI    +++     +  P+H AC  GH E+ ++LI    N+ A D+    P+H A + GH E  +IL+  K  I+A A      +HLAC  G  E+V++L+R   N +AL L+  +PI LA  +  +E++E+L +
Sbjct: 1464 RNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAR 1849          

HSP 10 Score: 294.278 bits (752), Expect = 1.407e-79
Identity = 152/384 (39.58%), Postives = 231/384 (60.16%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +N   +H ACF GH ++V++L+ +K N +    +N  P+HLAC+ G+ ++V+ILI +K + +A    NC P+H AC  GHKEV ++LI +  N+ A D+    PLHLAC+ GH ++V +LI  K NIDA D  +  P+HLAC  GH ++V+ L  +K NI+A    N  P+H AC  G  E+V ILI +K +++A   +N  P+HLAC  GHKE+ EVLI    ++ A D+     +HLAC+ G+ ++ ++LI     I+     +  P+H AC  G  E+V++LI    NI+A    N  PIH AS  GH E  +IL  +K +I+A        +HLAC  GH E+ ++L+R   N  AL  K  +P+ LA ++  +E++E+L
Sbjct: 1530 RNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEIL 1913          

HSP 11 Score: 292.352 bits (747), Expect = 7.640e-79
Identity = 143/384 (37.24%), Postives = 236/384 (61.46%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +N   IH A   GH ++V++L  +K N +    +N  P+HLAC  G++++ ++LI +  +  A DE    P+H AC+ GHKEVV++LI  K N+ A D  N  PLHLAC  GH ++V +L+ +K NIDA +  +  P+HLAC  GH+++V+ L  +K N++A    N  P+H AC  G KE+  +LI K  ++ A ++K   P+HLAC  GHKE+VE+LI  K +I+A D      +HLAC  G+ ++ ++L+    +I+  +  +  P+H AC+ GH E+V++LI    N++A    N  P+H A   GH E  ++L+ K  ++ A  + +   +HLAC+ GH E+V++L+R   + +A+ L+  +P+ LA  + ++E++E+L
Sbjct: 1431 ENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVL 1814          

HSP 12 Score: 292.352 bits (747), Expect = 7.928e-79
Identity = 146/384 (38.02%), Postives = 235/384 (61.20%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +N+  +H AC  G  ++VK+L+ +K N    A +N  P+HLAC  G++++V+IL+ +K + +A DE    P+H AC+ GHKEVV++LI +K N++A    N  PLHLAC  G  ++V +LI +K NIDA    +  PIHLA   GH ++V+ L  +K NI+A +  N  P+H AC  G KE+  +LI K  ++ A ++K   P+HLAC  GHKE+VE+LI  K +I A D      +HLAC  G+ ++ ++L+    +I+  +  +  P+H AC+ GH E+V++LI    N++A    N  P+H A   GH E  ++L+ K  ++ A  + +   +HLAC+ GH E+V++L+R   N +A   +  +P+ LA  +  +E++E+L
Sbjct: 1299 ENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEIL 1682          

HSP 13 Score: 291.197 bits (744), Expect = 1.739e-78
Identity = 146/384 (38.02%), Postives = 233/384 (60.68%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +N   +H AC  GH ++V++LI +K N +  A +N  P+HLAC  G++++ ++LI +  +  A DE    P+H AC+ GHKEVV++LI  K N++A D  N  PLHLAC  GH ++V +L+ +K NIDA +  +  P+HLAC  GH+++V+ L  +K N++A    N  P+H AC  G KE+  +LI K  ++ A ++K   P+HLAC  GHKE+VE+LI  K  I+A   + +  +HLAC  G  ++ ++LI    +I+     +  PIH A   GH E+V++L     NI+A D  N  P+H A   GH E  ++L+ K  ++ A  + +   +HLAC+ GH E+V++L+R   N +A   +  +P+ LA  +  +E++E+L
Sbjct: 1563 RNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEIL 1946          

HSP 14 Score: 288.5 bits (737), Expect = 1.339e-77
Identity = 144/384 (37.50%), Postives = 236/384 (61.46%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +N   +H AC  GH ++V++LI +K N +  A +N  P+HLAC  G++++ ++LI +  +  A DE    P+H AC+ GHKEVV++LI  K +++A    N  PLHLAC  G  ++V +LI +K NIDA    +  PIHLA   GH ++V+ L  +K NI+A +  N  P+H AC  G KE+  +LI K  ++ A ++K   P+HLAC  GHKE+VE+LI  K +I+A D      +HLAC  G+ ++ ++L+    +I+  +  +  P+H AC+ GH E+V++LI    N++A    N  P+H A   GH E  ++L+ K  ++ A  + +   +HLAC+ GH E+V++L+R   + +A+ L+  +P+ LA  + ++E++E+L
Sbjct: 1695 RNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVL 2078          

HSP 15 Score: 286.574 bits (732), Expect = 6.488e-77
Identity = 146/384 (38.02%), Postives = 232/384 (60.42%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K    +H AC  GH ++V++LI  K N      +N  P+HLAC  G++++V+IL+ +K + +A +  NC P+H AC+ GH EVV++LI +K N++A    N  PLHLAC  GH ++  +LI +  N++A D+    P+HLAC  GH ++V+ L   K NI+A +  N  P+H AC+ G KE+V IL+ +K +I+A E +N  P+HLAC  GH E+VE+LI  K +++A   +    +HLAC  G+ ++A++LI    ++   D+    P+H AC+ GH E+V++LI    +I+A    N  P+H A   G  E  ++L+ +K +I+A A      IHLA   GH E+V++L R   N +A   +  +P+ LA  +  +E+ E+L
Sbjct: 1497 KKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVL 1880          

HSP 16 Score: 285.034 bits (728), Expect = 1.773e-76
Identity = 144/384 (37.50%), Postives = 231/384 (60.16%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +N   +H AC  GH ++V++L+ +K N +   EK   P+HLAC+ G++++V+ILI +K + +A    N  P+H AC  G KEVV++LI +K N++A    N  P+HLA   GH ++V +L  +K NIDA D  +  P+HLAC  GH ++ + L  +  N+ A ++    P+H AC  G KE+V ILI  K +I A + +N  P+HLAC  GHKE+VE+L+  K +I+A +      +HLAC+ G+ ++ ++LI    +++     +  P+H AC  GH E+ ++LI    N+ A D+    P+H A + GH E  +IL+  K +I+A        +HLAC  GH E+V++LVR   N +AL  +  +P+ LA ++   E++E+L
Sbjct: 1332 ENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEIL 1715          

HSP 17 Score: 283.878 bits (725), Expect = 4.459e-76
Identity = 147/396 (37.12%), Postives = 232/396 (58.59%), Query Frame = 2
Query:  725 EKSLSKLII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            EKS    +  +N   +H AC  GH ++ ++LI +  N     EK   P+HLAC+ G++++V+ILI  K   +A    N  P+H AC  G KEVV++LI +K N++A    N  P+HLA   GH ++V +L  +K NIDA D  +  P+HLAC  GH ++ + L  +  N+ A ++    P+H AC  G KE+V ILI  K +I+A + +N  P+HLAC  GHKE+VE+L+  K +I+A +      +HLAC+ G+ ++ ++LI    +++     +  P+H AC  GH E+ ++LI    N+ A D+    P+H A + GH E  +IL+  K  I+A A      +HLAC  G  E+V++L+R   N +AL L+  +PI LA  +  +E++E+L +
Sbjct: 1718 EKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAR 2113          

HSP 18 Score: 282.337 bits (721), Expect = 1.451e-75
Identity = 142/369 (38.48%), Postives = 222/369 (60.16%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPI 1861
            K    +H AC  GH ++V++LI  K + +  A +N  P+HLAC  G +++V++LI +K + +A    NC PIH A   GHKEVV++L  +K N++A D  N  PLHLAC  GH ++  +LI +  N++A D+    P+HLAC  GH ++V+ L   K NI+A +  N  P+H AC+ G KE+V IL+ +K +I+A E +N  P+HLAC  GH E+VE+LI  K +++A   +    +HLAC  G+ ++A++LI    ++   D+    P+H AC+ GH E+V++LI    +I+A    N  P+H A   G  E  ++L+ +K +I+A A      IHLA   GH E+V++L R   N +A   +  +P+
Sbjct: 1761 KKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPL 2129          

HSP 19 Score: 282.337 bits (721), Expect = 1.620e-75
Identity = 148/379 (39.05%), Postives = 228/379 (60.16%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            + F+ F G+     ++I    N      +N  P+HLAC  G+++IV+ILI +K + +A    N  P+H AC  GHKEVV++LI +K N++  D+    PLH AC KGH ++V +LI ++ NI+A    +  P+HLAC  GH ++VK L  +K NIEA    N  P+H AC  G KE+  ILI +K +I+A E KN  P+HLAC  GH E+VE+LI  K +I+A   + +  +HLAC+ G  ++ ++L+    +I      +  P+H AC  GH E+V++L+    NI+A D+    P+H A + GH E  +IL+ +K +I+A A      +HLAC  G  E+V++L+R   N +AL L+  +PI LA  +  +E++E+L
Sbjct: 1074 LQFSLF-GNKGAEDIIIKGNVNIGALTHENCTPLHLACLNGHKEIVEILIRRKANIDALALENSTPLHLACLNGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEIL 1451          

HSP 20 Score: 253.447 bits (646), Expect = 4.988e-66
Identity = 136/387 (35.14%), Postives = 213/387 (55.04%), Query Frame = 2
Query:  866 PIHLACEKGYEKIVKILIEQKCDTEAYD----------------------------------------ENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            P+H+A E     IV++LIE+  D    D                                          NC P+H AC  GHKE+V++LI +K N++A    N  PLHLAC  GH ++V +LI +K N+D  D+    P+H AC KGH ++V+ L  ++ NI A    N+ P+H AC  G KE+V +LI +K +IEA   +N  P+HLAC  GHKE+ E+LI  K +I+A +      +HLAC  G+ ++ ++LI    +I+     +  P+H AC+ G  E+V++L+    NI A    N  P+H A   GH E  +IL+ +K +I+A  + +   +HLAC+ GH E+V++L+R   N +A+ L+  +P+ LA  + ++E++E+L
Sbjct: 1032 PLHVAIEGDQRHIVQLLIEKGADVNIRDAKLNFDTPISAKPPLQFSLFGNKGAEDIIIKGNVNIGALTHENCTPLHLACLNGHKEIVEILIRRKANIDALALENSTPLHLACLNGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVL 1418          

HSP 21 Score: 239.195 bits (609), Expect = 2.466e-61
Identity = 119/304 (39.14%), Postives = 183/304 (60.20%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIH 1666
            +N   IH A   GH ++V++L  +K N +    +N  P+HLAC  G++++ ++LI +  +  A DE    P+H AC+ GHKEVV++LI  K N++A D  N  PLHLAC  GH ++V +L+ +K NIDA +  +  P+HLAC  GH+++V+ L  +K N++A    N  P+H AC  G KE+  +LI K  ++ A ++K   P+HLAC  GHKE+VE+LI  K  I+A   + +  +HLAC  G  ++ ++LI    +I+     +  PIH A   GH E+V++L     NI+A D  N  P+H
Sbjct: 1827 ENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLH 2130          

HSP 22 Score: 81.6481 bits (200), Expect = 8.011e-12
Identity = 64/235 (27.23%), Postives = 111/235 (47.23%), Query Frame = 2
Query: 1232 IEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH---KCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQ-------ISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            ++ A+  +   + +AC     E+   +I+K+      E++ L+   +A   G  +I   LI+      D+E     G+  +H+A E     I QLLI+   D+ + D        IS +P       G+     ++I  N NI A    N  P+H A   GH E  +IL+ +K +I+A A      +HLAC  GH E+V++L++   N + L  +  +P+  A     +E++E+L
Sbjct:  958 VQEASLFSEEFVLWACESNAIELFKFVISKENQRWTKEEEMLQ---IAIINGSDKICSYLIDDCQVHPDVELYG--GFAPLHVAIEGDQRHIVQLLIEKGADVNIRDAKLNFDTPISAKPPLQFSLFGNKGAEDIIIKGNVNIGALTHENCTPLHLACLNGHKEIVEILIRRKANIDALALENSTPLHLACLNGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVL 1187          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 199.519 bits (506), Expect = 4.328e-52
Identity = 98/380 (25.79%), Postives = 188/380 (49.47%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H A F GH +IVK+L+ +  +      K + P+H+A   G+ ++ + L++     +A  +++   +H A + GHKE+VKLL+  K N  +       PLH+A  +GHT  VR+L+D         +    P+H+A   G + + + L  +  N  AA +    P+H A      ++VN+L++K     +  +    P+H+A  +   E+   L+ +     A    G   +HLA ++G AD+  LLI    ++ + ++    P+H   + GH  I  +L+    ++ A  +    P+H A   G+++  K L+ ++ ++    +     +H A ++GH +IV LL++       +T  G S + +A++     +I++LK
Sbjct:  380 LHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVLK 759          

HSP 2 Score: 194.897 bits (494), Expect = 1.589e-50
Identity = 113/420 (26.90%), Postives = 200/420 (47.62%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIE----QKCDTEA---------------YDENNCR-----------------PIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K   A+H A   G   +V  L+N   N    ++K   P+++A ++ + ++VK L+E    Q   TE                Y   N                   P+H A    +  V +LL+N+  N+    KN   PLH+A  +G+  +VRLL+D+   IDA  ++   P+H A   GH++I++ L +Q   I+A  +    PIH A      + V  L+    +I+     +L P+H+A   GH  + +VL++          +G+  +H+AC+K +  +  LL+ ++  +E   +    P+H A  MGH  IV++L+    +  A +     P+H AS AGH E  + L+     ++A A++++ ++H A   GH E+VKLL+    N  + T  G++P+ +A +    + + +L
Sbjct:   75 KGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRIL 494          

HSP 3 Score: 193.741 bits (491), Expect = 3.115e-50
Identity = 101/396 (25.51%), Postives = 193/396 (48.74%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            +H A   G+  +V++L+++    +   +    P+H A   G+ +I++IL++Q    +A  +N   PIH A +  H + V+ L+     ++    ++  PLH+A   GH  + ++L+D+    +    N   P+H+AC K HL+++  L     ++EA  +    P+H A + G   IV IL+ K     A   K   P+H+A   GH E+ E L+ +   ++A   D   ++H A   G+ ++ +LL+++  +          P+H A   GHT+ V++L+D N       K    P+H A++ G V+  ++L+ +  +  A  +N    +H+A    + ++V LLV    +  +    G +P+ +A K  + E+   L Q      ++ +Q   P
Sbjct:  215 LHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTP 610          

HSP 4 Score: 191.815 bits (486), Expect = 1.239e-49
Identity = 96/383 (25.07%), Postives = 186/383 (48.56%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H AC + H  ++ +L+    + E   E    P+H+A   G+  IVKIL+++     A +     P+H A + GH EV + L+     ++A  K++Q  LH A   GH ++V+LL++ K N ++     + P+H+A  +GH + V+ L +         +  + P+H A   G+ ++  +L+ +  +  A  K  L P+H+A    + ++V +L++      +   +G+  +H+A ++   ++A  L+               P+H A + G  ++V LLI    N+   +K    P+H  ++ GHV    IL+ +   + A  +     +H+AC  G+ ++VK L++   N    T  G +P+  A +    +I+ LL
Sbjct:  343 GFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLL 725          

HSP 5 Score: 181.415 bits (459), Expect = 2.690e-46
Identity = 98/395 (24.81%), Postives = 194/395 (49.11%), Query Frame = 2
Query:  728 KSLSKLII*KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ--KCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K++   I    +  +H A    + ++ ++L+N+  N     +    P+H+A  +G   +V++L+++    +A  ++   P+H A + GH  ++++L++Q   ++A  KN   P+H+A +  H D VR L+     ID    +   P+H+A   GH ++ K L ++  K N  A N   + P+H AC K    ++++L+     +EA  +  L P+H+A   GH  IV++L+       A +      +H+A   G+ ++A+ L+ N   ++   +  +  +H A  MGH E+V+LL++   N  +       P+H A+  GH +  +IL+          +     +H+A + G  ++ +LL+    N  A    G +P+ +A      +++ LL
Sbjct:  168 KNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALN--GFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLL 560          

HSP 6 Score: 180.259 bits (456), Expect = 6.710e-46
Identity = 96/379 (25.33%), Postives = 188/379 (49.60%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  I+++L++Q    +   +    PIH+A +  +   V+ L++   + +    ++  P+H A   GH  + K+L+++         N   PLH+AC+K H  ++ LL+    +++A  ++   P+H+A   GHL IVK L  +  +  A+N     P+H A   G  E+   L+     ++A  K +   +H A   GHKE+V++L+ HK +  +    G   +H+A  +G+    ++L+D N       +    P+H A + G  ++ +LL++   N  A  K    P+H A    +++   +L+ K     + A+N    +H+A ++   E+   L++   +  A +L+G +P+ LA +  + +++ LL
Sbjct:  248 LHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLL 626          

HSP 7 Score: 174.096 bits (440), Expect = 5.631e-44
Identity = 94/379 (24.80%), Postives = 179/379 (47.23%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            IH A    H D V+ L+      +     +  P+H+A   G+ ++ K+L+++         N   P+H ACK+ H  V+ LL+    +LEA  ++   PLH+A   GH +IV++L+ +  + +A++     P+H+A   GH ++ + L      ++A  + +   +H A   G KE+V +L+  K +  +       P+H+A  +GH + V +L++           G+  +H+A + G  D+A+LL++   +     +    P+H A    + ++V LL+    +  +  +    P+H AS+   VE    L+       A +      +HLA ++G A++V LL+    N       G +P+ L  +     I ++L
Sbjct:  281 IHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADIL 659          

HSP 8 Score: 166.007 bits (419), Expect = 2.358e-41
Identity = 80/316 (25.32%), Postives = 152/316 (48.10%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILML 1714
            ++H A   GH ++VK+L+  K N  +       P+H+A  +G+ + V+IL++         +    P+H A K G  +V +LL+ +  N  A  KN   PLH+A    + D+V LL+ +  +  +  +N   P+H+A  +  +++  +L     +  A +     P+H A  +G+ ++V++LI+K+ ++    K  L P+HL   +GH  I ++L+     + A    G+  +H+AC  G   + + L+    ++    +    P+H A + GHT+IV LL+                +  A   G++    +L L
Sbjct:  445 SLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVLKL 760          

HSP 9 Score: 139.043 bits (349), Expect = 5.916e-33
Identity = 65/252 (25.79%), Postives = 121/252 (48.02%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  D+ ++L+ +  N     +    P+H+A       +V +L+ +     +   N   P+H A K+   EV   L+    +  A       PLHLA ++G  D+V LLI ++ N++  +++   P+HL   +GH+ I   L  Q  ++ AA ++ + P+H AC  G  ++V  L+ ++ ++    +    P+H A  +GH +IV +L+ H         +G  A+ +A   GY  +  +L
Sbjct:  507 KGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVL 758          

HSP 10 Score: 138.658 bits (348), Expect = 7.274e-33
Identity = 89/390 (22.82%), Postives = 176/390 (45.13%), Query Frame = 2
Query:  818 INQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQ----------NSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            I    +  T  +     +HLA ++G+ K+V  L+      E   +     +H A   G ++VV  L+N   N+ A  +    PL++A ++ H ++V+ L++   N     +          + + P++L+ +  H+ +        C+   A    + P+H A       +  +L+ +  ++    K  + P+H+A  +G+  +V +L++    I+A   D    +H A   G+  I ++L+D    I+   +    PIH A +  H + V+ L+  N  I+     +  P+H A+  GH    K+L+ K       A N    +H+AC+K H  ++ LL++   + EA+T  G +P+ +A       I+++L Q      +  ++ E P
Sbjct:   30 IKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITL-----KNVCSFITAT--GFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETP 412          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 192.586 bits (488), Expect = 9.224e-50
Identity = 99/383 (25.85%), Postives = 189/383 (49.35%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A  ++   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K + ++K N  A     + P+H AC K + +++ +L+     ++A  +  L PIH+A   GH+ IV+ L +H       +  G  A+H+A   G AD+ + L+ N   +++  +  +  +H A  +G  EIVQLL+       A       P+H A   GH E   +L+     + A  +     +H+A + G  E  KLL++     +     G +P+ +A     Q +  LL
Sbjct:  237 GFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLL 619          

HSP 2 Score: 179.104 bits (453), Expect = 1.782e-45
Identity = 93/382 (24.35%), Postives = 181/382 (47.38%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQ--KCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IVK L +   +  T   + +  +H+A   G   +V+ L++   K D +A D+     +H A + G  E+V+LL+ +     A   +   PLHLA  +GH +   LL++   ++ A  +    P+H+A   G ++  K L  ++   + A +    P+H A     + +  +L+       A  K    P+H+A  K   EI   L+    +  A    G   +HLA ++G  D+  LL+  N ++ + ++    P+H A +     + ++L++    ++A  K    P+H A   G+++    L+  +  I +  ++    +H A ++GH  I+ +L++   +   LTL GN+ + +A +     +++ L+
Sbjct:  439 IHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTA--LHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLR 818          

HSP 3 Score: 177.563 bits (449), Expect = 5.870e-45
Identity = 93/385 (24.16%), Postives = 179/385 (46.49%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+E IVK L          +      +H A + G  +VV+ L+     ++   K++Q  LH+A   G  +IV+LL+ +     A   +   P+HLA  +GH +    L     ++ AA +  + P+H A   GQ E   +L+ K+   +   K  L P+H+A    ++ +  +L++H     A   +G+  +H+A +K   +I   L++   +     +    P+H A + G  ++V LL+  N N+   +K    P+H A++   V   ++L+    +++A  +     +H+AC  G+ ++V  L+       + T  G +P+  A +     II +L Q
Sbjct:  402 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQ 786          

HSP 4 Score: 173.711 bits (439), Expect = 8.844e-44
Identity = 85/347 (24.50%), Postives = 169/347 (48.70%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G AD+V+ L+      +  A+ +Q  +H+A   G  +IV++L+++     A   +   P+H A + GH+E   LL+    +L A  K    PLH+A + G  +  +LL+ ++   D   +    P+H+A    + ++   L +   +  AA +  + P+H A  K Q EI   L+    +  A  ++ + P+HLA  +G  ++V +L+    ++   + +G   +HLA ++    +A++L+++  +++   +    P+H AC  G+ ++V  L++    I +  K    P+H A++ GH     +L+  +        N   A+ +A   G+  +V  L
Sbjct:  471 ALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          

HSP 5 Score: 170.244 bits (430), Expect = 1.038e-42
Identity = 96/379 (25.33%), Postives = 177/379 (46.70%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H     GH  +V+ML+++     +  +    P+H+A +  +   V++L++     +    +    +H A   GH +V K+++++K N  A   N   PLH+AC+K    ++ LL+    ++ A  ++   PIH+A   GH  IVK LT+   +    N      +H A   GQ ++V  L+     ++   K +   +H+A   G  EIV++L+       A    G+  +HLA  +G+ + A LL+++   +    +    P+H A + G  E  +LL+      +   K    P+H A+   +     +L+       A A+N    +H+A +K   EI   L+     T A+T +G SP+ LA +    +++ LL
Sbjct:  307 LHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLL 685          

HSP 6 Score: 166.392 bits (420), Expect = 2.191e-41
Identity = 90/379 (23.75%), Postives = 175/379 (46.17%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+++++K +  A   N   P+H ACK+   +V++LL+    +L+A  ++   P+H+A   GH +IV+ L     + +  +      +H+A   G   +V+ L      ++   + +   +H A   G+ EIV +L+ K     A       P+HLA  +GH+E   +L+ H   + A    G+  +H+A + G  + A+LL+      +   +    P+H A    +  +  LL+D   +  A  K    P+H A++   +E    L+    +  A  +     +HLA ++G  ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  340 LHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVL 718          

HSP 7 Score: 164.851 bits (416), Expect = 5.509e-41
Identity = 93/392 (23.72%), Postives = 188/392 (47.96%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQ----KCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A+H A   G  D+V+ L+    N    ++    P+++A ++ + ++V+ L+E         E+   P+  A ++GH +VV LL+      K  L A        LH+A  K  T    LL+    N D   ++   P+H+A   G++ +   L N+   ++   + +  P+H A  +G   +V +L+ +   I+A  K  L P+H     GH+++VE+L++    I +   +G   +H+A +  + +  QLL+ ++  ++         +H A   GH ++ ++++D  AN N +A + +   P+H A +   V+  ++L+     ++A  ++    IH+A   GH  IVK L     +     ++G + + +A ++ + +++  L Q   K
Sbjct:  112 ALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA--------LHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFT--PLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAK 493          

HSP 8 Score: 162.925 bits (411), Expect = 2.252e-40
Identity = 90/380 (23.68%), Postives = 182/380 (47.89%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A  EGH ++V  L+    + +   +K    +H+A   G   +V+ L+    +  A  +N   P++ A +  H EVV+ L+    +     ++   PL +A ++GH  +V LL++     D   +     +H+A  K   K    L     N +  ++  + P+H A   G   +  +L+ +   ++   + ++ P+H+A  +G+  +V++L++    I+A   DG   +H     G+  + ++L+D    I    +    P+H A +  H   VQLL+  +  ++         +H A+  GH +  K+++ KK +  A A N    +H+AC+K   ++++LL++   + +A+T  G +PI +A     + I++ L
Sbjct:   79 ALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 454          

HSP 9 Score: 150.599 bits (379), Expect = 1.614e-36
Identity = 80/354 (22.60%), Postives = 171/354 (48.31%), Query Frame = 2
Query:  845 CAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            C +     +HLA ++G+ ++V  L++     +A  +     +H A   G  +VV+ L+    N+ A  +N   PL++A ++ H ++VR L++   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G  ++ +LL+D    I+   +    P+H     GH ++V++L+D    I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K++V    N  A  L G +P+ +A K  + +++ELL
Sbjct:   72 CNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELL 421          

HSP 10 Score: 133.265 bits (334), Expect = 4.375e-31
Identity = 62/252 (24.60%), Postives = 120/252 (47.62%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  +  K+L+ ++   +T  +    P+H+A     +++  +L++      A  +N   P+H A K+   E+   L+       A  +    PLHLA ++G  D+V LL+ +  N++  ++N   P+HLA  +  + + + L N    ++A  +  + P+H AC  G  ++V+ L+  +  I +  K    P+H A  +GH  I+ +L+ H+        +G  A+ +A   GY  +   L
Sbjct:  566 KGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          

HSP 11 Score: 92.8189 bits (229), Expect = 1.047e-18
Identity = 57/284 (20.07%), Postives = 127/284 (44.72%), Query Frame = 2
Query: 1148 QNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLI-------------------------------DANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +SN     A   G+L+          +I   NQ     +H A  +G  E+V  L+     ++A  KK    +H+A   G  ++V  L+ +  ++ A   +G+  +++A ++ + ++ + L+++     +  +    P+  A + GH ++V LL+                               D N ++E+   +   P+H A+  G++    +L+ +   ++  A+N+   +H+A ++G+  +VKLL+      +A T  G +P+    +S  ++++E+L
Sbjct:   41 SDSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFT--PLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEML 322          

HSP 12 Score: 70.8626 bits (172), Expect = 5.520e-12
Identity = 38/151 (25.17%), Postives = 73/151 (48.34%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  + A   +    DI +C+Q     +H A + GH E+V  L+    +++A  K     +H AS AG  +  + L+    ++ A +QN    +++A ++ H E+V+ L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   50 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK 200          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 191.815 bits (486), Expect = 1.633e-49
Identity = 99/384 (25.78%), Postives = 189/384 (49.22%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+++    +A  ++   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+     +D    +    +H+A   GH K+ K + ++K N  A     + P+H AC K + +++ +L+     ++A  +  L PIH+A   GH+ IV+ L +H       +  G  A+H+A   G AD+ + L+ N   +++  +  +  +H A  +G  EIVQLL+       A       P+H A   GH E   +L+     + A  +     +H+A + G  E  KLL++     +     G +P+ +A     Q +  LL
Sbjct:  208 SGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLL 591          

HSP 2 Score: 178.333 bits (451), Expect = 3.052e-45
Identity = 93/382 (24.35%), Postives = 181/382 (47.38%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQ--KCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IVK L +   +  T   + +  +H+A   G   +V+ L++   K D +A D+     +H A + G  E+V+LL+ +     A   +   PLHLA  +GH +   LL++   ++ A  +    P+H+A   G ++  K L  ++   + A +    P+H A     + +  +L+       A  K    P+H+A  K   EI   L+    +  A    G   +HLA ++G  D+  LL+  N ++ + ++    P+H A +     + ++L++    ++A  K    P+H A   G+++    L+  +  I +  ++    +H A ++GH  I+ +L++   +   LTL GN+ + +A +     +++ L+
Sbjct:  411 IHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTA--LHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLR 790          

HSP 3 Score: 177.178 bits (448), Expect = 9.200e-45
Identity = 93/385 (24.16%), Postives = 179/385 (46.49%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+E IVK L          +      +H A + G  +VV+ L+     ++   K++Q  LH+A   G  +IV+LL+ +     A   +   P+HLA  +GH +    L     ++ AA +  + P+H A   GQ E   +L+ K+   +   K  L P+H+A    ++ +  +L++H     A   +G+  +H+A +K   +I   L++   +     +    P+H A + G  ++V LL+  N N+   +K    P+H A++   V   ++L+    +++A  +     +H+AC  G+ ++V  L+       + T  G +P+  A +     II +L Q
Sbjct:  374 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQ 758          

HSP 4 Score: 172.94 bits (437), Expect = 1.619e-43
Identity = 85/347 (24.50%), Postives = 169/347 (48.70%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G AD+V+ L+      +  A+ +Q  +H+A   G  +IV++L+++     A   +   P+H A + GH+E   LL+    +L A  K    PLH+A + G  +  +LL+ ++   D   +    P+H+A    + ++   L +   +  AA +  + P+H A  K Q EI   L+    +  A  ++ + P+HLA  +G  ++V +L+    ++   + +G   +HLA ++    +A++L+++  +++   +    P+H AC  G+ ++V  L++    I +  K    P+H A++ GH     +L+  +        N   A+ +A   G+  +V  L
Sbjct:  443 ALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 789          

HSP 5 Score: 169.859 bits (429), Expect = 1.621e-42
Identity = 96/379 (25.33%), Postives = 177/379 (46.70%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H     GH  +V+ML+++     +  +    P+H+A +  +   V++L++     +    +    +H A   GH +V K+++++K N  A   N   PLH+AC+K    ++ LL+    ++ A  ++   PIH+A   GH  IVK LT+   +    N      +H A   GQ ++V  L+     ++   K +   +H+A   G  EIV++L+       A    G+  +HLA  +G+ + A LL+++   +    +    P+H A + G  E  +LL+      +   K    P+H A+   +     +L+       A A+N    +H+A +K   EI   L+     T A+T +G SP+ LA +    +++ LL
Sbjct:  279 LHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLL 657          

HSP 6 Score: 165.622 bits (418), Expect = 3.629e-41
Identity = 90/379 (23.75%), Postives = 175/379 (46.17%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+      +         +H+A   G+ K+ K+++++K +  A   N   P+H ACK+   +V++LL+    +L+A  ++   P+H+A   GH +IV+ L     + +  +      +H+A   G   +V+ L      ++   + +   +H A   G+ EIV +L+ K     A       P+HLA  +GH+E   +L+ H   + A    G+  +H+A + G  + A+LL+      +   +    P+H A    +  +  LL+D   +  A  K    P+H A++   +E    L+    +  A  +     +HLA ++G  ++V LL+  + N       G +P+ LA +  +  + E+L
Sbjct:  312 LHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVL 690          

HSP 7 Score: 158.303 bits (399), Expect = 7.421e-39
Identity = 95/425 (22.35%), Postives = 195/425 (45.88%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQ----KCNIDA------------------NDQNSN---------------RPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A+H A  EGH ++V  L+    + +   +K    +H+A   G   +V+ L+    +  A  +N   P++ A +  H EVV+ L+    +     ++   PL +A ++GH  +V LL++     K  + A                  ND N++                P+H+A   G++ +   L N+   ++   + +  P+H A  +G   +V +L+ +   I+A  K  L P+H     GH+++VE+L++    I +   +G   +H+A +  + +  QLL+ ++  ++         +H A   GH ++ ++++D  AN N +A + +   P+H A +   V+  ++L+     ++A  ++    IH+A   GH  IVK L     +     ++G + + +A ++ + +++  L Q   K
Sbjct:   43 ALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFT--PLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAK 465          

HSP 8 Score: 142.895 bits (359), Expect = 4.701e-34
Identity = 81/362 (22.38%), Postives = 172/362 (47.51%), Query Frame = 2
Query:  845 CAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITK--KCDIEAP------EKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            C +     +HLA ++G+ ++V  L++     +A  +     +H A   G  +VV+ L+    N+ A  +N   PL++A ++ H ++VR L++   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+      D+E+             P+H+A   G+  +  +L+N    ++    +    +H+A ++G  ++ +LL+D    I+   +    P+H     GH ++V++L+D    I +  K    P+H A++  H+ C ++L+     ++    +   A+H+A   GH ++ K++V    N  A  L G +P+ +A K  + +++ELL
Sbjct:   36 CNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELL 393          

HSP 9 Score: 132.88 bits (333), Expect = 5.188e-31
Identity = 62/252 (24.60%), Postives = 120/252 (47.62%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  +  K+L+ ++   +T  +    P+H+A     +++  +L++      A  +N   P+H A K+   E+   L+       A  +    PLHLA ++G  D+V LL+ +  N++  ++N   P+HLA  +  + + + L N    ++A  +  + P+H AC  G  ++V+ L+  +  I +  K    P+H A  +GH  I+ +L+ H+        +G  A+ +A   GY  +   L
Sbjct:  538 KGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 789          

HSP 10 Score: 88.9669 bits (219), Expect = 1.735e-17
Identity = 58/293 (19.80%), Postives = 126/293 (43.00%), Query Frame = 2
Query: 1139 ANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLI-------------------------------DANCNIEAC------DKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             N   SN     A   G+L+          +I   NQ     +H A  +G  E+V  L+     ++A  KK    +H+A   G  ++V  L+ +  ++ A   +G+  +++A ++ + ++ + L+++     +  +    P+  A + GH ++V LL+                               D N ++E+             P+H A+  G++    +L+ +   ++  A+N+   +H+A ++G+  +VKLL+      +A T  G +P+    +S  ++++E+L
Sbjct:    2 GNSSRSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEML 294          

HSP 11 Score: 70.4774 bits (171), Expect = 8.410e-12
Identity = 38/151 (25.17%), Postives = 73/151 (48.34%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  + A   +    DI +C+Q     +H A + GH E+V  L+    +++A  K     +H AS AG  +  + L+    ++ A +QN    +++A ++ H E+V+ L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:   14 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK 164          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 191.43 bits (485), Expect = 1.974e-49
Identity = 100/379 (26.39%), Postives = 194/379 (51.19%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  ++++L++Q    +   +    PIH+A +  +   V+ L++   + +    ++  P+H A   GH  + K+L+++     A   N   PLH+AC+K H   + LL+    +++A  ++   P+H+A   GHL IVK+L  +  +  A+N     P+H A   G  E+   L+     ++A  K +  P+H A   GHKE+V++L+ HK + ++    G   +H+A  +G+A   ++L+D N       +    P+H AC+ G  ++ +LL++   N  A  K    P+H A    +++  K+L+ K     + A+N    +H+A ++   E+   L++   N  + +L+G +P+ LA +  + +++ LL
Sbjct:  251 LHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALL 629          

HSP 2 Score: 189.504 bits (480), Expect = 6.928e-49
Identity = 106/403 (26.30%), Postives = 193/403 (47.89%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILI-----------------------------EQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEK 1876
            K +  ++ A  E H ++VK L+    N     E    P+ +A ++G+E +V +LI                             +   + +   +    P+H A    +  V +LL+N+  N+    KN   PLH+A  +G+  +VRLL+D+   IDA  ++   P+H A   GH+++++ L +Q   I+A  +    PIH A      + V  L+    +I+     +L P+H+A   GH  + +VL++      A   +G+  +H+AC+K +     LL+ ++  +E   +    P+H A  MGH  IV+ L+    +  A +     P+H A+ AGH E  + L+     ++A A++++  +H A   GH E+VKLL+    N ++ T  G++P+ +A +
Sbjct:   85 KGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAR 487          

HSP 3 Score: 186.037 bits (471), Expect = 9.874e-48
Identity = 98/380 (25.79%), Postives = 181/380 (47.63%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A          +L+    N +  ++    P+H+A       + ++L+ +  +     +N   P+H A +RG+  +V+LL+++   ++A  K+   PLH A   GH  ++ +L+DQ   I A  +N   PIH+A    H+  V+ L      I+     +  P+H A   G   +  +L+ K     A       P+H+AC K H   +++L+ H   +EA  + G   +H+A   G+ +I + L+         +   + P+H A   GH E+ Q L+     ++A  K ++ P+H A+  GH E  K+L+  K + ++        +H+A  +GHA   ++L+  +     +T KG +P+ +A K  K ++ ELL
Sbjct:  151 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELL 530          

HSP 4 Score: 183.726 bits (465), Expect = 4.615e-47
Identity = 94/385 (24.42%), Postives = 187/385 (48.57%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKR-----PIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H A F GH +IVK L+ +  +      K + P+H+A   G+ ++ + L++     +A  +++  P+H A + GHKE+VKLL+  K N ++       PLH+A  +GH    R+L+D         +    P+H+AC  G + + + L  +  N  AA +    P+H A      ++V +L++K     +  +    P+H+A  +   E+   L+    +  +    G   +HLA ++G  D+  LLI    ++ + +++  +     P+H   + GH  I  +L+    ++ +  +     +H A   G+++  K L+ ++  +    +     +H A ++GH +IV LL++       +T  G SP+ +A++     +I++LK
Sbjct:  383 LHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 767          

HSP 5 Score: 172.94 bits (437), Expect = 1.193e-43
Identity = 109/428 (25.47%), Postives = 196/428 (45.79%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQ----KCNIDA------------------NDQNSN-------RPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
             +H A  EGH  +V  L++   + ET  +K    +H+A   G EK+V  L+    +  A  +    P++ A +  H EVVK L+    N     ++   PL +A ++GH ++V LLI+     K  + A                  ND N +        P+H+A    +L + + L N+  N+    +    P+H A  +G   +V +L+ +   I+A  K  L P+H A   GH  ++E+L++    I+A   +G   IH+A +  + D  + L+  N +I+        P+H A   GH  + ++L+D  A  N  A + +   P+H A +  H+    +L+     +EA  ++    +H+A   GH  IVK L++   +  A  +K  +P+ +A ++   E+ + L Q   +  +    D+ P
Sbjct:   23 GLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFT--PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTP 448          

HSP 6 Score: 160.229 bits (404), Expect = 1.292e-39
Identity = 88/372 (23.66%), Postives = 168/372 (45.16%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERR-----AIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +H A   GH  + K+L+++       A     P+H+AC+K + + + +L++     EA  E+   P+H A   GH  +VK L+ +  +  A +   + PLH+A   GH ++ + L+     +DA  ++   P+H A   GH ++VK L   K N ++A      P+H A  +G      IL+          KK   P+H+AC  G  ++ E+L+    +  A   +G   +H+A      D+ +LL+          +    P+H A +    E+   L+    N  +       P+H A++ G  +   +L+ K+ ++    +   +      +HL  ++GH  I  +LV+   +  + +  G + + +A
Sbjct:  317 LHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVA 688          

HSP 7 Score: 125.946 bits (315), Expect = 6.638e-29
Identity = 72/299 (24.08%), Postives = 140/299 (46.82%), Query Frame = 2
Query: 1016 INQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            I     +   ++N    LHLA ++GH  +V  L+    +++   +  N  +H+A   G  K+V  L +   N+ A +Q  + P++ A  +   E+V  L+    +   P +    P+ +A  +GH+ +V +LIN+    +        A+H+A        A +L+ N+ + +V  +    P+H A    +  + QLL++   N+    K    P+H A+  G+V   ++L+ +   I+A  ++E   +H A   GH  ++++L+      +A T  G SPI +A +    + +  L Q
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQ 301          

HSP 8 Score: 124.405 bits (311), Expect = 1.906e-28
Identity = 64/257 (24.90%), Postives = 121/257 (47.08%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQ-----NSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H AC  G  D+ ++L+ +  N     +    P+H+A       +VK+L+ +     +   N   P+H A K+   EV   L+    N  +       PLHLA ++G  D+V LLI ++ N++  ++      +  P+HL   +GH+ I   L  Q  ++ +A+++ +  +H AC  G  ++V  L+ ++  +    +    P+H A  +GH +IV +L+ H         +G   + +A   GY  +  +L
Sbjct:  510 KGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 9 Score: 53.9138 bits (128), Expect = 8.833e-7
Identity = 34/138 (24.64%), Postives = 63/138 (45.65%), Query Frame = 2
Query: 1511 IDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            I N   I   +Q     +H A + GH ++V  L+    ++E   K     +H A+ AG  +    L+    ++ A +Q     +++A ++ H E+VK L+    N    T  G +P+ +A +   + ++ LL    TK
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK 144          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 188.734 bits (478), Expect = 1.847e-48
Identity = 96/384 (25.00%), Postives = 192/384 (50.00%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ ++  +L+N+    +  A  +  P+H+A ++G   +VK+L+E+    +A  ++   P+H   + GH++VV++L+++   + +  KN   PLH+A +  H + V+LL+  +  +D    +    +H+A   GH K+ K + ++K N  A     + P+H AC K + +++ +L+     I+A  +  L PIH+A   GH+ IV  L+NH       +  G  A+H+A   G  ++ + L+ N   ++   +  + P+H +  +G  EI+Q L+      ++       P+H A+  GH +   IL+ +   +    +     +H+A + G  E+  LL++     +A    G +P+ +A     Q++  LL
Sbjct:  181 SGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLL 564          

HSP 2 Score: 184.111 bits (466), Expect = 4.888e-47
Identity = 99/379 (26.12%), Postives = 183/379 (48.28%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H     GH  +V+ML+++     +  +    P+H+A +  +   V++L+  +   +    +    +H A   GH +V K+++++K N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GH  IV  L N   +    N      +H A   GQ E+V  L+     ++A  K +  P+H++   G  EI++ L+ H    ++    G+  +HLA  +G+ D+A +L+D    + +  +    P+H A + G  E+  LL+      +A  K    P+H A+   + +   +L+ +     A A+N    +H+A +K   EI   L+    +T A+T +G SP+ LA +    +++ LL
Sbjct:  252 LHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLL 630          

HSP 3 Score: 180.644 bits (457), Expect = 7.000e-46
Identity = 90/368 (24.46%), Postives = 175/368 (47.55%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            A+H A   GH  + K+++++K N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH+ +V  L+N   +    +   +  LH+A   G T++V+ L+     +DA  ++   P+H++   G  +I++ L       ++     + P+H A  +G K++ +IL+ +   +    KK   P+H+A   G  E+  +L+  +   +A    G   +H+A       +A LL+D         +    P+H A +    EI   L++   +  A  +    P+H AS+ G+V+   +LM +   I  C ++    +HLA ++    + ++LV      +  T  G +P+ +A
Sbjct:  317 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVA 684          

HSP 4 Score: 174.481 bits (441), Expect = 6.096e-44
Identity = 93/411 (22.63%), Postives = 188/411 (45.74%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLAC---------------------------EKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
             +  +H AC +    ++++L+    + +   E    PIH+A   G+E IV  L+         +      +H A + G  EVVK L+     ++A  K++Q PLH++   G  +I++ L+      D+   +   P+HLA  +GH  +   L +Q  ++    +  + P+H A   G+ E+ N+L+ K+   +A  K  L P+H+A    ++++  +L++      A   +G+  +H+A +K   +IA  L++   D     +    P+H A + G+ ++V LL+  +  I  C+K    P+H A++   V   ++L+     ++   +     +H+AC                           ++GH  I+ LL++       LT+ GN+ + +A +     +++ L+
Sbjct:  347 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVTAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTLR 757          

HSP 5 Score: 174.096 bits (440), Expect = 7.925e-44
Identity = 95/382 (24.87%), Postives = 181/382 (47.38%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N+  P+H A KRG+  +VKLL+ +   ++A  K+   PLH     GH  +V +L+D+   I +  +N   P+H+A    HL  V+ L + +  ++         +H A   G  ++  +++ KK +  A       P+H+AC K   +++E+L+ H   I+A  + G   IH+A   G+ +I   L+++       +   +  +H A   G TE+V+ L+     ++A  K ++ P+H +S  G  E  + L+      ++   +    +HLA  +GH ++  +L+    +    T KG +P+ +A K  K E+  LL Q
Sbjct:  152 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQ 533          

HSP 6 Score: 164.081 bits (414), Expect = 9.397e-41
Identity = 94/428 (21.96%), Postives = 194/428 (45.33%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC-----------------------------NIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A  EGH ++V  LI      +   +K    +H+A   G   +VK L+    +  A  +N   P++ A +  H +VV+ L++   +     ++   PL +A ++GH  +V LL++                                N D   ++   P+H+A   G++ +   L N+   ++   + +  P+H A  +G   +V +L+ +   I+A  K  L P+H     GH+++VE+L++    I +   +G   +H+A +  + +  QLL+ +   ++         +H A   GH ++ ++++D  AN N +A + +   P+H A +   ++  ++L+     I+A  ++    IH+A   GH  IV  L+    +     ++G + + +A ++ + E+++ L Q      +    D+ P
Sbjct:   24 ALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFT--PLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTP 449          

HSP 7 Score: 163.31 bits (412), Expect = 1.772e-40
Identity = 86/379 (22.69%), Postives = 181/379 (47.76%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L++ +   +         +H+A   G+ K+ K+++++K +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV  L++   + +  +      +H+A   G  ++VK L      ++A ++ +  P+H +   G+ EI+  L+      ++       P+HLA  +GHK++  +L++    +      G+  +H+A + G  ++A LL+      +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   +E    L+    D  A  +     +HLA ++G+ ++V LL+            G +P+ LA +  +  + E+L
Sbjct:  285 LHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVL 663          

HSP 8 Score: 154.066 bits (388), Expect = 1.478e-37
Identity = 83/354 (23.45%), Postives = 173/354 (48.87%), Query Frame = 2
Query:  845 CAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            C +     +HLA ++G+ ++V  LI+     +A  +     +H A   G  +VVK L+    N+ A  +N   PL++A ++ H D+VR L+D   +     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +    +H+A ++G +++ +LL++    I+   +    P+H     GH ++V++L+D    I +  K    P+H A++  H+ C ++L+  +  ++    +   A+H+A   GH ++ K++V    N  A  L G +P+ +A K  + +++ELL
Sbjct:   17 CNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELL 366          

HSP 9 Score: 115.931 bits (289), Expect = 9.494e-26
Identity = 58/252 (23.02%), Postives = 117/252 (46.43%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  ++  +L+ ++   +   +    P+H+A     +K+  +L++Q     A  +N   P+H A K+   E+   L+    +  A  +    PLHLA ++G+ D+V LL+ +   I+  +++   P+HLA  +  + + + L N    ++   ++ + P+H AC  G  ++V+ L+  +  + A  K        A  +GH  I+ +L+ H         +G  A+ +A   GY  +   L
Sbjct:  511 KGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVT------AAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          

HSP 10 Score: 70.8626 bits (172), Expect = 5.717e-12
Identity = 45/194 (23.20%), Postives = 87/194 (44.85%), Query Frame = 2
Query: 1325 CDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             DI    +  L  +HLA  +GH E+V  LI     ++A    G  A+H+A   G +D+ + L+ N  ++    Q    P++ A +  H ++V+ L+D   +     +    P+  A + GH +   +L+    + +   +    A+H+A  K   +   LL++   N +  +  G +P+ +A       +  LL
Sbjct:   12 VDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLL 201          

HSP 11 Score: 69.707 bits (169), Expect = 1.312e-11
Identity = 36/138 (26.09%), Postives = 69/138 (50.00%), Query Frame = 2
Query: 1511 IDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            + +  DI +C+Q     +H A + GH E+V  LI     ++A  K     +H AS AG  +  K L+    ++ A +QN    +++A ++ H ++V+ L+    +    T  G +P+ +A +    +++ LL +  TK
Sbjct:    8 LKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK 145          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.66 bits (483), Expect = 1.917e-50
Identity = 99/390 (25.38%), Postives = 192/390 (49.23%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDV 1939
            +H A    H   V++L+ ++   +        P+H+A   G+ ++ K+L+++  +  A   N   P+H ACK+   +V++LL+    ++    ++   P+H+A   GH ++V+LL+    + +A +     P+H+A   G L++VK L      +    + +  P+H A   G+ EIV +L+ +  D  AP      P++ A  +GH ++  +L+ +  DI      G+  +H+A + G  ++A LL++     +   +    P+H A    H ++  LL+D   +  +  K    P+H A++   +E  K+L+    +     Q     +HLA ++GHA++V LL+  H +    T  G + + LA +  K  + E+L    TK ++DV
Sbjct:  315 LHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEIL----TKHKADV 700          

HSP 2 Score: 189.889 bits (481), Expect = 3.718e-50
Identity = 107/412 (25.97%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+ ++VK+L+++    +T       P+H A   G+EK++++L+E+     A  +N   P+H A +                                  GH  V KLL+++     A   N   PLH+AC+K    ++ LL+    +I    ++   PIH+A   GHL +V+ L     +  A N     P+H A   GQ E+V  L+     +    +++  P+H+A   G  EIV++L+    D  A    G   ++ A  +G+ D+A LL++N  DI    +    P+H A + G  E+  LL++   + +   K    P+H A+   H +   +L+ K     + A+N    +H+A +K   E+ K+L+     T  LT +G +P+ LA +    +++ LL
Sbjct:  249 LHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALL 660          

HSP 3 Score: 185.652 bits (470), Expect = 1.048e-48
Identity = 94/384 (24.48%), Postives = 187/384 (48.70%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ ++  +L+N     +  A     P+H+A ++G   +VK+L+++    +    +   P+H A + GH++V+++L+ +   + A  KN   PLH+A +  H   V+LL+ ++  +D    +   P+H+A   GH ++ K L ++     A     + P+H AC K + +++ +L+     I    +  L PIH+A   GH  +V++L+ +     A +  G   +H+A   G  ++ + L+ +   + V  +  + P+H A  +G  EIVQLL+    +  A       P+++AS  GH +   +L+    DI    +     +H+A + G  E+  LL+  + + +     G +P+ +A     Q++  LL
Sbjct:  211 SGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLL 594          

HSP 4 Score: 184.496 bits (467), Expect = 2.361e-48
Identity = 95/374 (25.40%), Postives = 178/374 (47.59%), Query Frame = 2
Query:  788 EGHADIV-KMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            E +AD+  KM++NQ        E    P+H+A   G   +  +L+      +    N   P+H A KRG+  +VKLL+++   ++   ++   PLH A   GH  ++ +L+++   I A  +N   P+H+A    HL  V+ L  ++  ++        P+H A   G   +  +L+ +  +  A       P+H+AC K   +++E+L+ H   I    + G   IH+A   G+ ++ QLL+ N       +   + P+H A   G  E+V+ L+ +   +    + ++ P+H AS  G  E  ++L+ +  D  A   +    ++ A  +GH ++  LL+    +   +T KG +P+ +A K  + E+  LL
Sbjct:  194 EHNADVTSKMMLNQTT------ESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLL 561          

HSP 5 Score: 177.178 bits (448), Expect = 5.025e-46
Identity = 90/385 (23.38%), Postives = 182/385 (47.27%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    +  T  E    PIH+A   G+  +V++L++    + A +     P+H A + G  EVVK L+     +    + +Q PLH+A   G  +IV+LL+ +  + +A   + + P++ A  +GH  +   L     +I    +  + P+H A   G+ E+  +L+ K    +   K  L P+H+A    H+++  +L++      +   +G+  +H+A +K   ++ ++L++   +  +  Q    P+H A + GH ++V LL+  + +I    K     +H A++   V   +IL   K D+    +     +H+A   G+ ++V  L+R      A T  G +P+  A +     ++  L Q
Sbjct:  377 GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQ 761          

HSP 6 Score: 175.252 bits (443), Expect = 2.044e-45
Identity = 96/437 (21.97%), Postives = 194/437 (44.39%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQ-------------------------------------KCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
               A+H A  EGH D+V  L+ ++   +T  +     +H+A   G   IV++L+E   +  A  +N   P++ A +  H E+VK L++   N     ++   PL +A ++GH  +V LL++                                      K  ++   ++   P+H+A   G++ +   L N    ++   +    P+H A  +G   +V +L+ +   I+   +  L P+H A   GH++++E+L+     I A   +G   +H+A +  +    QLL+     ++        P+H A   GH  + +LL+D      A       P+H A +   ++  ++L+     I    ++    IH+A   GH  +V+LL++   ++ A  ++G +P+ +A ++ + E+++ L Q+  +      +D+ P
Sbjct:   43 GLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTP 479          

HSP 7 Score: 173.326 bits (438), Expect = 8.073e-45
Identity = 86/380 (22.63%), Postives = 175/380 (46.05%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH ++V++L+    +      + + P+H+A   G  ++VK L++           +  P+H A + G  E+V+LL+ +  +  A   +   PL+ A  +GH D+  LL++   +I    +    P+H+A   G L++   L  +  + +   +    P+H A     +++  +L+ K     +  K    P+H+A  K   E+ +VL+    +       G   +HLA ++G+AD+  LL+  +  I +  +     +H A +     + ++L     ++    K    P+H AS  G+++    L+  +  + A  +N    +H A ++GH  +V  L++   +   LT  GN+ + +A +     +++ L 
Sbjct:  414 IHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLS 793          

HSP 8 Score: 160.614 bits (405), Expect = 1.097e-40
Identity = 84/379 (22.16%), Postives = 169/379 (44.59%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  + K+L+++       A     P+H+AC+K   K++++L++         E+   PIH A   GH  VV+LL+    +  A +   + PLH+A   G  ++V+ L+     +    +    P+H+A   G  +IV+ L  +  +  A       P++FA  +G  ++ ++L+    DI    KK   P+H+A   G  E+  +L+      +    +G   +H+A    +  +A LL+D         +    P+H A +    E+ ++L++         +    P+H A++ GH +   +L+ +   I    +    A+HLA ++    + ++L +   +    T    +P+ +A      +++  L
Sbjct:  348 LHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFL 726          

HSP 9 Score: 150.214 bits (378), Expect = 1.789e-37
Identity = 82/367 (22.34%), Postives = 177/367 (48.23%), Query Frame = 2
Query:  830 CNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNIL--------ITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
             +  TC +     +HLA ++G+  +V  L++++ + +   +     +H A   G  ++V++L+    N+ A  +N   PL++A ++ H +IV+ L+D   N     ++   P+ +A  +GH ++V  L       +   ++    +H A  K       +L        +T K  +    +    P+H+A   G+  +  +L+N    ++    +G   +H+A ++G  ++ +LL+D    I+   +    P+H A   GH +++++L++ +  I A  K    P+H A++  H+ C ++L+ ++  ++    +    +H+A   GH  + KLL+       A  L G +P+ +A K  + +++ELL
Sbjct:   34 MDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELL 396          

HSP 10 Score: 70.4774 bits (171), Expect = 1.229e-12
Identity = 37/138 (26.81%), Postives = 69/138 (50.00%), Query Frame = 2
Query: 1511 IDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            +    DI  C+Q     +H A + GH ++V  L+     I+   K     +H A+ AG  +  ++L+    +I A +QN    +++A ++ H EIVK L+    N    T  G +P+ +A +   ++++ LL ++ TK
Sbjct:   30 LKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK 167          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.808 bits (473), Expect = 3.070e-49
Identity = 92/380 (24.21%), Postives = 180/380 (47.37%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A  +   +   +L+  + N +  ++    P+H+A   G   +  +L+      +    N   P+H A KRG+  +VKLL+++   ++   ++   PLH A   GH  ++ +L+++   I A  +N   P+H+A    HL  V+ L  ++  ++        P+H A   G   +  +L+ +  +  A       P+H+AC K   +++E+L+ H   I    + G   IH+A   G+ ++ QLL+ N       +   + P+H A   G  E+V+ L+ +   +    + ++ P+H AS  G  E  ++L+ +  D  A   +    ++ A  +GH ++  LL+    +   +T KG +P+ +A K  + E+  LL
Sbjct:  175 ALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLL 554          

HSP 2 Score: 181.8 bits (460), Expect = 1.207e-47
Identity = 95/386 (24.61%), Postives = 187/386 (48.45%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVR--AHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
              +  +H A   G+ ++  +L+N     +  A     P+H+A ++G   +VK+L+++    +    +   P+H A + GH++V+++L+ +   + A  KN   PLH+A +  H   V+LL+ ++  +D    +   P+H+A   GH ++ K L ++     A     + P+H AC K + +++ +L+     I    +  L PIH+A   GH  +V++L+ +     A +  G   +H+A   G  ++ + L+ +   + V  +  + P+H A  +G  EIVQLL+    +  A       P+++AS  GH +   +L+    DI    +     +H+A + G  E+  LL+   A  + +     G +P+ +A     Q++  LL
Sbjct:  204 SGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLL 589          

HSP 3 Score: 180.644 bits (457), Expect = 2.423e-47
Identity = 97/429 (22.61%), Postives = 193/429 (44.99%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC-----------------------------NIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
               A+H A  EGH D+V  L+ ++   +T  +     +H+A   G   IV++L+E   +  A  +N   P++ A +  H E+VK L++   N     ++   PL +A ++GH  +V LL++                                N D   ++   P+H+A   G++ +   L N    ++   +    P+H A  +G   +V +L+ +   I+   +  L P+H A   GH++++E+L+     I A   +G   +H+A +  +    QLL+     ++        P+H A   GH  + +LL+D      A       P+H A +   ++  ++L+     I    ++    IH+A   GH  +V+LL++   ++ A  ++G +P+ +A ++ + E+++ L Q+  +      +D+ P
Sbjct:   44 GLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTP 472          

HSP 4 Score: 173.711 bits (439), Expect = 4.403e-45
Identity = 98/426 (23.00%), Postives = 191/426 (44.84%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKC-----------------------------NLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            A+H A   G  DIV++L+    N    ++    P+++A ++ + +IVK L++   +     E+   P+  A ++GH++VV LL+                                 N +   K+   PLH+A   G+ ++  LL++    +D   +N   P+H+A  +G+  +VK L ++   I+   +    P+H A   G ++++ +L+ +   I A  K  L P+H+A    H   V++L+  +  ++    D    +H+A   G+  +A+LL+D   +          P+H AC+    ++++LL+    +I    +    PIH AS  GH+   ++L+       A        +H+A   G  E+VK L+++         +  +P+ +A +  K EI++LL Q  +   +       P
Sbjct:   80 ALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTP 505          

HSP 5 Score: 173.326 bits (438), Expect = 6.897e-45
Identity = 90/387 (23.26%), Postives = 183/387 (47.29%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITK--KCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    +  T  E    PIH+A   G+  +V++L++    + A +     P+H A + G  EVVK L+     +    + +Q PLH+A   G  +IV+LL+ +  + +A   + + P++ A  +GH  +   L     +I    +  + P+H A   G+ E+  +L+ K    D +   +  L P+H+A    H+++  +L++      +   +G+  +H+A +K   ++ ++L++   +  +  Q    P+H A + GH ++V LL+  + +I    K     +H A++   V   +IL   K D+    +     +H+A   G+ ++V  L+R      A T  G +P+  A +     ++  L Q
Sbjct:  370 GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQ 756          

HSP 6 Score: 172.555 bits (436), Expect = 1.270e-44
Identity = 88/382 (23.04%), Postives = 176/382 (46.07%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIE--AANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH ++V++L+    +      + + P+H+A   G  ++VK L++           +  P+H A + G  E+V+LL+ +  +  A   +   PL+ A  +GH D+  LL++   +I    +    P+H+A   G L++   L  +  + +   A Q    P+H A     +++  +L+ K     +  K    P+H+A  K   E+ +VL+    +       G   +HLA ++G+AD+  LL+  +  I +  +     +H A +     + ++L     ++    K    P+H AS  G+++    L+  +  + A  +N    +H A ++GH  +V  L++   +   LT  GN+ + +A +     +++ L 
Sbjct:  407 IHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLS 788          

HSP 7 Score: 160.999 bits (406), Expect = 5.407e-41
Identity = 89/349 (25.50%), Postives = 170/349 (48.71%), Query Frame = 2
Query:  947 DENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILI----------------TKKCDIEAP-------------EKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            ++N    +H A K GH +VV  L+ ++  ++   K     LH+A   G TDIVR+L++   NI+A  QN   P+++A  + HL+IVK L +   N   A +  + P+  A  +G +++V +L+                 +K D  A               K    P+H+A   G+  +  +L+N    ++    +G   +H+A ++G  ++ +LL+D    I+   +    P+H A   GH +++++L++ +  I A  K    P+H A++  H+ C ++L+ ++  ++    +    +H+A   GH  + KLL+       A  L G +P+ +A K  + +++ELL
Sbjct:   41 NQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELL 389          

HSP 8 Score: 70.4774 bits (171), Expect = 1.230e-12
Identity = 37/138 (26.81%), Postives = 69/138 (50.00%), Query Frame = 2
Query: 1511 IDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            +    DI  C+Q     +H A + GH ++V  L+     I+   K     +H A+ AG  +  ++L+    +I A +QN    +++A ++ H EIVK L+    N    T  G +P+ +A +   ++++ LL ++ TK
Sbjct:   31 LKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK 168          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 2.268e-45
Identity = 87/380 (22.89%), Postives = 178/380 (46.84%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H + F G+ +IV +L+    +      + +  +H+A   G  ++V+ L+      +A       P+H A + G  E+V+LL+    + +A   N   PLH+A  +GH D+  +L++   ++    +    P+H+A   G +++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   EI   L+ +  +  A    G   +HL  ++G+AD+A LL+    D+    +    P+H A +     + ++L+    ++ A  K    P+  A   G+++    L+    D+ +  +N    +H A ++GH  IV LL++       +T+ GN+ + +A +     +++ LK
Sbjct:   52 MHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLK 431          

HSP 2 Score: 169.088 bits (427), Expect = 3.217e-43
Identity = 86/349 (24.64%), Postives = 166/349 (47.56%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEA--CAQNERRAIHLACEKGHAEIVKLL 1807
            A+H A   G  ++V+ L+      +  A + Q P+H+A   G  +IV++L++     +A   N   P+H A + GH++V  +L+    +L    K    PLH+A + G  ++  LL+ +  + DA  +N   P+H+A    + K+   L +Q  +  A  +  + P+H A  K Q EI   L+    +  A  ++ + P+HL   +GH ++  +L+    D+      G   +HLA ++   ++A++L+ +   +    ++   P+  AC  G+ ++V  L+    ++ +  K    P+H A++ GH     +L+  KC         N   A+ +A   G+  +V  L
Sbjct:   84 ALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 3 Score: 164.466 bits (415), Expect = 8.037e-42
Identity = 83/352 (23.58%), Postives = 164/352 (46.59%), Query Frame = 2
Query:  815 LINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            L+++  N    A     P+H+AC+K   +++++L++     EA  E+   P+H +   G+  +V +L+    +  A +   +  LH+A   G T++VR L+     +DA  +    P+H+A   G L+IV+ L     + +AA    + P+H A  +G +++  IL+     +    KK   P+H+A   G  E+  +L+      +A   +G   +H+A       +A LL+D         +    P+H A +    EI   L++      A  +    P+H  ++ GH +   +L+ +  D+    ++    +HLA ++    + ++LV+   +  A T  G +P+ +A
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVA 352          

HSP 4 Score: 155.221 bits (391), Expect = 7.384e-39
Identity = 78/331 (23.56%), Postives = 158/331 (47.73%), Query Frame = 2
Query:  914 LIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            L+++  +      N   P+H ACK+    V++LL+    ++EA  ++   P+H++   G+ +IV +L+    + +A +      +H+A   G  ++V++L      ++A  +    P+H A   G+ EIV +L+      +A       P+H+A  +GH+++  +L+ H   +      G+  +H+A + G  ++A LL+      +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   +E    L+    +  A  +     +HL  ++GHA++  LL+  + +    T  G SP+ LA +  K  + E+L
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEIL 331          

HSP 5 Score: 118.627 bits (296), Expect = 1.801e-27
Identity = 61/254 (24.02%), Postives = 118/254 (46.46%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACD--DDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  ++  +L+ +  + +   +    P+H+A     +K+  +L++Q     A  +N   P+H A K+   E+   L+       A  +    PLHL  ++GH D+  LL+ +  +++   ++   P+HLA  +  + + + L     ++ A  ++ + P+  AC  G  ++VN L+    D+ +  K    P+H A  +GH  IV +L+  KC     D   +G  A+ +A   GY  +   L
Sbjct:  179 KGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 3.411e-45
Identity = 87/380 (22.89%), Postives = 178/380 (46.84%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            +H + F G+ +IV +L+    +      + +  +H+A   G  ++V+ L+      +A       P+H A + G  E+V+LL+    + +A   N   PLH+A  +GH D+  +L++   ++    +    P+H+A   G +++   L  +  + +AA +    P+H A     +++  +L+ +     A  K    P+H+A  K   EI   L+ +  +  A    G   +HL  ++G+AD+A LL+    D+    +    P+H A +     + ++L+    ++ A  K    P+  A   G+++    L+    D+ +  +N    +H A ++GH  IV LL++       +T+ GN+ + +A +     +++ LK
Sbjct:  142 MHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLK 521          

HSP 2 Score: 174.096 bits (440), Expect = 1.047e-44
Identity = 89/368 (24.18%), Postives = 172/368 (46.74%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            A+H A   GH    K+L+++  N    A     P+H+AC+K   +++++L++     EA  E+   P+H +   G+  +V +L+    +  A +   +  LH+A   G T++VR L+     +DA  +    P+H+A   G L+IV+ L     + +AA    + P+H A  +G +++  IL+     +    KK   P+H+A   G  E+  +L+      +A   +G   +H+A       +A LL+D         +    P+H A +    EI   L++      A  +    P+H  ++ GH +   +L+ +  D+    ++    +HLA ++    + ++LV+   +  A T  G +P+ +A
Sbjct:   75 ALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVA 442          

HSP 3 Score: 174.096 bits (440), Expect = 1.075e-44
Identity = 95/379 (25.07%), Postives = 182/379 (48.02%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   GH  +V++L+ Q        +    P+H+A +  + + V++L++ +   +    +    +H A   GH    K+L+++  N      N   PLH+AC+K    ++ LL+    +I+A  ++   P+H++   G+L IV  L     +  A N      +H A   GQ E+V  L+     ++A  ++   P+H+A   G  EIV++L+ H    +A   +G+  +H+A  +G+ D+  +L+++   + V  +    P+H A + G  E+  LL+    + +A  K    P+H AS   + +   +L+ +     A A+N    +H+A +K   EI   L+     T A+T +G +P+ L  +    ++  LL
Sbjct:   10 LHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLL 388          

HSP 4 Score: 169.474 bits (428), Expect = 3.261e-43
Identity = 91/381 (23.88%), Postives = 176/381 (46.19%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEA--CAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIEL 1903
            A+H A   G  ++V+ L+      +  A + Q P+H+A   G  +IV++L++     +A   N   P+H A + GH++V  +L+    +L    K    PLH+A + G  ++  LL+ +  + DA  +N   P+H+A    + K+   L +Q  +  A  +  + P+H A  K Q EI   L+    +  A  ++ + P+HL   +GH ++  +L+    D+      G   +HLA ++   ++A++L+ +   +    ++   P+  AC  G+ ++V  L+    ++ +  K    P+H A++ GH     +L+  KC         N   A+ +A   G+  +V  L      T   T   N   ++       E++E+
Sbjct:  174 ALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVSNPSSRVNVPETMTEVLEV 552          

HSP 5 Score: 169.088 bits (427), Expect = 4.165e-43
Identity = 87/379 (22.96%), Postives = 179/379 (47.23%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + V++L+  +   +         +H+A   G+ +  K+L+++  +      N   P+H ACK+    V++LL+    ++EA  ++   P+H++   G+ +IV +L+    + +A +      +H+A   G  ++V++L      ++A  +    P+H A   G+ EIV +L+      +A       P+H+A  +GH+++  +L+ H   +      G+  +H+A + G  ++A LL+      +   +    P+H A    + ++  LL+D   +  A  K    P+H A++   +E    L+    +  A  +     +HL  ++GHA++  LL+  + +    T  G SP+ LA +  K  + E+L
Sbjct:   43 LHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEIL 421          

HSP 6 Score: 156.377 bits (394), Expect = 4.171e-39
Identity = 84/322 (26.09%), Postives = 158/322 (49.07%), Query Frame = 2
Query:  941 AYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+ ++   P+H A + GH++VV++L+ Q   + A  KN   PLH+A +  H + V++L+  +  +D    +    +H+A   GH +  K L ++  N        + P+H AC K +  ++ +L+     IEA  +  L P+H++   G+  IV +L+       A +  G  A+H+A   G  ++ + L+ N   ++   +  + P+H A  +G  EIVQLL+    + +A       P+H A+  GH + T IL+     +    +     +H+A + G  E+  LL++   + +A    G +P+ +A     Q++  LL
Sbjct:    1 AHRQDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLL 322          

HSP 7 Score: 119.013 bits (297), Expect = 1.930e-27
Identity = 61/254 (24.02%), Postives = 118/254 (46.46%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACD--DDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  ++  +L+ +  + +   +    P+H+A     +K+  +L++Q     A  +N   P+H A K+   E+   L+       A  +    PLHL  ++GH D+  LL+ +  +++   ++   P+HLA  +  + + + L     ++ A  ++ + P+  AC  G  ++VN L+    D+ +  K    P+H A  +GH  IV +L+  KC     D   +G  A+ +A   GY  +   L
Sbjct:  269 KGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 8 Score: 107.457 bits (267), Expect = 6.520e-24
Identity = 62/225 (27.56%), Postives = 110/225 (48.89%), Query Frame = 2
Query: 1238 AANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A  Q    P+H A   G +++V IL+ +   I A  K  L P+H+A    H E V+VL+ ++  ++    D   A+H+A   G+   A++L+D   +  V       P+H AC+     +++LL+    +IEA  +    P+H ++  G++    IL+       A       A+H+A   G  E+V+ L+R     +A   +  +P+ +A +  K EI++LL Q
Sbjct:    1 AHRQDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQ 225          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.548 bits (423), Expect = 1.219e-42
Identity = 96/321 (29.91%), Postives = 167/321 (52.02%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNC-RPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQN--SNRPIHLACDKGHLKIVKALTNQKCNIEAANQINW-RPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWR--AIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILM 1711
            A+  AC  GH D+V +LI +  N E   +K   P+ LA   G+  +V++L++   D EA  E     P+  AC  G +EVV+LLI +  N E  + ++  PL LA   G+ +I+++L++    I++   +     P+ LA   GH   VK L +   +I A  + N    +  AC++G+ E+V++L+ +K ++E   K  L P+  A   G+ E+  VL+    D+ A      R  A+ +A +KG+    +L+I     I+V ++    P+  A   GH ++VQLL+++  +++A D     P+  A   GHV+  + L+
Sbjct:  936 ALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLV 1256          

HSP 2 Score: 164.081 bits (414), Expect = 1.696e-41
Identity = 95/352 (26.99%), Postives = 172/352 (48.86%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAY-DENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEA-PEKKNLRPIHLACGKGHKEIVEVLINHKCDIE-ACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDI-EACAQNERRAIHLACEKGHAEIVKLLV 1810
            A+ +AC  G+ D+V++L+    N E   E    P+  A   G+ ++ ++L+E+      + +E     +  AC +GH E+V+ L+    + E         L  AC  GH ++ RLL++    ++    +   P+ LA   GH+++   L  +  N+E  N   + P+  A  +G +E+V +L+ +  +I A  E+     + LAC  G  E+ + LI    D+E  C       +  A ++G+ ++ + L+    ++          + YACE GHT++  LL+ A  ++E   +  R P+  A+ AGHV   + L+ K  D+  A A N+   + LAC  GH  +V+LL+
Sbjct:  203 ALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCSTP----LMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLL 550          

HSP 3 Score: 148.673 bits (374), Expect = 1.170e-36
Identity = 93/405 (22.96%), Postives = 180/405 (44.44%), Query Frame = 2
Query:  764 RAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYD-ENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEA-ANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRR-------------------------------PIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKS 1879
            R++  AC +G  + V+ L+ +  +     E+ +  + LAC  GY ++ ++L+    + E    + +  P+  A   G  ++V+LL+    ++ A        L  AC  G+ D+VR+L++   N++ ++++ + P+  A   GH+++ + L  +   I   +N+     +  AC+KG  E+V  L+    D E    +    +  AC  GH E+  +L+     +    D     + LA   G+ ++A LLI+   ++E  +     P+  A   GH E+V LL+    NI A  +  +                                P+  A++ GH+E  K L+    ++ A       A+  ACE GH ++  LL++A  + E  +  G +P+  A ++
Sbjct:  102 RSLAEACSDGDVNAVRKLLGEGRSVHETTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARA 506          

HSP 4 Score: 147.902 bits (372), Expect = 1.788e-36
Identity = 94/379 (24.80%), Postives = 173/379 (45.65%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEA-CDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEA-CDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGN-SPIKLAEKSKKQEIIELL 1906
            A   G  DIV++L+    +    +      +  AC  GY  +V++L+E   + E ++E+   P+  A   GH EV +LL+ +   +    ++  +  L LAC KGH ++VR L++   + +      +  +  AC  GH+++ + L      +         P+  A   G  E+  +LI +  ++E    +   P+  A  +GH+E+V +L+    +I A  ++    A+ LAC  G+ ++A  LI    D+E+       P+  A + GH E+V+ L+ A  N+ A        + YA E GH +   +L+    D+E  ++  R  +  A   GH   V+ L+    +    T   + + + LA       ++ELL
Sbjct:  174 AASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELG---CSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELL 549          

HSP 5 Score: 137.117 bits (344), Expect = 4.743e-33
Identity = 101/398 (25.38%), Postives = 172/398 (43.22%), Query Frame = 2
Query:  827 KCNFETCAEKNQ---RPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACD-KNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKK-NLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEA-CAQNERRAIHLAC------------------------------EKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            +   ET A   Q   R +  AC  G    V+ L+ +        E     +  AC  G+ E+ ++L+    N+E    K +  PL  A   G  DIVRLL+    +++A     N  +  AC  G++ +V+ L     N+E  N+    P+  A   G  E+  +L+ +   I     +     + LAC KGH E+V  L+    D E   D+   A+  AC  G+ ++A+LL+++   + +     + P+  A   GH E+  LLI+   N+E  +     P+  A+  GH E   +L+ +  +I A   + +  A+ LAC                              ++GH E+VK L+ A  N  A T  G++ +  A ++   ++ +LL Q
Sbjct:   87 RMRAETAAATGQPDNRSLAEACSDGDVNAVRKLLGEGRSVHETTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQ 484          

HSP 6 Score: 133.265 bits (334), Expect = 6.373e-32
Identity = 85/336 (25.30%), Postives = 169/336 (50.30%), Query Frame = 2
Query:  947 DENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDA-NDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEA--PEKKNLRPIHLACGKGHKEIVEVLINHKCDIEA-CDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRR--PIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSD 1936
            + N+   +  AC  GH+++V +LI +  N+E  DK    PL LA   GH ++V LL+D   +I+A +++  + P+ LAC  G  ++V+ L  +  N E  N  ++ P+  A   G   I+ IL+    +I +    K  + P+ LA   GH   V++L++   DI A  + +   A+ LAC +G  ++  LL++   ++E   +    P+  A   G+ E+ ++L++   ++ A    + R   +  A++ GH +  ++++ +   I+   +     + LA   GH ++V+LLV +  + +A   +  +P+  A +    +++  L +   +  SD
Sbjct:  930 ESNHDTALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLVKEVNQFPSD 1265          

HSP 7 Score: 105.531 bits (262), Expect = 2.691e-23
Identity = 68/282 (24.11%), Postives = 119/282 (42.20%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQR-------------------------------PLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPI-HLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLID 1516
            A+  AC +GH ++ ++L+         A+  + P+ LA   G+ ++  +LIE+  + E  ++    P+  A + GH+E+V LL+ Q  N+ A  +  Q                                PL  A ++GH ++V+ L+    N+ A     +  +  AC+ GH  +   L     ++E  ++    P+  A   G    V  LI+K  D+      N   +  LAC  GH  +VE+L+ H  D      DG   +  A + G+  +   LID
Sbjct:  303 ALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLID 584          

HSP 8 Score: 100.138 bits (248), Expect = 1.139e-21
Identity = 54/189 (28.57%), Postives = 96/189 (50.79%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCR--PIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKC 1327
            A+  ACF+G  ++V +L+ +K N E  A+    P+  A   GY ++ ++L+E+  D  A    + R   +  A  +GH +  +L+I++  +++  +K    PL LA   GH D+V+LL++   ++DA D     P+  A  KGH+K+V+ L           ++N  P    C +    I +  + KKC
Sbjct: 1105 ALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLV---------KEVNQFPSDSECMRYIATITDKELLKKC 1284          

HSP 9 Score: 92.4337 bits (228), Expect = 2.490e-19
Identity = 58/214 (27.10%), Postives = 105/214 (49.07%), Query Frame = 2
Query: 1208 ALTNQKCNIEAA-NQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRA----IHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACA-QNERRAIHLACEKGHAEIVKLLVRAHCNTE 1831
            ALT  +    AA  Q + R +  AC  G    V  L+ +   +    ++    + LAC  G+ E+ +VL+    ++E   D G +     +  A   G+ DI +LL+ +  D+          + YAC  G+ ++V++L++A  N+E  ++    P+  A+  GHVE  ++L+ +   I   + + +  A+ LAC KGH E+V+ L+ A  + E
Sbjct:   84 ALTRMRAETAAATGQPDNRSLAEACSDGDVNAVRKLLGEGRSVHETTEEGESLLCLACSAGYYELAQVLLAMHANVE---DRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQE 294          

HSP 10 Score: 87.0409 bits (214), Expect = 1.230e-17
Identity = 60/225 (26.67%), Postives = 99/225 (44.00%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQR-PIHLACEKGYEKIVKILIEQKCDTEAYDENNCR-PIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPI-HFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH 1420
            + +  +  A  EGH ++V +L+ Q  N     E+ Q   + LAC  G+ ++   LI+   D E      C  P+  A + GH E+VK L+    N+ A        L  ACE GHTD+  LL+    +++   +    P+  A   GH+  V+ L ++  ++  A   N   +   AC  G   +V +L+    D     K     +  A   GH  +V  LI++
Sbjct:  365 EGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLEL----GCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLIDY 585          

HSP 11 Score: 66.2402 bits (160), Expect = 3.371e-11
Identity = 41/157 (26.11%), Postives = 70/157 (44.59%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRP-LHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAAN 1246
            A  EGH ++VK L+    N           +  ACE G+  +  +L++   D E   E    P+  A + GH   V+ LI++  ++     NN    L LAC  GH  +V LL+    + +   ++ +  +  A   GH  +V  L +   N+ +A+
Sbjct:  437 AAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLIDYPHNLLSAS 593          

HSP 12 Score: 58.9214 bits (141), Expect = 4.588e-9
Identity = 37/124 (29.84%), Postives = 57/124 (45.97%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPI-HFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNI 1135
            A+ +AC  GH D+  +L+    + E  +E  + P+  A   G+   V+ LI +  D      NN   +   AC  GH  VV+LL+    +     K+    L  A + GHT +V  LID   N+
Sbjct:  466 ALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLIDYPHNL 589          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 77.411 bits (189), Expect = 2.348e-16
Identity = 51/195 (26.15%), Postives = 98/195 (50.26%), Query Frame = 2
Query: 1154 SNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWR-PIHFACWKGQKEIVNILITKKCDI---EAPEKKNLRPIHLACGKGHKEIVEVLINH--KCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID-ANCNIEACDKWNRRPIHYASEAGHVECTKILMLK 1717
            SN P+H AC +     V+ L + K ++      + R P+H++      EI + L++K  ++   + P+     P H+AC  G+ E+V+ L +   K D+    + G   +HLA  K + +++Q LI+N   + + D+ ++ P+H A  +G  ++++LL       +   DK    P+ +A   GH +   +L+ K
Sbjct:    2 SNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEK 196          

HSP 2 Score: 58.5362 bits (140), Expect = 5.360e-10
Identity = 48/191 (25.13%), Postives = 89/191 (46.60%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQR-PIHLACEKGYEKIVKILIE--QKCDTEAY-DENNCRPIHFACKRGHKEVVKLLINQ--KCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTN-QKCNIEAANQINWRPIHFACWKGQKEIVNILITK 1321
            +H AC E     V+ L++ K +     +++ R P+H +      +I   L+   +  + + Y D++   P H AC  G+ EVVK L ++  K +L          LHLA  K   ++ + LI+   ++   D+ +  P+H A   G LK+++ L    K  +   ++  W P+  A  +G  +   +L+ K
Sbjct:    6 LHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEK 196          

HSP 3 Score: 50.0618 bits (118), Expect = 3.694e-7
Identity = 35/124 (28.23%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQ--KCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLIN-QKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQ 1123
            W   H AC  G+ ++VK L ++  K +      +    +HLA  K + ++ + LIE        D+ N  P+H A   G  ++++LL    K  +   DK    PL  A  +GH D   LL+++
Sbjct:   73 WTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEK 196          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 68.1662 bits (165), Expect = 4.572e-12
Identity = 64/271 (23.62%), Postives = 111/271 (40.96%), Query Frame = 2
Query:  995 KEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC--NIDANDQNSNRPIHLACDKGHLKIV---------------KALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACE-KGYADIAQLLIDNNCDIEVCDQISK-RPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNE 1750
            KE V+ L+N      A D +++ PLH A E G  + V  L+      ++D  D +S  P+ LA    H+ +V               K + +   N+ ++ ++ + P++ AC     +   +L+  +    A   KN    HL C    K+               +  G   +H+  +  G   + QLLI    D    D  +K  PI YA   GH+E++  L+  N  ++  D     P+ YA    HV+    L+ +  ++ +   NE
Sbjct:  410 KETVQKLLN------AQDIHSRVPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHL-CQPLFKK---------------NSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNE 658          

HSP 2 Score: 50.447 bits (119), Expect = 1.260e-6
Identity = 39/174 (22.41%), Postives = 78/174 (44.83%), Query Frame = 2
Query:  797 ADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENN------CRPI-----------HFACK-RGHKEVVKLLINQKCNLEACDKNNQ-RPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAA--NQIN 1255
            + I K +++   N  +  +    P+++AC+       K+L+E +    A +  N      C+P+           H   K  G  ++++LLI    +    D  N+  P+  A   GH++++  L+     +D  D N + P+  A  + H+ ++ AL  +  N+ +A  N+IN
Sbjct:  487 SPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNEIN 660          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 66.6254 bits (161), Expect = 1.293e-11
Identity = 53/204 (25.98%), Postives = 94/204 (46.08%), Query Frame = 2
Query: 1046 DKNNQRPLHLACEKGHTDIVRLLID--QKCNI----------DANDQNSNRPIHLACDKGHLKIVKALTNQ-KCNIEAANQINWRPIHFAC-WKGQKEIVNILITKKCDIEAPEKK-NLRPIHLACGKGHKEIVEVLINHKCDIEACDD-DGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLL 1609
            D   + PLH +C+ G +++ +L+I   ++ NI             D  S  P+HL     H K  + L      N++  +      +H A  W     +  +L +K+ DI   + + +  P++LAC     E    L+ +  D+E  +   GW AI +A  +G+ DI +LLI NN + ++ D+    P+ +A   GH  I  ++
Sbjct:  425 DNYKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQSLDPNVKLKSS---SLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMV 625          

HSP 2 Score: 55.0694 bits (131), Expect = 5.093e-8
Identity = 45/204 (22.06%), Postives = 89/204 (43.63%), Query Frame = 2
Query:  860 QRPIHLACEKGYEKIVKILIEQKC-----------DTEAY-DENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKN----NQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNS---NRPIHLACDKGHLKIVKALTNQKCNIEAANQI-NWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVL 1411
            + P+H +C+ G  ++ K++I+              D  A+ D  +  P+H      H +  ++L      L++ D N    +   LHLA E  +  ++ +L+  K   D N Q++     P++LAC     +    L     ++E   ++  W  I  A  +G  +IV +LI    + +  ++    P+  A  +GH  I +++
Sbjct:  429 RTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVL------LQSLDPNVKLKSSSLLHLATEWNNYPLLHVLLSSK-RFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMV 625          

HSP 3 Score: 49.6766 bits (117), Expect = 2.297e-6
Identity = 45/198 (22.73%), Postives = 84/198 (42.42%), Query Frame = 2
Query: 1262 PIHFACWKGQKEIVNILI--TKKCDI--EAP--------EKKNLRPIHLACGKGHKEIVEVLI--------------------------------NHKCDIEACDDDGWRA-IHLACEKGYADIAQLLIDNNCDIEVCDQI-SKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLK 1717
            P+H++C  G  E+  ++I   K+ +I  E P        + ++L P+HL     H +  EVL+                                + + DI   D++     ++LAC   + + A  L+ N  D+E+ +++     I  A   G T+IV+LLI  N N +  D+    P+ +A   GH+    ++ ++
Sbjct:  431 PLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQSLDPNVKLKSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMVQIR 628          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 65.4698 bits (158), Expect = 2.355e-11
Identity = 55/260 (21.15%), Postives = 107/260 (41.15%), Query Frame = 2
Query: 1013 LINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCN--------IDANDQNSNRPI----HLACDKGHLKIVKALTNQK---CNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKK-NLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNC-----DIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDI 1729
            L N++  ++  + ++Q  + L      T +  L   +  N        ++ ND+    P+    H AC +G L  VK + + K    N +  +  +   +H+A    +  +V+ L+++  D+ A     +  P+H A   G+  IV+ L+ H  D    DD G+  +HL+       +   ++ N       DI+  D   +  + +A   G +  V  L+    +I+  D     P+H+ +  G     K L+    D 
Sbjct:   14 LTNEEQTVDPSNNDSQEDISLGDSNEITSLASLKAIRSGNEEESGNEQVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADF 273          

HSP 2 Score: 53.5286 bits (127), Expect = 1.417e-7
Identity = 44/196 (22.45%), Postives = 77/196 (39.29%), Query Frame = 2
Query:  773 HFACFEGHADIVKMLINQK---CNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEA-YDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC-----NIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDI 1333
            H AC  G    VK +I+ K    N +  + ++   +H A       +V  L+ Q  D  A     +  P+H+A + G+  +V  L+    +    D      LHL+    +  +V  ++         +ID  D      +  A  +G    V  L     +I+ A+   + P+H+   KGQ  ++  LI    D 
Sbjct:   78 HTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADF 273          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 59.3066 bits (142), Expect = 1.228e-9
Identity = 65/268 (24.25%), Postives = 111/268 (41.42%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETC--AEKNQRPIHLACEKGYEKIVKILIEQKCD----TEAYDENNCRPIHFACKRGHKEVVKLLINQKCN-LEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQ---KCNIEAANQINWRPIHFACWKGQKEIVNIL--ITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQ 1546
            A  EG+  IVK L+ +  +  T   +E     +H A   G   I   LI+   D     + +  N C  +H A  +GH++ + LL+ Q    +    +N + P+H+AC   +   + LLI    ++   D N + P+H+  + G +  +K L N+     +    ++ NW+PI  A      E+ NI   + K+   + P         L  GK        ++N K   E    DG   + L+    Y+     L  NN  + V  +
Sbjct:   12 AIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTC--VHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVAQ---TFEVGNIYSKVLKEVKKKGPP--------LGAGKKPSSFRTPILNAKATFE----DGPSPV-LSMNSPYS-----LYSNNSPLPVLPR 256          

HSP 2 Score: 57.7658 bits (138), Expect = 4.665e-9
Identity = 42/152 (27.63%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLIN---------QKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCR-PIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQ-KCNIDAN--DQNSNRPIHLA 1177
            W ++H+A + G   I   LI          +     TC       +HLA  KG+E+ + +L++Q      +   N R PIH AC   + + + LLI    +L   D N   PLH+  E G    +++L+++ + ++D N  D+ + +PI +A
Sbjct:   41 WSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTC-------VHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVA 185          

HSP 3 Score: 54.6842 bits (130), Expect = 3.705e-8
Identity = 57/200 (28.50%), Postives = 89/200 (44.50%), Query Frame = 2
Query: 1175 ACDKGHLKIVKALTNQK----CNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEK--KNLRPIHLACGKGHKEIVEVL-------INHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID---ANCNIEACDKWNRRPIHYAS--EAGHVECTKILMLKK 1720
            A  +G+L IVK L  +      NI++ N   W  +H+A + G+  I   LI    D     K  K    +HLA  KGH++ + +L       INH+       ++G   IH+AC   Y     LLI    D+ V D     P+H   E G    +++L++    + +    DK N +PI  A   E G++    +  +KK
Sbjct:   12 AIIEGNLLIVKRLLRRNPDLLTNIDSEN--GWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHR------GENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVAQTFEVGNIYSKVLKEVKK 203          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 102.064 bits (253), Expect = 1.121e-22
Identity = 97/391 (24.81%), Postives = 160/391 (40.92%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLI---NQKCNFETCAE-------KNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFA----------------------CK--RGHKEV------VKLLINQKCNLEAC----DKNNQRPLHLACEKGHTDIVRLLIDQKCNI---DANDQNS-------------------NRPIHLACDK--------GHLKIVKALT--------NQKCNIEAANQINWRPIHFACWKGQKEIVNILITK-KCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVE 1693
            +HFAC EG+  + K+L      +  + T ++       + Q  +HLA E G+  + K+ +E+  +  A  E+  +  H                        CK  +  +E+      V ++I       AC    DK+   PL +A EK H D VR L+    +I   D ND+NS                    +P+   CD         G  K++  L         N  C I++ N  +  PIH+A   G+   V  L+ +    I   +  +  P+HLA   GH  +V+ L+     I+A +   W  +  A  +G  ++A +L+D +  ++  D+    P+H A   GH E+V+LL+    NI   D   R  +  A E+ H E
Sbjct:   41 LHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGAC-IDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKE 430          

HSP 2 Score: 99.3673 bits (246), Expect = 8.023e-22
Identity = 98/401 (24.44%), Postives = 155/401 (38.65%), Query Frame = 2
Query:  866 PIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLI----------NQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLA------CDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADI-------------------------------------AQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIV-QLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            P+H+AC  G   + K L+E   D  + DE    P+HFAC  G+  V KLL                +   D+  Q  LHLA E GH D+ +L +++  N++A  ++ N+  H        C    +K+ K      C  E       R I    +     I  I+  + C IE  +K    P+ +A  K H + V  L+ H  DI A D +   ++  A  +G  +                                      +QLL+DN   I+  +     PIHYA + G    V  LL      I   D  +  P+H A+  GH    K L+ +   I+A        +  A  +G  E+  +L+      +       +P+ LA +    E+++LL
Sbjct:    7 PLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIK----REILLYFFDVVIIICYIIRFRAC-IECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLL 402          

HSP 3 Score: 92.8189 bits (229), Expect = 1.051e-19
Identity = 67/264 (25.38%), Postives = 117/264 (44.32%), Query Frame = 2
Query:  845 CAEKNQ-RPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVV-------------------------------------KLLINQKCNLEACDKNNQRPLHLACEKGHTDIV-RLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDN 1519
            C +K++  P+ +A EK +   V+ L++   D  A D N+   +  A   G  E +                                     +LL++    +++ +  +  P+H A + G    V  LL      I+  D  SN P+HLA   GH  +VK L  +   I+A N   W P+  A  +G  E+ NIL+ +   ++  +K    P+HLA  +GH E+V++L++ K +I   D  G   + +A E  + ++A  +ID+
Sbjct:  175 CRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 4 Score: 51.6026 bits (122), Expect = 9.797e-7
Identity = 53/251 (21.12%), Postives = 104/251 (41.43%), Query Frame = 2
Query: 1049 KNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLA------CEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKG 1783
            K    PLH+AC  G   + + L++   ++ + D+    P+H AC +G+L + K L                    A  +G    V+ ++T +      +++    +HLA   GH ++ ++ +    ++ A  +   +  H        C      +++L   + C  E   +I +  + Y  ++    I+  +I     IE  DK    P+  A+E  HV+  + L+    DI A   N+R ++  A  +G
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLL-----------------FVAAELRGGWSTVSKMVTDQ------DREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSE---KIKREILLYFFDV--VIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEG 224          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 93.2041 bits (230), Expect = 2.710e-21
Identity = 60/222 (27.03%), Postives = 111/222 (50.00%), Query Frame = 2
Query: 1061 RPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKG-HKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKR----PIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILM 1711
            +PLHLAC  G T+  + L+    +++A D N   P+H A   G++  ++ L +Q  +    +++   P+H+A        V  L+T   ++  P+ K   P+H A       + VE L+ ++ +    D  G+ A+H A   G+    ++L+D + + ++ ++ S      P+H A   GH   +++LI +  ++E  D   R P+  AS  GHVEC + L+
Sbjct:    2 QPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSAN-DLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLL 222          

HSP 2 Score: 91.6633 bits (226), Expect = 9.460e-21
Identity = 68/230 (29.57%), Postives = 112/230 (48.70%), Query Frame = 2
Query:  863 RPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDI--VRLLIDQKCNIDANDQNSNRPIHLACDKG-HLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKN-------LRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNN 1522
            +P+HLAC  G+ +  K L+    D  A D N+  P+H A   G+   ++LL++Q  +    DK  + PLH A   GHT+   V  L+    N++  D  +  P+H A       K V+ L   + N    ++  +  +H+A   G K  + +L+    D+ A +  N       + P+HLA   GHK  +EVLI    D+E  DD G   + LA  +G+ +  + L+++N
Sbjct:    2 QPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAA--GHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLL----DVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHN 225          

HSP 3 Score: 83.1889 bits (204), Expect = 8.094e-18
Identity = 58/224 (25.89%), Postives = 103/224 (45.98%), Query Frame = 2
Query:  962 RPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKG-QKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAI---HLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDAN 1621
            +P+H AC  G  E  K L+    ++ A D N++ PLH A   G+ + + LL+ Q  + +  D+    P+H A    + + V +L     N+   +     P+H+A       + V  L+  + +    +K+    +H A   GHK  +E+L++   +       G   +   HLA   G+    ++LI +  D+EV D   + P+  A   GH E V+ L++ N
Sbjct:    2 QPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHN 225          

HSP 4 Score: 74.3294 bits (181), Expect = 6.798e-15
Identity = 55/223 (24.66%), Postives = 92/223 (41.26%), Query Frame = 2
Query:  764 RAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKG-HTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNI---EAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH 1420
            + +H AC  G  +  K L+    +       ++ P+H A   G    +++L+ Q  D    D+    P+H+A    +   V  L+    N+   D     PLH A         V  L+  + N    D+     +H A   GH   ++ L +   N     ++      P+H A + G K  + +LI    D+E  + +   P+ LA  +GH E VE L+NH
Sbjct:    2 QPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNH 224          

HSP 5 Score: 65.4698 bits (158), Expect = 7.080e-12
Identity = 55/224 (24.55%), Postives = 94/224 (41.96%), Query Frame = 2
Query: 1259 RPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMG-HTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRA-------IHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +P+H AC  G  E    L+    D+ A +  +  P+H A   G+   +E+L++   D    D  G   +H A           L+    ++   D  +  P+HYA       + V+ L+    N    DK     +HYAS  GH    ++L+    D+ A     R +       +HLA   GH   +++L+++  + E    +G +P+ LA      E +E L
Sbjct:    2 QPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLL----DVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECL 221          

HSP 6 Score: 65.0846 bits (157), Expect = 1.002e-11
Identity = 43/169 (25.44%), Postives = 78/169 (46.15%), Query Frame = 2
Query: 1355 LRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAG-HVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSP 1858
            ++P+HLAC  G  E  + L+ +  D+ A D++    +H A   G  +  +LL+    D    D++ + P+HYA    +   V  L+ A  N+   D     P+HYA+ +    +C + L+  + +     +    A+H A   GH   +++L+    N + L     SP
Sbjct:    1 MQPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSAN-DLLNRSSGSP 168          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 77.7962 bits (190), Expect = 2.033e-16
Identity = 52/184 (28.26%), Postives = 88/184 (47.83%), Query Frame = 2
Query:  977 ACKRGHKEVV-KLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNR---PIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITK-KCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLI 1513
            AC+ G K+ V KLL     NL   D +   PLH A    H DIV++L+D   ++D     S +   PI  A     ++  + L     ++   N      +H A  +G  ++V +L+   + D+   ++ N   +H+A   G   I++ L+    +I A D+DG+ A HLA  +G  ++ Q L+
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLL 185          

HSP 2 Score: 65.855 bits (159), Expect = 2.645e-12
Identity = 45/186 (24.19%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 1373 ACGKGHKEIVEVLI-NHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKR---PIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLK-KCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQT 1915
            AC  G K+ V  L+  +  ++   D DG+  +H A    + DI Q+L+D   D++V    S +   PI  A +    E  ++L+ A  ++   + + +  +H+A+  GH +  ++L+   + D+    ++   ++H+A   G   I+K L+    N  A    G +   LA +  ++E+++ L +T
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRT 187          

HSP 3 Score: 60.4622 bits (145), Expect = 2.146e-10
Identity = 39/152 (25.66%), Postives = 75/152 (49.34%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKN-QRPIHLACEKGYEKI--VKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLI-NQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKAL 1213
            +H+A    H DIV+ML++   + +     + QR   + C   +  I   ++L+    D    +      +H A +RGH ++V+LL+ + + ++   D++N   LH+A   G   I++ L+    NI A D +     HLA  +G  ++++ L
Sbjct:   33 LHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTL 184          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 73.9442 bits (180), Expect = 8.305e-15
Identity = 48/189 (25.40%), Postives = 84/189 (44.44%), Query Frame = 2
Query: 1064 PLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNI 1630
            PLH+AC+KG  ++ RLL+++   +D  +     P+H+A   G    +K L ++   I+  +  +  P   A   G+ E   +L+ K       ++    P+HLAC  G    VE L          D++G  A+H+A   G+  +   L+    DI   D     P+  A + G  +    L+ +  +I
Sbjct:   39 PLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK-------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 2 Score: 73.559 bits (179), Expect = 1.093e-14
Identity = 47/183 (25.68%), Postives = 89/183 (48.63%), Query Frame = 2
Query:  866 PIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGH-KEIVEVL 1411
            P+H+AC+KG  ++ ++L+E+    +  ++    P+H A   G  + +K L+++   ++  D +++ P   A   G T+   LL+++       D+N   P+HLAC  G    V+ALT    +    ++     +H A   G +++V  L+    DI A +     P+  A   G  K  +E+L
Sbjct:   39 PLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK-------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELL 214          

HSP 3 Score: 66.6254 bits (161), Expect = 3.033e-12
Identity = 43/173 (24.86%), Postives = 75/173 (43.35%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKG 1288
            +H AC +G  ++ ++L+ +    +   +K + P+H+A   G    +K L+ +    +  D ++  P   A   G  E   LL+ +       D+N + PLHLAC  G    V  L     + +  D+     +H+A   G  K+V  L     +I A +   W P+  A   G
Sbjct:   40 LHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK-------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTG 205          

HSP 4 Score: 63.1586 bits (152), Expect = 4.315e-11
Identity = 39/148 (26.35%), Postives = 74/148 (50.00%), Query Frame = 2
Query: 1463 IHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H+AC+KG  ++ +LL++    ++  +   + P+H A  +G  + ++ L+     I+  D  +R P   A  AG  E   +L+ K        +N++  +HLAC  G A  V+ L RA  +T     +G S + +A  S  ++++  L
Sbjct:   40 LHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKD-------ENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQL 180          

HSP 5 Score: 57.3806 bits (137), Expect = 4.221e-9
Identity = 49/189 (25.93%), Postives = 85/189 (44.97%), Query Frame = 2
Query: 1361 PIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAG---HVECTKILMLKKCDIEACAQNE--RRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKK-QEIIELLK 1909
            P+H+AC KG  E+  +L+     ++  +D G   +H+A   G  D  + L+     I+  D   + P   A   G TE   LL++ + N        + P+H A  AG   HVE      L +  +    ++E  + A+H+A   G  ++V  L+R   +  A      +P+  A K+   +  +ELL+
Sbjct:   39 PLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKDEN-------QKSPLHLACAAGRALHVEA-----LTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQ 215          

HSP 6 Score: 55.8398 bits (133), Expect = 1.270e-8
Identity = 44/185 (23.78%), Postives = 78/185 (42.16%), Query Frame = 2
Query: 1262 PIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRA 1816
            P+H AC KG  E+  +L+ K   ++    K   P+H+A   G  + ++ L++    I+  D         A   G  + A LL++        D+  K P+H AC  G    V+ L  A  +    D+  +  +H A+ +G  +    L+    DI A   N    +  A + G  +    L+++
Sbjct:   39 PLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK-------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQS 216          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Nematostella
Match: EDO28178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T774])

HSP 1 Score: 73.1738 bits (178), Expect = 1.494e-14
Identity = 48/165 (29.09%), Postives = 80/165 (48.48%), Query Frame = 2
Query:  797 ADIVKMLINQKCNFETCAEK---NQRPIHLACEKGYEKIVKILIEQKCDTEA-YDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNID-ANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFA 1276
            ++++K  +    N E C  K   N + +      G+ K+  +L++   +     D N   P+ FAC +GH +VV+LL+ +  N+E   K    PL  A   GHTD+   L++Q   ++  +  N++ P+  AC KGH  +VK L     NIE   +    P+  A
Sbjct:   30 SELMKANVPTNTNREYCHAKILENNKTMSRDALAGHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLA 194          

HSP 2 Score: 72.7886 bits (177), Expect = 1.931e-14
Identity = 46/168 (27.38%), Postives = 78/168 (46.43%), Query Frame = 2
Query:  986 RGHKEVVKLLINQKCNLEACDKN---NQRPLHLACEKGHTDIVRLLIDQKCNIDA-NDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLR-PIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLA 1474
            R   E++K  +    N E C      N + +      GH  +  +L+D    I+  +D N + P+  AC KGH  +V+ L  +  NIE   +  + P+ FA   G  ++   L+ +   +  P   N   P+  AC KGH ++V++L+ +  +IE    DG   + LA
Sbjct:   27 RDGSELMKANVPTNTNREYCHAKILENNKTMSRDALAGHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLA 194          

HSP 3 Score: 70.4774 bits (171), Expect = 1.125e-13
Identity = 42/140 (30.00%), Postives = 72/140 (51.43%), Query Frame = 2
Query: 1484 GYADIAQLLIDNNCDIEV-CDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIE-ACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEII 1897
            G+  +A +L+D+  +I V  D     P+ +AC  GH ++V+LL+  + NIE   K    P+ +A+  GH +    L+ +   +      N    +  AC KGH ++VKLL++   N E  T  G +P+ LA +  K  ++
Sbjct:   64 GHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLAARYVKYCVV 203          

HSP 4 Score: 63.929 bits (154), Expect = 2.404e-11
Identity = 35/104 (33.65%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTE-AYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLA 1078
            + FAC++GH D+V++L+ +  N E   ++   P+  A   G+  +   L+EQ          NN  P+  AC +GH +VVKLL+    N+E   K+   PL LA
Sbjct:   91 LTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLA 194          

HSP 5 Score: 58.151 bits (139), Expect = 2.101e-9
Identity = 34/119 (28.57%), Postives = 60/119 (50.42%), Query Frame = 2
Query: 1187 GHLKIVKALTNQKCNIEAANQINW-RPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINH--KCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIE 1534
            GH+K+   L +    I   +  N   P+ FACWKG  ++V +L+ +  +IE   K+   P+  A   GH ++   L+    K +I +  ++    +  AC KG+ D+ +LL+    +IE
Sbjct:   64 GHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNND-IPLTSACWKGHHDVVKLLLKYTSNIE 181          

HSP 6 Score: 56.6102 bits (135), Expect = 7.154e-9
Identity = 41/156 (26.28%), Postives = 72/156 (46.15%), Query Frame = 2
Query: 1286 GQKEIVNILITKKCDIEAPEKKNL-RPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKR-PIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVE-CTKILMLKKCDIEACAQ 1744
            G  ++  +L+    +I      N   P+  AC KGH ++VE+L+    +IE    +G+  +  A   G+ D+A  L++    + +    +   P+  AC  GH ++V+LL+    NIE   K    P+  A  A +V+ C  +  L+ C    C  
Sbjct:   64 GHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLA--ARYVKYCVVLTWLEGCQKYCCGM 217          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 190.66 bits (483), Expect = 3.870e-49
Identity = 93/361 (25.76%), Postives = 181/361 (50.14%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALT 1840
             +  +H AC + H  ++ +L+    + E   E    P+H+A   G+  IVKIL+++     A +     P+H A + GH EV + L+     ++A  K++Q PLH A   GH ++V+LL++ K N ++     + P+H+A  +GH++ V+ L + +       +  + P+H A   G+ ++  +L+ +  +  A  K  L P+H+A    + ++V +L++      +   +G+ A+H+A ++   ++A  L+ +             P+H A + G  +IV LLI    N+   +K    P+H  ++ GHV    IL+ +   + A  +     +H+AC  G+ ++VK L++   N  + T
Sbjct:  309 GFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKT 669          

HSP 2 Score: 182.956 bits (463), Expect = 1.012e-46
Identity = 102/400 (25.50%), Postives = 189/400 (47.25%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
             +  +H A    + ++ ++L+N+  N E        P+H A   G+ +I++IL++     +A  +N   PIH A +  H + VK L+     ++    ++  PLH+A   GH  + ++L+D+    ++   N   P+H+AC K HL+++  L     +IEA  +    P+H A + G   IV IL+ K     A   K   P+H+A   GH E+ E L+ +   ++A   D    +H A   G+ ++ +LL+++  +          P+H A   GH + V+LL+D         K    P+H AS+ G V+  ++L+ +  +  A  +N    +H+A    + ++V LLV    +  +    G + + +A K  + E+   L Q      ++ +Q   P
Sbjct:  183 GFTPLHIAAHYENLNVAQLLLNRGANDELT------PLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTP 576          

HSP 3 Score: 182.185 bits (461), Expect = 2.272e-46
Identity = 106/395 (26.84%), Postives = 181/395 (45.82%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQ----KCDTEAYDE-------NNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K +  ++ A  E H ++VK L+    N     E    P+ +A ++G+E +V +LI      K    A  +           P+H A    +  V +LL+N+  N E        PLH A   GH  I+ +L+D    I A  +N   PIH+A    H+  VK L      I+     +  P+H A   G   +  +L+ K     +       P+H+AC K H  ++++L+ H   IEA  + G   +H+A   G+ +I ++L+         +   + P+H A   GH E+ + L+     ++A  K ++ P+H A+  GH E  K+L+  K +  +        +H+A  +GH + V+LL+        +T KG +P+ +A K  K ++ ELL
Sbjct:  105 KGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELT------PLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELL 493          

HSP 4 Score: 181.8 bits (460), Expect = 2.732e-46
Identity = 110/420 (26.19%), Postives = 191/420 (45.48%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC----------------------------------------NIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A  EGH  +V  L++     ET  +K    +H+A   G E++V  L+    +  A  +    P++ A +  H EVVK L+    N     ++   PL +A ++GH ++V LLI                                            N  AND+ +  P+H A   GH +I++ L +    I+A  +    PIH A      + V  L+    +I+     +L P+H+A   GH  + +VL++      +   +G+  +H+AC+K +  +  LL+ ++  IE   +    P+H A  MGH  IV++L+    +  A +     P+H AS +GH E  + L+     ++A A++++  +H A   GH E+VKLL+    N  + T  G+SP+ +A +    + + LL
Sbjct:   43 ALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELT--PLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLL 460          

HSP 5 Score: 175.637 bits (444), Expect = 2.075e-44
Identity = 85/327 (25.99%), Postives = 160/327 (48.93%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNE 1750
            +H A F GH +IVK+L+ +  +      K + P+H+A   G+ ++ + L++     +A  +++  P+H A + GHKE+VKLL+  K N  +       PLH+A  +GH   VRLL+D +       +    P+H+A   G + + + L  +  N  AA +    P+H A      ++VN+L++K     +  +     +H+A  +   E+   L+ H     A    G   +HLA ++G  DI  LLI    ++ + ++    P+H   + GH  I  +L+    ++ A  +    P+H A   G+++  K L+ ++ ++ +  + E
Sbjct:  346 LHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVE 672          

HSP 6 Score: 172.17 bits (435), Expect = 3.344e-43
Identity = 93/379 (24.54%), Postives = 179/379 (47.23%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            IH A    H D VK L+      +     +  P+H+A   G+ ++ K+L+++     +   N   P+H ACK+ H  V+ LL+    ++EA  ++   PLH+A   GH +IV++L+ +  +  A++     P+H+A   GH ++ + L      ++A  + +  P+H A   G KE+V +L+  K +  +       P+H+A  +GH + V +L++ +         G+  +H+A + G  D+A+LL++   +     +    P+H A    + ++V LL+    +  +  +     +H A++   VE    L+       A +      +HLA ++G  +IV LL+    N       G +P+ L  +     I ++L
Sbjct:  247 IHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADIL 625          

HSP 7 Score: 170.244 bits (430), Expect = 1.155e-42
Identity = 89/367 (24.25%), Postives = 169/367 (46.05%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +H A   GH  + K+L+++     + A     P+H+AC+K + +++ +L++     EA  E+   P+H A   GH  +VK+L+ +  +  A +   + PLH+A   GH ++   L+     +DA  ++   P+H A   GH ++VK L   K N  +       P+H A  +G  + V +L+  +       KK   P+H+A   G  ++ E+L+    +  A   +G   +H+A      D+  LL+          +     +H A +    E+   L+    +  A       P+H AS+ G  +   +L+ K+ ++    ++    +HL  ++GH  I  +LV+   +  A T  G +P+ +A
Sbjct:  280 LHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVA 646          

HSP 8 Score: 140.584 bits (353), Expect = 2.344e-33
Identity = 94/387 (24.29%), Postives = 167/387 (43.15%), Query Frame = 2
Query:  917 IEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILIT--KKCDIEAPEKKN------------------------------------LRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            I+   D    ++N    +H A K GH ++V  L++    LE   K     LH+A   G   +V  L++   N++A  Q    P+++A  + HL++VK L     N     +  + P+  A  +G + +V +LI+   K  +  P   +                                    L P+H A   GH  I+E+L+++   I+A   +G   IH+A +  + D  + L+  N +I+        P+H A   GH  + ++L+D  A  N  A + +   P+H A +  H+    +L+     IEA  ++    +H+A   GH  IVK+L++   +  A  +K  +P+ +A +S   E+ E L Q      +    D+ P
Sbjct:   27 IKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFT--PLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTP 411          

HSP 9 Score: 110.538 bits (275), Expect = 4.473e-24
Identity = 65/262 (24.81%), Postives = 118/262 (45.04%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLI-----------NQKCNLEACDKNNQ----------------------RPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAP---------------EKKNLRPIHLACGKGHKEIVEVL 1411
            +H A  EGH   V++L++ +       +K   P+H+A + G   + ++L+E+  +  A  +N   P+H A    + +VV LL+           N    L    K NQ                       PLHLA ++G  DIV LLI ++ N++  +++   P+HL   +GH+ I   L  Q  ++ AA ++ + P+H AC  G  ++V  L+ ++ ++ +                E K+  P+H     G+  +++VL
Sbjct:  445 LHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCHYKDHYCEYKHTTPLHTHLWLGYISVIDVL 706          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 188.348 bits (477), Expect = 2.042e-48
Identity = 109/413 (26.39%), Postives = 194/413 (46.97%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILI-----------------------------EQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            K +  ++ A  E H ++VK L+    N     E    P+ +A ++G+E +V +LI                             +   + +   +    P+H A    +  V +LL+N+  N+    KN   PLH+A  +G+  +VRLL+D+   IDA  ++   P+H A   GH++I++ L      I+A  +    PIH A      + V  L+    +I+     +L P+H+A   GH  + +VL++      A   +G+  +H+AC+K +     LL+ ++  +E   +    P+H A  MGH  IV+ L+    +  A +     P+H AS AGH E  + L+     ++A A++++  +H A   GH E+VKLL+    N ++ T  G++P+ +A +      I +L
Sbjct:  108 KGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRIL 520          

HSP 2 Score: 185.652 bits (470), Expect = 1.799e-47
Identity = 99/396 (25.00%), Postives = 190/396 (47.98%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            +H A   G+  +V++L+++    +   +    P+H A   G+ +I++IL+E     +A  +N   PIH A +  H + V+ L+     ++    ++  PLH+A   GH  + ++L+D+    +A   N   P+H+AC K H++ +  L     ++EA  +    P+H A + G   IV  L+ +     A   K   P+H+A   GH E+ + L+ +   ++A   D    +H A   G+ ++ +LL+D+  + +        P+H A   GH   +++L+DA        K    P+H AS+ G V+  ++L+ +  +  A  +N    +H+A    + ++VKLLV    +  +    G +P+ +A K  + E+  +L Q       + +Q   P
Sbjct:  241 LHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITP 636          

HSP 3 Score: 183.726 bits (465), Expect = 7.094e-47
Identity = 97/380 (25.53%), Postives = 180/380 (47.37%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A+H A          +L+    N +  ++    P+H+A       + ++L+ +  +     +N   P+H A +RG+  +V+LL+++   ++A  K+   PLH A   GH  I+ +L++    I A  +N   PIH+A    H+  V+ L      I+     +  P+H A   G   +  +L+ K     A       P+H+AC K H   +++L+ H   +EA  + G   +H+A   G+ +I + L+         +   + P+H A   GH E+ Q L+     ++A  K ++ P+H A+  GH E  K+L+  K + ++        +H+A  +GH   +++L+ A      +T KG +P+ +A K  K ++ ELL
Sbjct:  174 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELL 553          

HSP 4 Score: 173.326 bits (438), Expect = 1.188e-43
Identity = 104/403 (25.81%), Postives = 187/403 (46.40%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLID--ANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 1957
            K   A+H A   G   +V  L+N   N    + K   P+++A ++ + ++VK L+E   +     E+   P+  A ++GH+ VV LLIN         K     LH+A     T    +L+    N D   +    P+H+A    ++ + + L N+  N+    +    P+H A  +G   +V +L+ +   I+A  K  L P+H A   GH  I+E+L+ H   I+A   +G   IH+A +  + D  + L+  N +I+        P+H A   GH  + ++L+D  A  N  A + +   P+H A +  H+    +L+     +EA  ++    +H+A   GH  IVK L++   +  A  +K  +P+ +A ++   E+ + L Q   +  +    D+ P
Sbjct:   75 KGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFT--PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTP 471          

HSP 5 Score: 172.555 bits (436), Expect = 2.267e-43
Identity = 79/346 (22.83%), Postives = 171/346 (49.42%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            +H A   GH ++ + L+      +  A+ +Q P+H A   G++++VK+L++ K + ++       P+H A + GH   +++L++         K    PLH+A + G  D+  LL+++  N +A  +N   P+H+A    +L +VK L ++  +  +  +  + P+H A  + Q E+ ++L+           + + P+HLA  +G  ++V +LI+ + ++   + +G   +HL  ++G+  IA  L+     +    ++   P+H AC  G+ ++V+ L+    ++ A  +    P+H A++ GH +   +L+           N    + +A   G+  ++ +L
Sbjct:  439 LHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 6 Score: 142.124 bits (357), Expect = 7.493e-34
Identity = 81/346 (23.41%), Postives = 160/346 (46.24%), Query Frame = 2
Query:  869 IHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +HLA ++G+ K+V  L+    + EA  +     +H A   G ++VV  L+N   N+ A       PL++A ++ H ++V+ L++   N     ++   P+ +A  +GH  +V  L N         ++    +H A          +L+    + +   K    P+H+A    +  + ++L+N   ++     +G   +H+A  +G   + +LL+D    I+   +    P+H A   GH  I+++L++    I+A  K    PIH A++  H++C + L+    +I+    +    +H+A   GH  + K+L+       A  L G +P+ +A K      ++LL
Sbjct:   47 LHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLL 388          

HSP 7 Score: 137.117 bits (344), Expect = 2.817e-32
Identity = 65/252 (25.79%), Postives = 122/252 (48.41%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H A   G  D+ ++L+ +  N     +    P+H+A       +VK+L+ +     +   N   P+H A K+   EV  +L+    +          PLHLA ++G  D+V +LI ++ N++  ++N   P+HL   +GH+ I   L  Q  ++ AA+++ + P+H AC  G  ++V  L+ ++  + A  +    P+H A  +GH +IV +L+ H         +G   + +A   GY  +  +L
Sbjct:  533 KGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 8 Score: 131.339 bits (329), Expect = 1.495e-30
Identity = 76/299 (25.42%), Postives = 140/299 (46.82%), Query Frame = 2
Query: 1016 INQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            I    N+   ++N    LHLA ++GH  +V  L+     ++A  +  N  +H+A   G  K+V  L N   N+ A +   + P++ A  +   E+V  L+    +   P +    P+ +A  +GH+ +V +LIN+    +        A+H+A        A +L+ N+ + +V  +    P+H A    +  + QLL++   N+    K    P+H AS  G+V   ++L+ +   I+A  ++E   +H A   GH  I+++L+      +A T  G SPI +A +    + +  L Q
Sbjct:   30 IKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQ 324          

HSP 9 Score: 57.3806 bits (137), Expect = 8.851e-8
Identity = 38/151 (25.17%), Postives = 69/151 (45.70%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  D A   I N  +I + +Q     +H A + GH ++V  L+ +   +EA  K     +H A+ AG  +    L+    ++ A +      +++A ++ H E+VK L+    N    T  G +P+ +A +   + ++ LL    TK
Sbjct:   17 AARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK 167          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Medaka
Match: ENSORLT00000006308.2 (pep primary_assembly:ASM223467v1:1:12516834:12530692:1 gene:ENSORLG00000005003.2 transcript:ENSORLT00000006308.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.178 bits (448), Expect = 6.786e-48
Identity = 98/384 (25.52%), Postives = 186/384 (48.44%), Query Frame = 2
Query:  761 WRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
              A+H A  EGH D+V+ L+ +    ++  +K    +H+A   G +++VK+L+ +  D  A  +N   P++ A +  H EVV+  +  + N     ++   PL +A ++GH  +V LL++     D   +     +H+A  K   K    L     N +  ++  + P+H A   G   +  +L+ +   ++   +  + P+H+A  +G+  +V +L++    I+A   DG   +H A   G+    +LL++    I    +    P+H + +  H E V+LL+     ++         +H A+  GH   TK+L+ KK +  A A N    +H+AC+K   ++++LLV+   + +A+T  G +PI +A       I+ LL Q
Sbjct:   21 LNALHLAAKEGHKDLVEELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEH----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQ 400          

HSP 2 Score: 166.392 bits (420), Expect = 3.749e-44
Identity = 89/369 (24.12%), Postives = 181/369 (49.05%), Query Frame = 2
Query:  800 DIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            D V   +    +  TC +     +HLA ++G++ +V+ L+++    ++  +     +H A   G KEVVKLL+++  ++ A  +N   PL++A ++ H ++VR  ++ + N     ++   P+ +A  +GH  +V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +G   +H+A ++G  ++  LL+D    I+   +    P+H A   GH   V+LL++    I A  K    P+H +++  H+EC K+L+  +  ++    +   A+H+A   GH  + K+L+    N  A  L G +P+ +A K  + +++ELL
Sbjct:    1 DKVLEFLKNGVDISTCNQNGLNALHLAAKEGHKDLVEELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEH----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELL 365          

HSP 3 Score: 124.405 bits (311), Expect = 5.960e-30
Identity = 66/262 (25.19%), Postives = 124/262 (47.33%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQIS 1552
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N   P+H A KRG+  +V LL+++   ++A  ++   PLH A   GH   V LL+++   I A  +N   P+H++    H++ VK L   +  ++         +H A   G   +  +L+ KK +  A       P+H+AC K   +++E+L+ +   I+A  + G   IH+A   G+ +I  LL+ N    +V + +S
Sbjct:  151 ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVRNIVS 412          

HSP 4 Score: 73.9442 bits (180), Expect = 2.365e-13
Identity = 37/139 (26.62%), Postives = 69/139 (49.64%), Query Frame = 2
Query: 1508 LIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
             + N  DI  C+Q     +H A + GH ++V+ L+     +++  K     +H AS AG  E  K+L+ +  D+ A +QN    +++A ++ H E+V+  +    N    T  G +P+ +A +     ++ LL +  TK
Sbjct:    6 FLKNGVDISTCNQNGLNALHLAAKEGHKDLVEELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEHDTK 144          

HSP 5 Score: 68.5514 bits (166), Expect = 1.245e-11
Identity = 34/130 (26.15%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSN 1159
            +H +    H + VK+L+  +   +         +H+A   G+ ++ K+L+++K +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV LL+    + D  +  SN
Sbjct:  284 LHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVRNIVSN 413          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 178.333 bits (451), Expect = 3.812e-45
Identity = 95/382 (24.87%), Postives = 178/382 (46.60%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L++++ N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH  +V LL+    + +  +   +  LH+A   G  ++VR L+     +DA  +    P+H+A   G  +IV+ L     + +AA    + P+H +  +GQ E  ++L+          KK   P+H+    G  ++ ++L+  +   ++   +G   +H+A       +A LL+D         +    P+H A +    +I  +L+       A  K    P+H AS+ GH +   +LM K   I    ++   A+HLA ++    + ++LVR   N +  T  G +P+ +A      +++  L Q
Sbjct:  361 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQ 742          

HSP 2 Score: 172.17 bits (435), Expect = 2.767e-43
Identity = 93/382 (24.35%), Postives = 180/382 (47.12%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N   P+H A KRG+  +V+LL+++   ++A  ++   PLH A   GH   V +L+++   + A  +N   P+H+A    H++ VK L   K  ++         +H A   G   +  +L+ K+ +  A       P+H+AC K   +++E+L+ +   I+A  + G   IH+A   G+ +I  LL+ N    +V +   +  +H A   G  E+V+ L+     ++A  + ++ P+H AS  G  E  ++L+      +A   N    +H++  +G  E   +L+ A  +    T KG +P+ +  K    ++ +LL Q
Sbjct:  196 ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQ 577          

HSP 3 Score: 172.17 bits (435), Expect = 3.046e-43
Identity = 99/412 (24.03%), Postives = 188/412 (45.63%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+ ++V++L+++    +        P+H A   G+E  V++L+E+     A  +N   P+H A +                                  GH  V KLL++++ N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GHL IV  L     + + +N      +H A   GQ E+V  L+     ++A  +++  P+H+A   G  EIV++L+ H    +A   +G+  +H++  +G  + A +L++      +  +    P+H   + G  ++ +LL+      ++  K    P+H A+   + +   +L+ K       A+N    +H+A +K   +I  +L++    T ALT +G +P+ LA +    ++  LL
Sbjct:  263 LHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALL 674          

HSP 4 Score: 169.859 bits (429), Expect = 1.556e-42
Identity = 100/444 (22.52%), Postives = 193/444 (43.47%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC-----------------------------NIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEV---------------------------------LINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  EGH D+V+ L+++    ++  +K    +H++   G  ++VK L+++  D  A  +N   P++ A +  H +VV+ L+    N     ++   PL +A ++GH  +V +L++                                N D   ++   P+H+A   G++ +   L N+   ++   +    P+H A  +G   +V +L+ +   I+A  +  L P+H A   GH+  VEV                                 L+ HK  ++    D   A+H+A   G+  + +LL+D   +          P+H AC+    ++++LL+    +I+A  +    PIH A+  GH+    +L+      +        ++H+A   G AE+V+ L+R     +A   +  +P+ +A +  K EI++LL Q
Sbjct:   68 ALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQ 511          

HSP 5 Score: 165.622 bits (418), Expect = 3.111e-41
Identity = 92/376 (24.47%), Postives = 181/376 (48.14%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   G+ D V   +    +  TC +     +HLA ++G+  +V+ L+++    ++  +     +H +   G  EVVK L+ +  ++ A  +N   PL++A ++ H D+VR L++   N     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +G   +H+A ++G  ++ +LL+D    I+   +    P+H A   GH   V++L++    + A  K    P+H A++  HVEC K L+  K  ++    +   A+H+A   GH  + KLL+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   39 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELL 410          

HSP 6 Score: 164.851 bits (416), Expect = 5.870e-41
Identity = 85/380 (22.37%), Postives = 175/380 (46.05%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV +L+    + +    + +  +H+A   G  ++V+ L+      +A    +  P+H A + G  E+V+LL+    + +A   N   PLH++  +G  +   +L++   +     +    P+H+    G L + K L  ++   ++A +    P+H A     +++  +L+ K        K    P+H+A  K   +I  VL+ +  +  A    G   +HLA ++G+AD+A LL+     I V  +     +H A +     + ++L+    N++   K    P+  A   G+ +    L+     + A  +N    +H A ++G+  I+ +L++      A+T+ GN+ + +A +     +++ L+
Sbjct:  428 IHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLR 807          

HSP 7 Score: 164.466 bits (415), Expect = 7.752e-41
Identity = 88/385 (22.86%), Postives = 179/385 (46.49%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+  IV +L++     +  +      +H A + G  EVV+ L+     ++A  + +Q PLH+A   G T+IV+LL+    + DA   N   P+H++  +G L+    L     +   A +  + P+H     G  ++  +L+ ++   ++  K  L P+H+A    ++++  +L++          +G+  +H+A +K   DIA +L+    +     +    P+H A + GH ++  LL+     I    K     +H A++   V   +IL+    +++   +     + +AC  G+A++V  L++   +  A T  G +P+  A +     II +L Q
Sbjct:  391 GFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQ 775          

HSP 8 Score: 164.081 bits (414), Expect = 1.187e-40
Identity = 82/347 (23.63%), Postives = 166/347 (47.84%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            ++H A   G A++V+ L+      +  A ++Q P+H+A   G  +IV++L++     +A   N   P+H + + G  E   +L+    +     K    PLH+  + G  D+ +LL+ ++   D+  +N   P+H+A    + K+   L ++  +     +  + P+H A  K Q +I  +L+    +  A  K+ + P+HLA  +GH ++  +L++    I      G  A+HLA ++    +A++L+ N  +++   ++   P+  AC  G+ ++V  L+    ++ A  K    P+H A++ G+     +L+       A   N   A+ +A   G+  +V  L
Sbjct:  460 SLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          

HSP 9 Score: 160.229 bits (404), Expect = 1.811e-39
Identity = 87/379 (22.96%), Postives = 175/379 (46.17%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + VK L+  K   +         +H+A   G+ ++ K+L++++ +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV LL+    + D ++      +H+A   G  ++V+ L      ++A  + +  P+H A   G+ EIV +L+      +A       P+H++  +G  E   VL+            G+  +H+  + G  D+A+LL+      +   +    P+H A    + ++  LL+D   +     K    P+H A++   ++   +L+    +  A  +     +HLA ++GHA++  LL+         T  G + + LA +  +  + E+L
Sbjct:  329 LHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEIL 707          

HSP 10 Score: 121.324 bits (303), Expect = 1.869e-27
Identity = 58/252 (23.02%), Postives = 116/252 (46.03%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H     G  D+ K+L+ ++   ++  +    P+H+A     +K+  +L+++        +N   P+H A K+   ++  +L+       A  K    PLHLA ++GH D+  LL+ +   I+   ++    +HLA  +  + + + L     N++   ++ + P+  AC  G  ++V+ L+     + A  K    P+H A  +G+  I+ VL+ H     A   +G  A+ +A   GY  +   L
Sbjct:  555 KGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          

HSP 11 Score: 95.9005 bits (237), Expect = 1.170e-19
Identity = 58/281 (20.64%), Postives = 124/281 (44.13%), Query Frame = 2
Query: 1151 NSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANC-----------------------------NIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +SN     A   G++  V        +I   NQ     +H A  +G  ++V  L+ +   +++  KK    +H++   G  E+V+ L+    DI A   +G+  +++A ++ + D+ + L++N  +     +    P+  A + GH ++V +L++ +                              N +   K    P+H A+  G+V    +L+ +   ++  A+N    +H+A ++G+  +V+LL+      +A T  G +P+  A +S  +  +E+L
Sbjct:   31 DSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVL 311          

HSP 12 Score: 75.8702 bits (185), Expect = 1.586e-13
Identity = 40/151 (26.49%), Postives = 73/151 (48.34%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  D     +    DI  C+Q     +H A + GH ++VQ L+D    +++  K     +H +S AG  E  K L+ +  DI A +QN    +++A ++ H ++V+ L+    N    T  G +P+ +A +    +++ +L +  TK
Sbjct:   39 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTK 189          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 177.948 bits (450), Expect = 4.643e-45
Identity = 95/382 (24.87%), Postives = 178/382 (46.60%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A   GH  + K+L++++ N    A     P+H+AC+K   K++++L++     +A  E+   PIH A   GH  +V LL+    + +  +   +  LH+A   G  ++VR L+     +DA  +    P+H+A   G  +IV+ L     + +AA    + P+H +  +GQ E  ++L+          KK   P+H+    G  ++ ++L+  +   ++   +G   +H+A       +A LL+D         +    P+H A +    +I  +L+       A  K    P+H AS+ GH +   +LM K   I    ++   A+HLA ++    + ++LVR   N +  T  G +P+ +A      +++  L Q
Sbjct:  376 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQ 757          

HSP 2 Score: 172.17 bits (435), Expect = 3.224e-43
Identity = 93/382 (24.35%), Postives = 180/382 (47.12%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  +       +L+    N +  ++    P+H+A   G   +  +L+ +    +    N   P+H A KRG+  +V+LL+++   ++A  ++   PLH A   GH   V +L+++   + A  +N   P+H+A    H++ VK L   K  ++         +H A   G   +  +L+ K+ +  A       P+H+AC K   +++E+L+ +   I+A  + G   IH+A   G+ +I  LL+ N    +V +   +  +H A   G  E+V+ L+     ++A  + ++ P+H AS  G  E  ++L+      +A   N    +H++  +G  E   +L+ A  +    T KG +P+ +  K    ++ +LL Q
Sbjct:  211 ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQ 592          

HSP 3 Score: 172.17 bits (435), Expect = 3.339e-43
Identity = 99/412 (24.03%), Postives = 188/412 (45.63%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKR---------------------------------GHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A   G+ ++V++L+++    +        P+H A   G+E  V++L+E+     A  +N   P+H A +                                  GH  V KLL++++ N  A   N   PLH+AC+K    ++ LL+    +I A  ++   PIH+A   GHL IV  L     + + +N      +H A   GQ E+V  L+     ++A  +++  P+H+A   G  EIV++L+ H    +A   +G+  +H++  +G  + A +L++      +  +    P+H   + G  ++ +LL+      ++  K    P+H A+   + +   +L+ K       A+N    +H+A +K   +I  +L++    T ALT +G +P+ LA +    ++  LL
Sbjct:  278 LHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALL 689          

HSP 4 Score: 169.859 bits (429), Expect = 1.861e-42
Identity = 100/444 (22.52%), Postives = 193/444 (43.47%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKC-----------------------------NIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEV---------------------------------LINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
            A+H A  EGH D+V+ L+++    ++  +K    +H++   G  ++VK L+++  D  A  +N   P++ A +  H +VV+ L+    N     ++   PL +A ++GH  +V +L++                                N D   ++   P+H+A   G++ +   L N+   ++   +    P+H A  +G   +V +L+ +   I+A  +  L P+H A   GH+  VEV                                 L+ HK  ++    D   A+H+A   G+  + +LL+D   +          P+H AC+    ++++LL+    +I+A  +    PIH A+  GH+    +L+      +        ++H+A   G AE+V+ L+R     +A   +  +P+ +A +  K EI++LL Q
Sbjct:   83 ALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQ 526          

HSP 5 Score: 165.622 bits (418), Expect = 3.623e-41
Identity = 92/376 (24.47%), Postives = 181/376 (48.14%), Query Frame = 2
Query:  779 ACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A   G+ D V   +    +  TC +     +HLA ++G+  +V+ L+++    ++  +     +H +   G  EVVK L+ +  ++ A  +N   PL++A ++ H D+VR L++   N     ++   P+ +A  +GH ++V  L       +   ++    +H A  K   +   +L+    + +   K    P+H+A   G+  +  +L+N    ++    +G   +H+A ++G  ++ +LL+D    I+   +    P+H A   GH   V++L++    + A  K    P+H A++  HVEC K L+  K  ++    +   A+H+A   GH  + KLL+    N  A  L G +P+ +A K  + +++ELL
Sbjct:   54 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELL 425          

HSP 6 Score: 164.851 bits (416), Expect = 6.775e-41
Identity = 85/380 (22.37%), Postives = 175/380 (46.05%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLK 1909
            IH A F GH +IV +L+    + +    + +  +H+A   G  ++V+ L+      +A    +  P+H A + G  E+V+LL+    + +A   N   PLH++  +G  +   +L++   +     +    P+H+    G L + K L  ++   ++A +    P+H A     +++  +L+ K        K    P+H+A  K   +I  VL+ +  +  A    G   +HLA ++G+AD+A LL+     I V  +     +H A +     + ++L+    N++   K    P+  A   G+ +    L+     + A  +N    +H A ++G+  I+ +L++      A+T+ GN+ + +A +     +++ L+
Sbjct:  443 IHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLR 822          

HSP 7 Score: 164.466 bits (415), Expect = 9.104e-41
Identity = 88/385 (22.86%), Postives = 179/385 (46.49%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 1912
             +  +H AC +    ++++L+    + +   E    PIH+A   G+  IV +L++     +  +      +H A + G  EVV+ L+     ++A  + +Q PLH+A   G T+IV+LL+    + DA   N   P+H++  +G L+    L     +   A +  + P+H     G  ++  +L+ ++   ++  K  L P+H+A    ++++  +L++          +G+  +H+A +K   DIA +L+    +     +    P+H A + GH ++  LL+     I    K     +H A++   V   +IL+    +++   +     + +AC  G+A++V  L++   +  A T  G +P+  A +     II +L Q
Sbjct:  406 GFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQ 790          

HSP 8 Score: 163.696 bits (413), Expect = 1.547e-40
Identity = 82/347 (23.63%), Postives = 166/347 (47.84%), Query Frame = 2
Query:  767 AIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLL 1807
            ++H A   G A++V+ L+      +  A ++Q P+H+A   G  +IV++L++     +A   N   P+H + + G  E   +L+    +     K    PLH+  + G  D+ +LL+ ++   D+  +N   P+H+A    + K+   L ++  +     +  + P+H A  K Q +I  +L+    +  A  K+ + P+HLA  +GH ++  +L++    I      G  A+HLA ++    +A++L+ N  +++   ++   P+  AC  G+ ++V  L+    ++ A  K    P+H A++ G+     +L+       A   N   A+ +A   G+  +V  L
Sbjct:  475 SLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 9 Score: 159.844 bits (403), Expect = 2.036e-39
Identity = 87/379 (22.96%), Postives = 175/379 (46.17%), Query Frame = 2
Query:  770 IHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +H A    H + VK L+  K   +         +H+A   G+ ++ K+L++++ +  A   N   P+H ACK+   +V++LL+    +++A  ++   P+H+A   GH +IV LL+    + D ++      +H+A   G  ++V+ L      ++A  + +  P+H A   G+ EIV +L+      +A       P+H++  +G  E   VL+            G+  +H+  + G  D+A+LL+      +   +    P+H A    + ++  LL+D   +     K    P+H A++   ++   +L+    +  A  +     +HLA ++GHA++  LL+         T  G + + LA +  +  + E+L
Sbjct:  344 LHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEIL 722          

HSP 10 Score: 121.324 bits (303), Expect = 2.130e-27
Identity = 58/252 (23.02%), Postives = 116/252 (46.03%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLL 1510
            K +  +H     G  D+ K+L+ ++   ++  +    P+H+A     +K+  +L+++        +N   P+H A K+   ++  +L+       A  K    PLHLA ++GH D+  LL+ +   I+   ++    +HLA  +  + + + L     N++   ++ + P+  AC  G  ++V+ L+     + A  K    P+H A  +G+  I+ VL+ H     A   +G  A+ +A   GY  +   L
Sbjct:  570 KGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 11 Score: 95.9005 bits (237), Expect = 1.379e-19
Identity = 58/281 (20.64%), Postives = 124/281 (44.13%), Query Frame = 2
Query: 1151 NSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANC-----------------------------NIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +SN     A   G++  V        +I   NQ     +H A  +G  ++V  L+ +   +++  KK    +H++   G  E+V+ L+    DI A   +G+  +++A ++ + D+ + L++N  +     +    P+  A + GH ++V +L++ +                              N +   K    P+H A+  G+V    +L+ +   ++  A+N    +H+A ++G+  +V+LL+      +A T  G +P+  A +S  +  +E+L
Sbjct:   46 DSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVL 326          

HSP 12 Score: 75.8702 bits (185), Expect = 1.789e-13
Identity = 40/151 (26.49%), Postives = 73/151 (48.34%), Query Frame = 2
Query: 1472 ACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTK 1924
            A   G  D     +    DI  C+Q     +H A + GH ++VQ L+D    +++  K     +H +S AG  E  K L+ +  DI A +QN    +++A ++ H ++V+ L+    N    T  G +P+ +A +    +++ +L +  TK
Sbjct:   54 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTK 204          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Planmine SMEST
Match: SMESG000017260.1 (SMESG000017260.1)

HSP 1 Score: 1061.6 bits (2744), Expect = 0.000e+0
Identity = 531/532 (99.81%), Postives = 532/532 (100.00%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIPHXXXXXXXXXXXXIHLEKLISTMGLQCLGSPCDHKLCPTSLKSKTFANGEIIGQGGFGTVFRSKASNITREFAIKFIGHDKLEEVLDSKCIENDINEYVDILQHENIIQYFGIIRKSDDLYVFMEYVQGVS 2350
            KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIPHEEEKSEPKTPEEIHLEKLISTMGLQCLGSPCDHKLCPTSLKSKTFANGEIIGQGGFGTVFRSKASNITREFAIKFIGHDKLEEVLDSKCIENDINEYVDILQHENIIQYFGIIRKSDDLYVFMEYVQG+S
Sbjct:  102 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIPHEEEKSEPKTPEEIHLEKLISTMGLQCLGSPCDHKLCPTSLKSKTFANGEIIGQGGFGTVFRSKASNITREFAIKFIGHDKLEEVLDSKCIENDINEYVDILQHENIIQYFGIIRKSDDLYVFMEYVQGLS 633          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Planmine SMEST
Match: SMESG000017258.1 (SMESG000017258.1)

HSP 1 Score: 538.11 bits (1385), Expect = 3.489e-180
Identity = 269/498 (54.02%), Postives = 364/498 (73.09%), Query Frame = 2
Query:  866 PIHLACEKGYEKIVKILIEQKCDTEAYD-ENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEA-PEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISK-RPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIPHXXXXXXXXXXXXIHLEKLISTMGLQCLGSPCDHKLCPTSLKSKTFANGEIIGQGGFGTVFRSKASNITREFAIKFIGHDKLEEVLDSKCIENDINEYVDILQHENIIQYFGIIRKSDDLYVFMEYVQGVS 2350
            PIH ACE G+ ++ K LI +KC+ EA    NN RPIH+AC+RGHK+++K+L++QKC++EACD+NN RP+H ACE GH DIV++L+D  CNI+A DQ+  RPIHLAC++GH  I+K L + +C+IEA NQ +WRPIH AC KG KEIV +LI +KCDIEA     N RPIH AC  GH  IV +L++ KCDIEAC +D WR IH ACE+G+ +IA+LLID  CDIE    ++  RPIH+ACE GH +I +LL+D  C++ AC + + RPI +ASE G++E  KIL+ +KCDI+AC + + R +H ACE+GH EIVKLL +A C+ EALT +  SP+KLAE    +EIIE++ +  ++R+ +          +    +  EE +L ++IS MGL+C  + CDH LCPTSLK+KTF NGEIIGQG FG VF  K SN  REFA+KFIG D +++  ++K +END+N YVDIL+H++IIQY+G+I K++ LYVFMEY+ G S
Sbjct:   39 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIHFACEMGHKDIVKMLLDHHCNIEAADQDEWRPIHLACERGHKDILKMLLDSQCDIEACNQDSWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLAENKNWKEIIEIINKVKSERKGEKRLTWKYKTPKDQTFEEQEEKNLARMISLMGLKCQMN-CDHSLCPTSLKNKTFQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDS-ETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGS 534          

HSP 2 Score: 214.927 bits (546), Expect = 8.890e-59
Identity = 115/255 (45.10%), Postives = 154/255 (60.39%), Query Frame = 2
Query: 1250 INWRPIHF----------------------------------ACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNR-RPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEA-LTLKGNSPIKLAEKSKKQEIIELL 1906
            + W PIH+                                  AC +G K+I+ IL+ +KCDIEA ++ N RPIH AC  GHK+IV++L++H C+IEA D D WR IHLACE+G+ DI ++L+D+ CDIE C+Q S RPIH ACE G  EIV++LID  C+IEAC   N  RPIH+A + GH    ++LM +KCDIEAC ++  R IH ACE+GH  I KLL+   C+ EA   L    PI  A +   ++I +LL
Sbjct:   35 LQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIHFACEMGHKDIVKMLLDHHCNIEAADQDEWRPIHLACERGHKDILKMLLDSQCDIEACNQDSWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLL 289          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 492.271 bits (1266), Expect = 3.542e-160
Identity = 259/525 (49.33%), Postives = 347/525 (66.10%), Query Frame = 2
Query:  764 RAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIPHXXXXXXXXXXXXIHLEKLISTMGLQCLGSPCDHKLCPTSLKSKTFANGEIIGQGGFGTVFRSKASNITREFAIKFIGHDKLEEVLDSKCIENDINEYVDILQHENIIQYFGIIRKSDDLYVFMEYV 2338
            R IH AC++GH++ VK+LI  KC+ E   ++ QRPIHLAC +G+ + VK+LIE KCD E  DE N RPIH AC +GH E VKLLI  KC++EA DK NQRP+HLAC++GH+  V+LLI+ KC+I+A D+   RPIH AC +GH + VK L   KC+IEA ++ N RPIH AC++G  E V +LI  KCDIEA +++N RPIHLAC +GH E V++LI +KCDIEA DD   R IHLAC++G+++  +LLI+N CDIE  D+ ++RPIH AC  G +E V+LLI+  C IEA DKWN+RPIH A   GH E  K+L+  KCDIEA  +  +R IHLAC  GH++  KLL+   C  +A    GNSP++ A K    EII++L +   +RQ      +                 LE+ IS MGL C  S CDHKLCPTSL+ K+F  G +IG+G FG V++ + S I+  FAIK +      E +D K IE +I +++  L H+ I++YFG I+    L +FMEY 
Sbjct:  269 RPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILNEARLERQRQQQLQQQ----------------LERQISKMGLTC-ESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISFVFAIKRMN----SEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYF 772          

HSP 2 Score: 414.075 bits (1063), Expect = 2.734e-130
Identity = 205/383 (53.52%), Postives = 271/383 (70.76%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            NWR IH AC++GH++ VK+LI  KC+ E   ++ QRPIHLAC++G+ + VK+LIE KCD EA D+ N RPIH +C +GH E VKLLI  KC++EA DK N RP+HL+C +GH++ V+LLI+  C+I+A D  + RPIH+AC +GH + VK L   KC+IEA +  N RPIH AC +G  E V +LI  KCDIEA +K+  RPIHLAC +GH E V++LI HKCDIEA D    R IHLAC +G+++  +LLI+N CDIEV D+ ++RPIH AC+ GH+E V+LLI+  C+IEA DKWN+RPIH A + GH    K+L+  KCDIEA  + +RR IH AC +GH+E VKLL+   C+ EAL      PI LA      E ++LL
Sbjct:   69 NWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLL 451          

HSP 3 Score: 405.601 bits (1041), Expect = 5.223e-127
Identity = 201/383 (52.48%), Postives = 268/383 (69.97%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            N R IH +C +GH++ VK+LI  KC+ E   ++N RPIHL+C +G+ + VK+LIE  CD EA D  N RPIH AC +GH E VKLLI  KC++EA D  N+RP+HLAC++GH++ V+LLI+ KC+I+A D+   RPIHLAC +GH + VK L   KC+IEA ++   RPIH AC++G  E V +LI  KCDIE  ++ N RPIHLAC +GH E V++LI +KCDIEA D    R IHLAC++G++   +LLI+N CDIE  D+  +RPIH+AC  GH+E V+LLI+  C+IEA DKWN+RPIH A   GH E  K+L+  KCDIEA  +  +R IHLAC++GH+E VKLL+   C+ EAL  +   PI LA      E ++LL
Sbjct:  135 NQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLL 517          

HSP 4 Score: 404.445 bits (1038), Expect = 1.444e-126
Identity = 201/384 (52.34%), Postives = 268/384 (69.79%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +NWR IH +C +GH++ VK+LI   C+ E    +N+RPIH+AC +G+ + VK+LIE KCD EA D  N RPIH AC +GH E VKLLI  KC++EA DK  QRP+HLAC +GH++ V+LLI+ KC+I+A D+   RPIHLAC +GH + VK L   KC+IE  ++ N RPIH AC +G  E V +LI  KCDIEA +K N RPIHLAC +GH   V++LI +KCDIEA D+   R IH AC +G+++  +LLI+N CDIE  D+ ++RPIH AC  GH+E V+LLI+  C+IEA D+ N+RPIH A + GH E  K+L+  KCDIEA     +R IHLAC++GH+E VKLL+   C+ EAL  +   PI LA    + E ++LL
Sbjct:  167 RNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLL 550          

HSP 5 Score: 399.053 bits (1024), Expect = 1.331e-124
Identity = 202/381 (53.02%), Postives = 264/381 (69.29%), Query Frame = 2
Query:  764 RAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            R IH AC  GHA+IVK+LI  KC+ E   + N RPIHLAC +G+ + VK+LIE KCD EA D+   RPIH AC +GH E VKLLI  KC++EA DK NQRP+HL+C +GH++ V+LLI+ KC+I+A D+ + RPIHL+C +GH + VK L    C+IEA +  N RPIH AC++G  E V +LI  KCDIEA +  N RPIHLAC +GH E V++LI HKCDIEA D    R IHLAC +G+++  +LLI++ CDIE  D+  +RPIH AC  GH+E V+LLI+  C+IE  D+WNRRPIH A + GH E  K+L+  KCDIEA  +  +R IHLAC++GH+  VKLL+   C+ EAL  +   PI  A      E ++LL
Sbjct:   38 RPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLL 418          

HSP 6 Score: 395.971 bits (1016), Expect = 1.802e-123
Identity = 198/381 (51.97%), Postives = 268/381 (70.34%), Query Frame = 2
Query:  764 RAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            R IH AC +GH++ VK+LI  KC+ E   + NQRPIHL+C +G+ + VK+LIE KCD EA D+ N RPIH +C +GH E VKLLI   C++EA D  N+RP+H+AC +GH++ V+LLI+ KC+I+A D  + RPIHLACD+GH + VK L   KC+IEA ++   RPIH AC++G  E V +LI  KCDIEA +K+  RPIHLAC +GH E V++LI +KCDIE  D+   R IHLAC++G+++  +LLI+N CDIE  D+ ++RPIH AC+ GH+  V+LLI+  C+IEA D+  RRPIH+A   GH E  K+L+  KCDIEA  +  +R IHLAC +GH+E VKLL+   C+ EAL  +   PI LA      E ++LL
Sbjct:  104 RPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLL 484          

HSP 7 Score: 393.275 bits (1009), Expect = 1.995e-122
Identity = 200/384 (52.08%), Postives = 265/384 (69.01%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +N R IH AC++GH++ VK+LI  KC+ E     N+RPIHLAC++G+ + VK+LIE KCD EA D+   RPIH AC +GH E VKLLI  KC++EA DK  QRP+HLAC +GH++ V+LLI+ KC+I+  D+ + RPIHLACD+GH + VK L   KC+IEA ++ N RPIH AC +G    V +LI  KCDIEA +++  RPIH AC +GH E V++LI +KCDIEA D    R IHLAC +G+++  +LLI+N CDIE  D+ ++RPIH AC+ GH+E V+LLI+  C+IEA D  N+RPIH A + GH E  K+L+  KCDIEA  +  +R IHLAC  G +E VKLL+   C  EAL      PI LA      E ++LL
Sbjct:  200 RNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLL 583          

HSP 8 Score: 365.155 bits (936), Expect = 7.792e-112
Identity = 182/337 (54.01%), Postives = 241/337 (71.51%), Query Frame = 2
Query:  860 QRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +RPIH AC  G+ +IVK+LIE KCD EA D++N RPIH AC +GH E VKLLI  KC++EA DK  QRP+HLAC++GH++ V+LLI+ KC+I+A D+ + RPIHL+C +GH + VK L   KC+IEA ++ NWRPIH +C +G  E V +LI   CDIEA + +N RPIH+AC +GH E V++LI +KCDIEA D    R IHLAC++G+++  +LLI++ CDIE  D+  +RPIH AC  GH+E V+LLI+  C+IEA DK  +RPIH A   GH E  K+L+  KCDIE   +  RR IHLAC++GH+E VKLL+   C+ EAL      PI LA
Sbjct:   37 RRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLA 373          

HSP 9 Score: 334.339 bits (856), Expect = 2.224e-100
Identity = 169/317 (53.31%), Postives = 223/317 (70.35%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKIL 1708
            N R IH AC +GH++ VK+LI  KC+ E   + NQRPIHLAC++G+   VK+LIE KCD EA DE   RPIH AC +GH E VKLLI  KC++EA DK NQRP+HLAC +GH++ V+LLI+ KC+I+A D+ + RPIHLACD+GH + VK L   KC+IEA +  N RPIH AC +G  E V +LI  KCDIEA +++N RPIHLAC  G  E V++LI +KC IEA D    R IHLAC +G+++  +LLI+N CDIE  D+ ++RPIH AC  GH++  +LLI+  C I+A D+    P+ +A + G+ E  KIL
Sbjct:  333 NRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKIL 649          

HSP 10 Score: 332.798 bits (852), Expect = 8.001e-100
Identity = 169/323 (52.32%), Postives = 223/323 (69.04%), Query Frame = 2
Query:  938 EAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            E  D +  RPIH AC  GH E+VKLLI  KC++EA DK+N RP+HLAC +GH++ V+LLI+ KC+I+A D+   RPIHLACD+GH + VK L   KC+IEA ++ N RPIH +C +G  E V +LI  KCDIEA +K+N RPIHL+C +GH E V++LI H CDIEA D    R IH+AC +G+++  +LLI+N CDIE  D  ++RPIH AC+ GH+E V+LLI+  C+IEA DK  +RPIH A   GH E  K+L+  KCDIEA  + ++R IHLAC +GH+E VKLL+   C+ E L      PI LA      E ++LL
Sbjct:   30 ERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLL 352          

HSP 11 Score: 298.13 bits (762), Expect = 4.138e-87
Identity = 156/310 (50.32%), Postives = 211/310 (68.06%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A K G  E+ +    ++  LE  D + +RP+H AC  GH +IV+LLI+ KC+I+A D+++ RPIHLAC +GH + VK L   KC+IEA ++   RPIH AC +G  E V +LI  KCDIEA +K N RPIHL+C +GH E V++LI +KCDIEA D   WR IHL+C +G+++  +LLI++NCDIE  D  ++RPIH AC  GH+E V+LLI+  C+IEA D WNRRPIH A + GH E  K+L+  KCDIEA  + ++R IHLAC +GH+E VKLL+   C+ EAL  +   PI LA      E ++LL
Sbjct:   11 AIKSGSAELFRRYFKEEF-LERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLL 319          

HSP 12 Score: 201.83 bits (512), Expect = 1.515e-53
Identity = 100/186 (53.76%), Postives = 129/186 (69.35%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNIL 1312
            +N R IH AC +GH++ VK+LI  KC+ E   ++NQRPIHLAC++G+ + VK+LIE KCD EA DE N RPIH AC  G  E VKLLI  KC +EA DK NQRP+HLAC +GH++ V+LLI+ KC+I+A D+ + RPIHLAC  GH K  K L   KC I+A ++    P+ FA   G  EI+ IL
Sbjct:  464 RNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKIL 649          

HSP 13 Score: 170.244 bits (430), Expect = 3.724e-43
Identity = 83/154 (53.90%), Postives = 106/154 (68.83%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALT 1216
            +N R IH AC +GH++ VK+LI  KC+ E   E+NQRPIHLAC  G  + VK+LIE KC  EA D+ N RPIH AC +GH E VKLLI  KC++EA DK NQRP+HLAC  GH+   +LLI+ KC IDA D++ N P+  A   G+ +I+K L 
Sbjct:  497 RNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILN 650          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 493.041 bits (1268), Expect = 1.285e-159
Identity = 259/525 (49.33%), Postives = 347/525 (66.10%), Query Frame = 2
Query:  764 RAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIPHXXXXXXXXXXXXIHLEKLISTMGLQCLGSPCDHKLCPTSLKSKTFANGEIIGQGGFGTVFRSKASNITREFAIKFIGHDKLEEVLDSKCIENDINEYVDILQHENIIQYFGIIRKSDDLYVFMEYV 2338
            R IH AC++GH++ VK+LI  KC+ E   ++ QRPIHLAC +G+ + VK+LIE KCD E  DE N RPIH AC +GH E VKLLI  KC++EA DK NQRP+HLAC++GH+  V+LLI+ KC+I+A D+   RPIH AC +GH + VK L   KC+IEA ++ N RPIH AC++G  E V +LI  KCDIEA +++N RPIHLAC +GH E V++LI +KCDIEA DD   R IHLAC++G+++  +LLI+N CDIE  D+ ++RPIH AC  G +E V+LLI+  C IEA DKWN+RPIH A   GH E  K+L+  KCDIEA  +  +R IHLAC  GH++  KLL+   C  +A    GNSP++ A K    EII++L +   +RQ      +                 LE+ IS MGL C  S CDHKLCPTSL+ K+F  G +IG+G FG V++ + S I+  FAIK +      E +D K IE +I +++  L H+ I++YFG I+    L +FMEY 
Sbjct:  269 RPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILNEARLERQRQQQLQQQ----------------LERQISKMGLTC-ESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISFVFAIKRMN----SEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYF 772          

HSP 2 Score: 414.461 bits (1064), Expect = 8.376e-130
Identity = 205/383 (53.52%), Postives = 271/383 (70.76%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            NWR IH AC++GH++ VK+LI  KC+ E   ++ QRPIHLAC++G+ + VK+LIE KCD EA D+ N RPIH +C +GH E VKLLI  KC++EA DK N RP+HL+C +GH++ V+LLI+  C+I+A D  + RPIH+AC +GH + VK L   KC+IEA +  N RPIH AC +G  E V +LI  KCDIEA +K+  RPIHLAC +GH E V++LI HKCDIEA D    R IHLAC +G+++  +LLI+N CDIEV D+ ++RPIH AC+ GH+E V+LLI+  C+IEA DKWN+RPIH A + GH    K+L+  KCDIEA  + +RR IH AC +GH+E VKLL+   C+ EAL      PI LA      E ++LL
Sbjct:   69 NWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLL 451          

HSP 3 Score: 405.986 bits (1042), Expect = 1.609e-126
Identity = 201/383 (52.48%), Postives = 268/383 (69.97%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            N R IH +C +GH++ VK+LI  KC+ E   ++N RPIHL+C +G+ + VK+LIE  CD EA D  N RPIH AC +GH E VKLLI  KC++EA D  N+RP+HLAC++GH++ V+LLI+ KC+I+A D+   RPIHLAC +GH + VK L   KC+IEA ++   RPIH AC++G  E V +LI  KCDIE  ++ N RPIHLAC +GH E V++LI +KCDIEA D    R IHLAC++G++   +LLI+N CDIE  D+  +RPIH+AC  GH+E V+LLI+  C+IEA DKWN+RPIH A   GH E  K+L+  KCDIEA  +  +R IHLAC++GH+E VKLL+   C+ EAL  +   PI LA      E ++LL
Sbjct:  135 NQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLL 517          

HSP 4 Score: 404.831 bits (1039), Expect = 4.296e-126
Identity = 201/384 (52.34%), Postives = 268/384 (69.79%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +NWR IH +C +GH++ VK+LI   C+ E    +N+RPIH+AC +G+ + VK+LIE KCD EA D  N RPIH AC +GH E VKLLI  KC++EA DK  QRP+HLAC +GH++ V+LLI+ KC+I+A D+   RPIHLAC +GH + VK L   KC+IE  ++ N RPIH AC +G  E V +LI  KCDIEA +K N RPIHLAC +GH   V++LI +KCDIEA D+   R IH AC +G+++  +LLI+N CDIE  D+ ++RPIH AC  GH+E V+LLI+  C+IEA D+ N+RPIH A + GH E  K+L+  KCDIEA     +R IHLAC++GH+E VKLL+   C+ EAL  +   PI LA    + E ++LL
Sbjct:  167 RNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLL 550          

HSP 5 Score: 399.438 bits (1025), Expect = 4.024e-124
Identity = 202/381 (53.02%), Postives = 264/381 (69.29%), Query Frame = 2
Query:  764 RAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            R IH AC  GHA+IVK+LI  KC+ E   + N RPIHLAC +G+ + VK+LIE KCD EA D+   RPIH AC +GH E VKLLI  KC++EA DK NQRP+HL+C +GH++ V+LLI+ KC+I+A D+ + RPIHL+C +GH + VK L    C+IEA +  N RPIH AC++G  E V +LI  KCDIEA +  N RPIHLAC +GH E V++LI HKCDIEA D    R IHLAC +G+++  +LLI++ CDIE  D+  +RPIH AC  GH+E V+LLI+  C+IE  D+WNRRPIH A + GH E  K+L+  KCDIEA  +  +R IHLAC++GH+  VKLL+   C+ EAL  +   PI  A      E ++LL
Sbjct:   38 RPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLL 418          

HSP 6 Score: 396.356 bits (1017), Expect = 5.508e-123
Identity = 198/381 (51.97%), Postives = 268/381 (70.34%), Query Frame = 2
Query:  764 RAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            R IH AC +GH++ VK+LI  KC+ E   + NQRPIHL+C +G+ + VK+LIE KCD EA D+ N RPIH +C +GH E VKLLI   C++EA D  N+RP+H+AC +GH++ V+LLI+ KC+I+A D  + RPIHLACD+GH + VK L   KC+IEA ++   RPIH AC++G  E V +LI  KCDIEA +K+  RPIHLAC +GH E V++LI +KCDIE  D+   R IHLAC++G+++  +LLI+N CDIE  D+ ++RPIH AC+ GH+  V+LLI+  C+IEA D+  RRPIH+A   GH E  K+L+  KCDIEA  +  +R IHLAC +GH+E VKLL+   C+ EAL  +   PI LA      E ++LL
Sbjct:  104 RPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLL 484          

HSP 7 Score: 393.66 bits (1010), Expect = 5.679e-122
Identity = 200/384 (52.08%), Postives = 265/384 (69.01%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +N R IH AC++GH++ VK+LI  KC+ E     N+RPIHLAC++G+ + VK+LIE KCD EA D+   RPIH AC +GH E VKLLI  KC++EA DK  QRP+HLAC +GH++ V+LLI+ KC+I+  D+ + RPIHLACD+GH + VK L   KC+IEA ++ N RPIH AC +G    V +LI  KCDIEA +++  RPIH AC +GH E V++LI +KCDIEA D    R IHLAC +G+++  +LLI+N CDIE  D+ ++RPIH AC+ GH+E V+LLI+  C+IEA D  N+RPIH A + GH E  K+L+  KCDIEA  +  +R IHLAC  G +E VKLL+   C  EAL      PI LA      E ++LL
Sbjct:  200 RNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLL 583          

HSP 8 Score: 365.54 bits (937), Expect = 2.122e-111
Identity = 182/337 (54.01%), Postives = 241/337 (71.51%), Query Frame = 2
Query:  860 QRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +RPIH AC  G+ +IVK+LIE KCD EA D++N RPIH AC +GH E VKLLI  KC++EA DK  QRP+HLAC++GH++ V+LLI+ KC+I+A D+ + RPIHL+C +GH + VK L   KC+IEA ++ NWRPIH +C +G  E V +LI   CDIEA + +N RPIH+AC +GH E V++LI +KCDIEA D    R IHLAC++G+++  +LLI++ CDIE  D+  +RPIH AC  GH+E V+LLI+  C+IEA DK  +RPIH A   GH E  K+L+  KCDIE   +  RR IHLAC++GH+E VKLL+   C+ EAL      PI LA
Sbjct:   37 RRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLA 373          

HSP 9 Score: 335.109 bits (858), Expect = 4.462e-100
Identity = 169/317 (53.31%), Postives = 223/317 (70.35%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKIL 1708
            N R IH AC +GH++ VK+LI  KC+ E   + NQRPIHLAC++G+   VK+LIE KCD EA DE   RPIH AC +GH E VKLLI  KC++EA DK NQRP+HLAC +GH++ V+LLI+ KC+I+A D+ + RPIHLACD+GH + VK L   KC+IEA +  N RPIH AC +G  E V +LI  KCDIEA +++N RPIHLAC  G  E V++LI +KC IEA D    R IHLAC +G+++  +LLI+N CDIE  D+ ++RPIH AC  GH++  +LLI+  C I+A D+    P+ +A + G+ E  KIL
Sbjct:  333 NRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKIL 649          

HSP 10 Score: 333.183 bits (853), Expect = 2.079e-99
Identity = 169/323 (52.32%), Postives = 223/323 (69.04%), Query Frame = 2
Query:  938 EAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            E  D +  RPIH AC  GH E+VKLLI  KC++EA DK+N RP+HLAC +GH++ V+LLI+ KC+I+A D+   RPIHLACD+GH + VK L   KC+IEA ++ N RPIH +C +G  E V +LI  KCDIEA +K+N RPIHL+C +GH E V++LI H CDIEA D    R IH+AC +G+++  +LLI+N CDIE  D  ++RPIH AC+ GH+E V+LLI+  C+IEA DK  +RPIH A   GH E  K+L+  KCDIEA  + ++R IHLAC +GH+E VKLL+   C+ E L      PI LA      E ++LL
Sbjct:   30 ERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLL 352          

HSP 11 Score: 298.516 bits (763), Expect = 8.833e-87
Identity = 156/310 (50.32%), Postives = 211/310 (68.06%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A K G  E+ +    ++  LE  D + +RP+H AC  GH +IV+LLI+ KC+I+A D+++ RPIHLAC +GH + VK L   KC+IEA ++   RPIH AC +G  E V +LI  KCDIEA +K N RPIHL+C +GH E V++LI +KCDIEA D   WR IHL+C +G+++  +LLI++NCDIE  D  ++RPIH AC  GH+E V+LLI+  C+IEA D WNRRPIH A + GH E  K+L+  KCDIEA  + ++R IHLAC +GH+E VKLL+   C+ EAL  +   PI LA      E ++LL
Sbjct:   11 AIKSGSAELFRRYFKEEF-LERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLL 319          

HSP 12 Score: 202.216 bits (513), Expect = 2.047e-53
Identity = 100/186 (53.76%), Postives = 129/186 (69.35%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNIL 1312
            +N R IH AC +GH++ VK+LI  KC+ E   ++NQRPIHLAC++G+ + VK+LIE KCD EA DE N RPIH AC  G  E VKLLI  KC +EA DK NQRP+HLAC +GH++ V+LLI+ KC+I+A D+ + RPIHLAC  GH K  K L   KC I+A ++    P+ FA   G  EI+ IL
Sbjct:  464 RNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKIL 649          

HSP 13 Score: 170.244 bits (430), Expect = 4.209e-43
Identity = 83/154 (53.90%), Postives = 106/154 (68.83%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALT 1216
            +N R IH AC +GH++ VK+LI  KC+ E   E+NQRPIHLAC  G  + VK+LIE KC  EA D+ N RPIH AC +GH E VKLLI  KC++EA DK NQRP+HLAC  GH+   +LLI+ KC IDA D++ N P+  A   G+ +I+K L 
Sbjct:  497 RNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILN 650          
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 474.552 bits (1220), Expect = 1.016e-153
Identity = 254/527 (48.20%), Postives = 345/527 (65.46%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIPHXXXXXXXXXXXXIHLEKLISTMGLQCLGSPCDHKLCPTSLKSKTFANGEIIGQGGFGTVFRSKASNITREFAIKFIGHDKLEEVLDSKCIENDINEYVDILQHENIIQYFGIIRKSDDLYVFMEYV 2338
            N R IH AC +GH++ VK+LI  KC+ E   ++ QRPIHLAC +G+ + VK+LIE KCD EA D+   RPIH AC +GH E VKLLI  KC++E  D+ N+RP+HLAC++GH++ V+LLI+ KC+I+A D+ + RPIHLACD+GH   VK L   KC+IEA ++   RPIH AC +G  E V +LI  KCDIEA +K N RPIHLAC +GH E V++LI +KCDIEA D+   R IHLAC++G+++  +LLI+N CDIE  D  ++RPIH AC+ GH+E V+LLI+  C+IEA D+ N+RPIH A   G  E  K+L+  KC IEA  +  +R IHLAC  GH++  KLL+   C  +A    GNSP++ A K    EII++L +   +RQ      +                 LE+ IS MGL C  S CDHKLCPTSL+ K+F  G +IG+G FG V++ + S I+  FAIK +      E +D K IE +I +++  L H+ I++YFG I+    L +FMEY 
Sbjct:  234 NRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILNEARLERQRQQQLQQQ----------------LERQISKMGLTC-ESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISFVFAIKRMN----SEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYF 739          

HSP 2 Score: 413.69 bits (1062), Expect = 1.499e-130
Identity = 205/383 (53.52%), Postives = 271/383 (70.76%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            NWR IH AC++GH++ VK+LI  KC+ E   ++ QRPIHLAC++G+ + VK+LIE KCD EA D+ N RPIH +C +GH E VKLLI  KC++EA DK N RP+HL+C +GH++ V+LLI+  C+I+A D  + RPIH+AC +GH + VK L   KC+IEA +  N RPIH AC +G  E V +LI  KCDIEA +K+  RPIHLAC +GH E V++LI HKCDIEA D    R IHLAC +G+++  +LLI+N CDIEV D+ ++RPIH AC+ GH+E V+LLI+  C+IEA DKWN+RPIH A + GH    K+L+  KCDIEA  + +RR IH AC +GH+E VKLL+   C+ EAL      PI LA      E ++LL
Sbjct:   69 NWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLL 451          

HSP 3 Score: 405.601 bits (1041), Expect = 2.351e-127
Identity = 201/383 (52.48%), Postives = 268/383 (69.97%), Query Frame = 2
Query:  758 NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            N R IH +C +GH++ VK+LI  KC+ E   ++N RPIHL+C +G+ + VK+LIE  CD EA D  N RPIH AC +GH E VKLLI  KC++EA D  N+RP+HLAC++GH++ V+LLI+ KC+I+A D+   RPIHLAC +GH + VK L   KC+IEA ++   RPIH AC++G  E V +LI  KCDIE  ++ N RPIHLAC +GH E V++LI +KCDIEA D    R IHLAC++G++   +LLI+N CDIE  D+  +RPIH+AC  GH+E V+LLI+  C+IEA DKWN+RPIH A   GH E  K+L+  KCDIEA  +  +R IHLAC++GH+E VKLL+   C+ EAL  +   PI LA      E ++LL
Sbjct:  135 NQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLL 517          

HSP 4 Score: 404.06 bits (1037), Expect = 6.788e-127
Identity = 201/384 (52.34%), Postives = 268/384 (69.79%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            +NWR IH +C +GH++ VK+LI   C+ E    +N+RPIH+AC +G+ + VK+LIE KCD EA D  N RPIH AC +GH E VKLLI  KC++EA DK  QRP+HLAC +GH++ V+LLI+ KC+I+A D+   RPIHLAC +GH + VK L   KC+IE  ++ N RPIH AC +G  E V +LI  KCDIEA +K N RPIHLAC +GH   V++LI +KCDIEA D+   R IH AC +G+++  +LLI+N CDIE  D+ ++RPIH AC  GH+E V+LLI+  C+IEA D+ N+RPIH A + GH E  K+L+  KCDIEA     +R IHLAC++GH+E VKLL+   C+ EAL  +   PI LA    + E ++LL
Sbjct:  167 RNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLL 550          

HSP 5 Score: 399.053 bits (1024), Expect = 6.864e-125
Identity = 202/381 (53.02%), Postives = 264/381 (69.29%), Query Frame = 2
Query:  764 RAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            R IH AC  GHA+IVK+LI  KC+ E   + N RPIHLAC +G+ + VK+LIE KCD EA D+   RPIH AC +GH E VKLLI  KC++EA DK NQRP+HL+C +GH++ V+LLI+ KC+I+A D+ + RPIHL+C +GH + VK L    C+IEA +  N RPIH AC++G  E V +LI  KCDIEA +  N RPIHLAC +GH E V++LI HKCDIEA D    R IHLAC +G+++  +LLI++ CDIE  D+  +RPIH AC  GH+E V+LLI+  C+IE  D+WNRRPIH A + GH E  K+L+  KCDIEA  +  +R IHLAC++GH+  VKLL+   C+ EAL  +   PI  A      E ++LL
Sbjct:   38 RPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLL 418          

HSP 6 Score: 395.971 bits (1016), Expect = 9.529e-124
Identity = 198/381 (51.97%), Postives = 268/381 (70.34%), Query Frame = 2
Query:  764 RAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            R IH AC +GH++ VK+LI  KC+ E   + NQRPIHL+C +G+ + VK+LIE KCD EA D+ N RPIH +C +GH E VKLLI   C++EA D  N+RP+H+AC +GH++ V+LLI+ KC+I+A D  + RPIHLACD+GH + VK L   KC+IEA ++   RPIH AC++G  E V +LI  KCDIEA +K+  RPIHLAC +GH E V++LI +KCDIE  D+   R IHLAC++G+++  +LLI+N CDIE  D+ ++RPIH AC+ GH+  V+LLI+  C+IEA D+  RRPIH+A   GH E  K+L+  KCDIEA  +  +R IHLAC +GH+E VKLL+   C+ EAL  +   PI LA      E ++LL
Sbjct:  104 RPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLL 484          

HSP 7 Score: 364.77 bits (935), Expect = 4.482e-112
Identity = 182/337 (54.01%), Postives = 241/337 (71.51%), Query Frame = 2
Query:  860 QRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLA 1870
            +RPIH AC  G+ +IVK+LIE KCD EA D++N RPIH AC +GH E VKLLI  KC++EA DK  QRP+HLAC++GH++ V+LLI+ KC+I+A D+ + RPIHL+C +GH + VK L   KC+IEA ++ NWRPIH +C +G  E V +LI   CDIEA + +N RPIH+AC +GH E V++LI +KCDIEA D    R IHLAC++G+++  +LLI++ CDIE  D+  +RPIH AC  GH+E V+LLI+  C+IEA DK  +RPIH A   GH E  K+L+  KCDIE   +  RR IHLAC++GH+E VKLL+   C+ EAL      PI LA
Sbjct:   37 RRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLA 373          

HSP 8 Score: 332.798 bits (852), Expect = 4.428e-100
Identity = 169/323 (52.32%), Postives = 223/323 (69.04%), Query Frame = 2
Query:  938 EAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            E  D +  RPIH AC  GH E+VKLLI  KC++EA DK+N RP+HLAC +GH++ V+LLI+ KC+I+A D+   RPIHLACD+GH + VK L   KC+IEA ++ N RPIH +C +G  E V +LI  KCDIEA +K+N RPIHL+C +GH E V++LI H CDIEA D    R IH+AC +G+++  +LLI+N CDIE  D  ++RPIH AC+ GH+E V+LLI+  C+IEA DK  +RPIH A   GH E  K+L+  KCDIEA  + ++R IHLAC +GH+E VKLL+   C+ E L      PI LA      E ++LL
Sbjct:   30 ERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLL 352          

HSP 9 Score: 298.13 bits (762), Expect = 2.276e-87
Identity = 156/310 (50.32%), Postives = 211/310 (68.06%), Query Frame = 2
Query:  977 ACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 1906
            A K G  E+ +    ++  LE  D + +RP+H AC  GH +IV+LLI+ KC+I+A D+++ RPIHLAC +GH + VK L   KC+IEA ++   RPIH AC +G  E V +LI  KCDIEA +K N RPIHL+C +GH E V++LI +KCDIEA D   WR IHL+C +G+++  +LLI++NCDIE  D  ++RPIH AC  GH+E V+LLI+  C+IEA D WNRRPIH A + GH E  K+L+  KCDIEA  + ++R IHLAC +GH+E VKLL+   C+ EAL  +   PI LA      E ++LL
Sbjct:   11 AIKSGSAELFRRYFKEEF-LERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLL 319          

HSP 10 Score: 174.096 bits (440), Expect = 1.844e-44
Identity = 83/154 (53.90%), Postives = 107/154 (69.48%), Query Frame = 2
Query:  755 KNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALT 1216
            +N R IH AC +GH++ VK+LI  KC+ E   ++NQRPIHLAC++G+ + VK+LIE KCD EA DE N RPIH AC  G  E VKLLI  KC +EA DK NQRP+HLAC  GH+   +LLI+ KC IDA D++ N P+  A   G+ +I+K L 
Sbjct:  464 RNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILN 617          
The following BLAST results are available for this feature:
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK32.291e-5023.42ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK32.509e-5023.42ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK21.187e-4725.52ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.347e-4725.52ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.361e-4725.52ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.767e-4827.46AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.767e-4827.46AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.946e-4827.46AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.946e-4827.46AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.240e-4827.46AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank24.661e-4823.98gene:FBgn0261788 transcript:FBtr0303119[more]
Ank5.336e-4827.36gene:FBgn0011747 transcript:FBtr0089172[more]
Ank5.336e-4827.36gene:FBgn0011747 transcript:FBtr0300497[more]
Ank5.336e-4827.36gene:FBgn0011747 transcript:FBtr0089171[more]
Ank5.336e-4827.36gene:FBgn0011747 transcript:FBtr0089173[more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b5.714e-5227.53ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b7.656e-5227.44ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b1.548e-5127.44ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1a1.509e-5025.00ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
BX640476.12.660e-5025.00ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm42.439e-4823.68tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.622e-4823.68tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.713e-4823.68tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm43.039e-4823.68tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm43.115e-4823.68tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank31.572e-5123.95ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank32.117e-5123.95ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank32.773e-5123.95ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.076e-5123.95ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.203e-5123.95ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5E8K5|ANK3_MOUSE3.290e-5023.95Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q4UMH6|Y381_RICFE3.210e-4628.16Putative ankyrin repeat protein RF_0381 OS=Rickett... [more]
sp|O70511|ANK3_RAT3.432e-4623.42Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|P16157|ANK1_HUMAN3.582e-4624.47Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|Q12955|ANK3_HUMAN3.385e-4523.42Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A182GGY84.813e-9942.97ANK_REP_REGION domain-containing protein OS=Aedes ... [more]
A0A1X7T5X63.553e-8645.04Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A1X7TD773.030e-8344.62ANK_REP_REGION domain-containing protein OS=Amphim... [more]
A0A182GJR24.555e-8338.48Uncharacterized protein OS=Aedes albopictus OX=716... [more]
A0A182H2I68.450e-8339.58Uncharacterized protein OS=Aedes albopictus OX=716... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase 1a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5