Tubulin polymerization-promoting protein family member 3

Overview
NameTubulin polymerization-promoting protein family member 3
Smed IDSMED30001237
Length (bp)1057
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin polymerization-promoting protein family member 3 (SMED30001237) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin polymerization-promoting protein family member 3 (SMED30001237) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin polymerization-promoting protein family member 3 (SMED30001237) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin polymerization-promoting protein family member 3 (SMED30001237) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001237

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30001237SMESG000002261.1 SmedASXL_009635SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30001237SMESG000002261.1 dd_Smed_v4_650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001237SMESG000002261.1 dd_Smed_v4_650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001237SMESG000002261.1 dd_Smed_v4_650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30001237SMESG000002261.1 dd_Smed_v4_650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30001237SMESG000002261.1 dd_Smed_v6_650_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30001237SMESG000002261.1 OX_Smed_1.0.03529ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30001237SMESG000002261.1 dd_Smed_v6_650_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001237SMESG000002261.1 dd_Smed_v6_650_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001237SMESG000002261.1 dd_Smed_v4_650_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Human
Match: TPPP3 (tubulin polymerization promoting protein family member 3 [Source:HGNC Symbol;Acc:HGNC:24162])

HSP 1 Score: 68.5514 bits (166), Expect = 3.910e-13
Identity = 58/148 (39.19%), Postives = 78/148 (52.70%), Query Frame = 3
Query:  363 KTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            K   K+C D K+   K+ T  DVDI F K  G   + I++  F+  L +     + K   KEE+   + I Q +    P + G TKA   GA +RLTD   YTG+ KE FD E+GKGKG  GR+ ++D     GYV  YK   +YD K
Sbjct:   33 KNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRF-KGKSKEEAF--DAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD-ESGKGKGIAGRQDILDD---SGYVSAYKNAGTYDAK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Human
Match: TPPP3 (tubulin polymerization promoting protein family member 3 [Source:HGNC Symbol;Acc:HGNC:24162])

HSP 1 Score: 68.5514 bits (166), Expect = 3.910e-13
Identity = 58/148 (39.19%), Postives = 78/148 (52.70%), Query Frame = 3
Query:  363 KTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            K   K+C D K+   K+ T  DVDI F K  G   + I++  F+  L +     + K   KEE+   + I Q +    P + G TKA   GA +RLTD   YTG+ KE FD E+GKGKG  GR+ ++D     GYV  YK   +YD K
Sbjct:   33 KNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRF-KGKSKEEAF--DAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD-ESGKGKGIAGRQDILDD---SGYVSAYKNAGTYDAK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Human
Match: TPPP3 (tubulin polymerization promoting protein family member 3 [Source:HGNC Symbol;Acc:HGNC:24162])

HSP 1 Score: 68.5514 bits (166), Expect = 3.910e-13
Identity = 58/148 (39.19%), Postives = 78/148 (52.70%), Query Frame = 3
Query:  363 KTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            K   K+C D K+   K+ T  DVDI F K  G   + I++  F+  L +     + K   KEE+   + I Q +    P + G TKA   GA +RLTD   YTG+ KE FD E+GKGKG  GR+ ++D     GYV  YK   +YD K
Sbjct:   33 KNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRF-KGKSKEEAF--DAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD-ESGKGKGIAGRQDILDD---SGYVSAYKNAGTYDAK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Human
Match: TPPP3 (tubulin polymerization promoting protein family member 3 [Source:HGNC Symbol;Acc:HGNC:24162])

HSP 1 Score: 68.5514 bits (166), Expect = 3.910e-13
Identity = 58/148 (39.19%), Postives = 78/148 (52.70%), Query Frame = 3
Query:  363 KTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            K   K+C D K+   K+ T  DVDI F K  G   + I++  F+  L +     + K   KEE+   + I Q +    P + G TKA   GA +RLTD   YTG+ KE FD E+GKGKG  GR+ ++D     GYV  YK   +YD K
Sbjct:   33 KNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRF-KGKSKEEAF--DAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD-ESGKGKGIAGRQDILDD---SGYVSAYKNAGTYDAK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Human
Match: TPPP2 (tubulin polymerization promoting protein family member 2 [Source:HGNC Symbol;Acc:HGNC:19293])

HSP 1 Score: 65.0846 bits (157), Expect = 5.035e-12
Identity = 64/165 (38.79%), Postives = 86/165 (52.12%), Query Frame = 3
Query:  312 FLAFCDATKKGSTTATDKTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            F AF +++  G T   +K   K+C D  +   KT T+ DVDI F K      + I F  F+  + +     +      E   V E+I   +    P + GATKA+  GA +RLTD   YTG  KE FD E+GKGKG  GRE + D+    GYV GYKG  +YD+K
Sbjct:   12 FAAFGESSSSG-TEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDE---VLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFD-ESGKGKGIAGREEMTDN---TGYVSGYKGSGTYDKK 168          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Celegans
Match: tppp-1 (Tubulin polymerization-promoting protein homolog [Source:UniProtKB/Swiss-Prot;Acc:P91127])

HSP 1 Score: 47.7506 bits (112), Expect = 2.468e-6
Identity = 63/174 (36.21%), Postives = 80/174 (45.98%), Query Frame = 3
Query:  294 SDIKSVFLAFCDATKKGSTTATDKTIK---KICTDAK-LYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIIS-NGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQ 800
            +D+K  + AF   TK G+ TAT+ T K   K   DA  L  K  T     I F K  G +KK   F   +  L  F     A+  KK      + I +K+     P   GA KA+  G   RLTD   YTGA KE FDAE       +G+    D+    GYVG YK  +SYD+
Sbjct:   12 ADVKKRWDAF---TKFGAATATEMTGKNFDKWLKDAGVLDNKAITGTMTGIAFSKVTGPKKKAT-FDETKKVL-AFVAEDRARQSKKPIQDELDAITEKLAKLEAPSVGGAAKANAAGVYSRLTDHTKYTGAHKERFDAE----GKGKGKSGRADTTENTGYVGAYKNKDSYDK 176          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Fly
Match: ringer (gene:FBgn0266417 transcript:FBtr0344399)

HSP 1 Score: 55.8398 bits (133), Expect = 5.573e-9
Identity = 63/172 (36.63%), Postives = 86/172 (50.00%), Query Frame = 3
Query:  294 SDIKSVFLAFCDATKKG---STTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGA-TERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYD 797
            SD    F  F D+   G   + + +DK +K+    AK+  K  T  D  I F+K    +  +I  + +  FL+       AK+ K E S    +IKQK+ S G     +  A K  A  +RLTD   YTG+ KE FDA +GKGKG  GR  VVD     GYV GY+  ++YD
Sbjct:   38 SDQFKAFSKFGDSKSDGKLITLSQSDKWMKQ----AKVIDKKITTTDTGIHFKKF---KAMKISLSDYNKFLDDL-----AKTKKVELS----EIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFDA-SGKGKGIAGRRNVVD---GSGYVSGYQHKDTYD 189          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Fly
Match: ringer (gene:FBgn0266417 transcript:FBtr0344401)

HSP 1 Score: 55.8398 bits (133), Expect = 5.573e-9
Identity = 63/172 (36.63%), Postives = 86/172 (50.00%), Query Frame = 3
Query:  294 SDIKSVFLAFCDATKKG---STTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGA-TERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYD 797
            SD    F  F D+   G   + + +DK +K+    AK+  K  T  D  I F+K    +  +I  + +  FL+       AK+ K E S    +IKQK+ S G     +  A K  A  +RLTD   YTG+ KE FDA +GKGKG  GR  VVD     GYV GY+  ++YD
Sbjct:   38 SDQFKAFSKFGDSKSDGKLITLSQSDKWMKQ----AKVIDKKITTTDTGIHFKKF---KAMKISLSDYNKFLDDL-----AKTKKVELS----EIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFDA-SGKGKGIAGRRNVVD---GSGYVSGYQHKDTYD 189          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Fly
Match: ringer (gene:FBgn0266417 transcript:FBtr0344398)

HSP 1 Score: 55.8398 bits (133), Expect = 5.573e-9
Identity = 63/172 (36.63%), Postives = 86/172 (50.00%), Query Frame = 3
Query:  294 SDIKSVFLAFCDATKKG---STTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGA-TERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYD 797
            SD    F  F D+   G   + + +DK +K+    AK+  K  T  D  I F+K    +  +I  + +  FL+       AK+ K E S    +IKQK+ S G     +  A K  A  +RLTD   YTG+ KE FDA +GKGKG  GR  VVD     GYV GY+  ++YD
Sbjct:   38 SDQFKAFSKFGDSKSDGKLITLSQSDKWMKQ----AKVIDKKITTTDTGIHFKKF---KAMKISLSDYNKFLDDL-----AKTKKVELS----EIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFDA-SGKGKGIAGRRNVVD---GSGYVSGYQHKDTYD 189          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Fly
Match: ringer (gene:FBgn0266417 transcript:FBtr0344400)

HSP 1 Score: 55.8398 bits (133), Expect = 5.573e-9
Identity = 63/172 (36.63%), Postives = 86/172 (50.00%), Query Frame = 3
Query:  294 SDIKSVFLAFCDATKKG---STTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGA-TERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYD 797
            SD    F  F D+   G   + + +DK +K+    AK+  K  T  D  I F+K    +  +I  + +  FL+       AK+ K E S    +IKQK+ S G     +  A K  A  +RLTD   YTG+ KE FDA +GKGKG  GR  VVD     GYV GY+  ++YD
Sbjct:   38 SDQFKAFSKFGDSKSDGKLITLSQSDKWMKQ----AKVIDKKITTTDTGIHFKKF---KAMKISLSDYNKFLDDL-----AKTKKVELS----EIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFDA-SGKGKGIAGRRNVVD---GSGYVSGYQHKDTYD 189          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Zebrafish
Match: tppp3 (tubulin polymerization-promoting protein family member 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1909])

HSP 1 Score: 73.1738 bits (178), Expect = 6.017e-15
Identity = 68/176 (38.64%), Postives = 89/176 (50.57%), Query Frame = 3
Query:  294 SDIKSVFLAFCDATKKGSTTATDKTIK-----KICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            +D+  +  +F      G T AT K +      K+C D K+   K  T+ DVDI F K      + I +  F+  L +   P   K   KEE+   E I + I    P + G TK +K  A +RLTD   YTG+ KE FD ETGKGKGK GRE +V+     GYVG YK    YD+K
Sbjct:    5 TDMDQLLNSFKKFAVHGDTKATGKELNGKNWAKLCKDCKVIDGKNVTSTDVDIVFTKVKAKTSRVITYEEFQKALEEL-APKRFKGQSKEEAL--ESIYKLIEGKEPTNIGVTKVAKTAAVDRLTDTSKYTGSHKERFD-ETGKGKGKGGREEIVEHT---GYVGAYKNAGKYDEK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Zebrafish
Match: tppp3 (tubulin polymerization-promoting protein family member 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1909])

HSP 1 Score: 73.1738 bits (178), Expect = 6.017e-15
Identity = 68/176 (38.64%), Postives = 89/176 (50.57%), Query Frame = 3
Query:  294 SDIKSVFLAFCDATKKGSTTATDKTIK-----KICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            +D+  +  +F      G T AT K +      K+C D K+   K  T+ DVDI F K      + I +  F+  L +   P   K   KEE+   E I + I    P + G TK +K  A +RLTD   YTG+ KE FD ETGKGKGK GRE +V+     GYVG YK    YD+K
Sbjct:    5 TDMDQLLNSFKKFAVHGDTKATGKELNGKNWAKLCKDCKVIDGKNVTSTDVDIVFTKVKAKTSRVITYEEFQKALEEL-APKRFKGQSKEEAL--ESIYKLIEGKEPTNIGVTKVAKTAAVDRLTDTSKYTGSHKERFD-ETGKGKGKGGREEIVEHT---GYVGAYKNAGKYDEK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Zebrafish
Match: tppp2 (tubulin polymerization-promoting protein family member 2 [Source:ZFIN;Acc:ZDB-GENE-140106-24])

HSP 1 Score: 68.1662 bits (165), Expect = 3.399e-13
Identity = 65/171 (38.01%), Postives = 85/171 (49.71%), Query Frame = 3
Query:  309 VFLAFCDATKKGSTTATDKTIK-----KICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            V +AF      G T AT K +      K+C D K+   K  T+ DVDI F K      + I F  F   + +     +    K +E AV + +   I    P + G TK +K  A +RLTD   YTG+ KE FD E+GKGKG+EGR  + D+    GYV  YKG  SYD K
Sbjct:   13 VEMAFRKFAVHGDTKATGKEMNGKNFVKLCKDCKVIDGKNVTSTDVDIIFSKVKVKSARVITFEQFTQAMGELATKRF--KGKSQEEAV-QLLYGLIAGKEPTNIGVTKVAKASAVDRLTDTSKYTGSHKERFD-ESGKGKGREGRADIPDT---SGYVSAYKGQGSYDSK 176          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Zebrafish
Match: tppp2 (tubulin polymerization-promoting protein family member 2 [Source:ZFIN;Acc:ZDB-GENE-140106-24])

HSP 1 Score: 67.781 bits (164), Expect = 4.645e-13
Identity = 65/171 (38.01%), Postives = 85/171 (49.71%), Query Frame = 3
Query:  309 VFLAFCDATKKGSTTATDKTIK-----KICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            V +AF      G T AT K +      K+C D K+   K  T+ DVDI F K      + I F  F   + +     +    K +E AV + +   I    P + G TK +K  A +RLTD   YTG+ KE FD E+GKGKG+EGR  + D+    GYV  YKG  SYD K
Sbjct:   13 VEMAFRKFAVHGDTKATGKEMNGKNFVKLCKDCKVIDGKNVTSTDVDIIFSKVKVKSARIITFEQFTQAMGELATKRF--KGKSQEEAV-QLLYGLIAGKEPTNIGVTKVAKASAVDRLTDTSKYTGSHKERFD-ESGKGKGREGRADIPDT---SGYVSAYKGQGSYDSK 176          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Xenopus
Match: rabep1 (rabaptin, RAB GTPase binding effector protein 1 [Source:Xenbase;Acc:XB-GENE-967240])

HSP 1 Score: 65.855 bits (159), Expect = 3.030e-12
Identity = 66/178 (37.08%), Postives = 90/178 (50.56%), Query Frame = 3
Query:  279 QNDIMSDIKSVFLAFC--DATKKGSTTATDKTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            +N  ++ ++  F  F     TK      T K   K+C D K+   K+ T  DVDI F K  G   + I    F+  L +     + K   KEE+   E I + ++   P S G TK +  GA +RLTD   YTG+ KE FD E+GKGKGK GRE +V++    GYV  YK   +YD K
Sbjct:    3 ENSDLTSLEESFRKFAIYGDTKATGQEMTGKNWAKLCKDCKVIDGKSVTGTDVDIVFSKVKGKSARVITCEEFKKALEELSGKRF-KGKSKEEAY--EAICKLVVGKEPVSAGITKPAATGAVDRLTDTSKYTGSHKERFD-ESGKGKGKGGRETIVEN---TGYVSSYKLAGTYDAK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Mouse
Match: Tppp2 (tubulin polymerization-promoting protein family member 2 [Source:MGI Symbol;Acc:MGI:2684923])

HSP 1 Score: 69.3218 bits (168), Expect = 1.296e-13
Identity = 56/150 (37.33%), Postives = 79/150 (52.67%), Query Frame = 3
Query:  357 TDKTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            T+K   K+C D  +   K  T+ DVDI F K      + I+F  F+  + +     + K    +E+  G  + + +    P + G TK++  G  +RLTD   YTG  KE FD E+GKGKG EGRE   D+    GYV GYKG  +YD+K
Sbjct:   26 TNKNFSKLCKDCDIMDGKAVTSTDVDIVFSKVKAKNARTINFQQFQEAMKELGQKRF-KGKNPDEALQG--VFKLMEGKDPATTGVTKSTTVGGVDRLTDTSKYTGTHKERFD-ESGKGKGIEGREETTDN---SGYVSGYKGAGTYDKK 168          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Mouse
Match: Tppp2 (tubulin polymerization-promoting protein family member 2 [Source:MGI Symbol;Acc:MGI:2684923])

HSP 1 Score: 69.3218 bits (168), Expect = 1.296e-13
Identity = 56/150 (37.33%), Postives = 79/150 (52.67%), Query Frame = 3
Query:  357 TDKTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            T+K   K+C D  +   K  T+ DVDI F K      + I+F  F+  + +     + K    +E+  G  + + +    P + G TK++  G  +RLTD   YTG  KE FD E+GKGKG EGRE   D+    GYV GYKG  +YD+K
Sbjct:   26 TNKNFSKLCKDCDIMDGKAVTSTDVDIVFSKVKAKNARTINFQQFQEAMKELGQKRF-KGKNPDEALQG--VFKLMEGKDPATTGVTKSTTVGGVDRLTDTSKYTGTHKERFD-ESGKGKGIEGREETTDN---SGYVSGYKGAGTYDKK 168          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Mouse
Match: Tppp3 (tubulin polymerization-promoting protein family member 3 [Source:MGI Symbol;Acc:MGI:1915221])

HSP 1 Score: 66.2402 bits (160), Expect = 1.664e-12
Identity = 58/148 (39.19%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  363 KTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            K   K+C D K+   K  T  DVDI F K      + I++  F+  L +     + K   KEE+   + I Q I    P + G TKA   GA +RLTD   YTG+ KE FD E+GKGKG  GR+ ++D     GYV  YK   +YD K
Sbjct:   33 KNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRF-KGKSKEEAF--DAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFD-ESGKGKGIAGRQDILDD---SGYVSAYKNAGTYDAK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Mouse
Match: Tppp3 (tubulin polymerization-promoting protein family member 3 [Source:MGI Symbol;Acc:MGI:1915221])

HSP 1 Score: 66.2402 bits (160), Expect = 1.664e-12
Identity = 58/148 (39.19%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  363 KTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            K   K+C D K+   K  T  DVDI F K      + I++  F+  L +     + K   KEE+   + I Q I    P + G TKA   GA +RLTD   YTG+ KE FD E+GKGKG  GR+ ++D     GYV  YK   +YD K
Sbjct:   33 KNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRF-KGKSKEEAF--DAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFD-ESGKGKGIAGRQDILDD---SGYVSAYKNAGTYDAK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Mouse
Match: Tppp3 (tubulin polymerization-promoting protein family member 3 [Source:MGI Symbol;Acc:MGI:1915221])

HSP 1 Score: 66.2402 bits (160), Expect = 1.664e-12
Identity = 58/148 (39.19%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  363 KTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            K   K+C D K+   K  T  DVDI F K      + I++  F+  L +     + K   KEE+   + I Q I    P + G TKA   GA +RLTD   YTG+ KE FD E+GKGKG  GR+ ++D     GYV  YK   +YD K
Sbjct:   33 KNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRF-KGKSKEEAF--DAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFD-ESGKGKGIAGRQDILDD---SGYVSAYKNAGTYDAK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. UniProt/SwissProt
Match: sp|Q3T077|TPPP2_BOVIN (Tubulin polymerization-promoting protein family member 2 OS=Bos taurus OX=9913 GN=TPPP2 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 3.849e-14
Identity = 62/165 (37.58%), Postives = 85/165 (51.52%), Query Frame = 3
Query:  312 FLAFCDATKKGSTTATDKTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            F  F +++  G T   +K   K+C D  +   KT T+ DVDI F K      + I F  F+  + +     +    K  + A+ E+I + +    P + G TKA+  G   RLTD   YTG  KE FD E+GKGKG  GRE V D+    GYV GYKG  +YD+K
Sbjct:   12 FAVFGESSSSG-TEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFQEAMKELGQKRF--KGKSPDEAL-ENIYKLMEGKDPATTGVTKATTVGGVSRLTDTSKYTGTHKERFD-ESGKGKGIAGREDVTDN---SGYVSGYKGAGTYDKK 168          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. UniProt/SwissProt
Match: sp|Q2VPM9|TPPP3_XENLA (Tubulin polymerization-promoting protein family member 3 OS=Xenopus laevis OX=8355 GN=tppp3 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.798e-13
Identity = 70/177 (39.55%), Postives = 89/177 (50.28%), Query Frame = 3
Query:  294 SDIKSV------FLAFCDATKKGSTTATDKTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            SDI S+      F  + D TK      T K   K+C D K+   K  T  DVDI F K      + I +  F   L +     + K   KEE+   E I + +    P S G TKA+  GA +RLTD   YTG+ KE FD +TGKGKGK GRE +V++    GYVG YK   +YD K
Sbjct:    5 SDITSLEDSFRKFAIYGD-TKATGQEMTGKNWSKLCKDCKVNDGKAVTGTDVDIVFSKVKAKSARVITYEEFTKALEELSAKRF-KGKSKEEAY--EAICKLVAGKEPVSAGITKAAATGAVDRLTDTSKYTGSHKERFD-QTGKGKGKSGRETIVEN---TGYVGSYKLAGTYDAK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. UniProt/SwissProt
Match: sp|Q0P5Y3|TPPP2_MOUSE (Tubulin polymerization-promoting protein family member 2 OS=Mus musculus OX=10090 GN=Tppp2 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 9.066e-13
Identity = 56/150 (37.33%), Postives = 79/150 (52.67%), Query Frame = 3
Query:  357 TDKTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            T+K   K+C D  +   K  T+ DVDI F K      + I+F  F+  + +     + K    +E+  G  + + +    P + G TK++  G  +RLTD   YTG  KE FD E+GKGKG EGRE   D+    GYV GYKG  +YD+K
Sbjct:   26 TNKNFSKLCKDCDIMDGKAVTSTDVDIVFSKVKAKNARTINFQQFQEAMKELGQKRF-KGKNPDEALQG--VFKLMEGKDPATTGVTKSTTVGGVDRLTDTSKYTGTHKERFD-ESGKGKGIEGREETTDN---SGYVSGYKGAGTYDKK 168          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. UniProt/SwissProt
Match: sp|Q3ZCC8|TPPP3_BOVIN (Tubulin polymerization-promoting protein family member 3 OS=Bos taurus OX=9913 GN=TPPP3 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.606e-12
Identity = 59/148 (39.86%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  363 KTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            K   K+C D K+   K  T  DVDI F K      + I++  F+  L +   P   K   KEE+   + I Q +    P + G TKA   GA ERLTD   YTG+ KE FD E+GKGKG  GR+ ++D     GYV  YK   +YD K
Sbjct:   33 KNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEEL-APKRFKGKSKEEAF--DAICQLVAGKEPANVGVTKAKTGGAVERLTDTSKYTGSHKERFD-ESGKGKGIAGRQDILDD---SGYVSAYKNAGTYDAK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. UniProt/SwissProt
Match: sp|Q9BW30|TPPP3_HUMAN (Tubulin polymerization-promoting protein family member 3 OS=Homo sapiens OX=9606 GN=TPPP3 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.878e-12
Identity = 58/148 (39.19%), Postives = 78/148 (52.70%), Query Frame = 3
Query:  363 KTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            K   K+C D K+   K+ T  DVDI F K  G   + I++  F+  L +     + K   KEE+   + I Q +    P + G TKA   GA +RLTD   YTG+ KE FD E+GKGKG  GR+ ++D     GYV  YK   +YD K
Sbjct:   33 KNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRF-KGKSKEEAF--DAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD-ESGKGKGIAGRQDILDD---SGYVSAYKNAGTYDAK 173          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. TrEMBL
Match: A0A419QFE1 (Tubulin polymerization-promoting protein family member 2 OS=Clonorchis sinensis OX=79923 GN=Tppp2 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.066e-57
Identity = 108/170 (63.53%), Postives = 124/170 (72.94%), Query Frame = 3
Query:  300 IKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCK-KEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQKK 806
            ++ +FLAFCDA KKGS T TDKT+KKICTD ++Y K   AN VDI FRK +GNQK ++DF  F  F+      AYAKS     E AV E IK+KI+   PK+HGATK S D AT RLTDVKGYTGA KE FD ETGKGKG EGREYV+D KAA GYV GYKG ++YDQKK
Sbjct:    1 MEEIFLAFCDAAKKGSKTCTDKTLKKICTDCQIYNKNLNANSVDIAFRKHVGNQKLDVDFGSFIRFVEGALGEAYAKSKNISLEQAVAE-IKEKIMQGNPKAHGATKVSSDAATARLTDVKGYTGAHKERFDLETGKGKGIEGREYVMDEKAAAGYVSGYKGKDTYDQKK 169          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. TrEMBL
Match: A0A4S2LGH0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009070 PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 2.248e-57
Identity = 105/170 (61.76%), Postives = 123/170 (72.35%), Query Frame = 3
Query:  300 IKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKS-CKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQKK 806
            ++ +FLAFCDA KKGS T TDKT+KKICTD ++Y K   AN VDI FRK +GNQK ++DF  F  F+      AYAKS    +E AV E IK+KI+   PK+HGATK S D AT RLTDVKGYTGA KE FD ETGKGKG EGREYV+D  AA GYV GYKG ++YDQ +
Sbjct:    1 MEEIFLAFCDAAKKGSKTCTDKTLKKICTDCQIYNKNLNANSVDIAFRKHVGNQKLDVDFNSFVRFIEGTLAEAYAKSKSISQEQAVAE-IKEKILHGNPKAHGATKVSSDAATARLTDVKGYTGAHKERFDLETGKGKGIEGREYVMDENAAAGYVSGYKGKDTYDQNQ 169          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. TrEMBL
Match: H2KRM5 (Tubulin polymerization-promoting protein family member 2 OS=Clonorchis sinensis OX=79923 GN=CLF_106688 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 3.212e-57
Identity = 108/170 (63.53%), Postives = 123/170 (72.35%), Query Frame = 3
Query:  300 IKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCK-KEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQKK 806
            ++ +FLAFCDA KKGS T TDKT+KKICTD ++Y K   AN VDI FRK +GNQK ++DF  F  F+      AYAKS     E AV E IK+KI    PK+HGATK S D AT RLTDVKGYTGA KE FD ETGKGKG EGREYV+D KAA GYV GYKG ++YDQKK
Sbjct:    1 MEEIFLAFCDAAKKGSKTCTDKTLKKICTDCQIYNKNLNANSVDIAFRKHVGNQKLDVDFGSFIRFVEGALGEAYAKSKNISLEQAVAE-IKEKITQGNPKAHGATKVSSDAATARLTDVKGYTGAHKERFDLETGKGKGIEGREYVMDEKAAAGYVSGYKGKDTYDQKK 169          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. TrEMBL
Match: A0A183NZT7 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS7623 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.293e-56
Identity = 105/171 (61.40%), Postives = 125/171 (73.10%), Query Frame = 3
Query:  291 MSDIKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIIS-NGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQ 800
            M D++ +F  FCD+ KKGS TATDKTIKKICTD  +YTK+F AN VDI F K + + KK++DF+ F  F+       YAK      +    +IK KIIS +GPKSHGAT+ASKD AT RLTDVKGYTG+ KE FD ETGKGKG EGREYV+D KAA GYVGGYKG N+YD+
Sbjct:    1 MGDLEKIFYDFCDSVKKGSRTATDKTIKKICTDCNIYTKSFNANAVDIAFCKHLKSAKKDVDFSDFVRFIEGAMAEEYAKQKNISTTDASNEIKNKIISTSGPKSHGATQASKDSATSRLTDVKGYTGSHKERFDTETGKGKGIEGREYVMDEKAASGYVGGYKGQNTYDK 171          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. TrEMBL
Match: A0A094ZQP0 (Tubulin polymerization-promoting protein family member 2 OS=Schistosoma haematobium OX=6185 GN=MS3_03581 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 6.063e-56
Identity = 105/171 (61.40%), Postives = 125/171 (73.10%), Query Frame = 3
Query:  291 MSDIKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIIS-NGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQ 800
            M D++ +F  FCD+ KKGS TATDKTIKKICTD  +YTK+F AN VDI F K + + KK++DF+ F  F+       YAK      +    +IK KIIS +GPKSHGAT+ASKD AT RLTDVKGYTG+ KE FD ETGKGKG EGREYV+D KAA GYVGGYKG N+YD+
Sbjct:    1 MGDLEKIFYDFCDSVKKGSRTATDKTIKKICTDCNIYTKSFNANAVDIAFCKHLKSAKKDVDFSDFVRFVEGAMAEEYAKQKNISTTDASNEIKNKIISTSGPKSHGATQASKDSATSRLTDVKGYTGSHKERFDTETGKGKGIEGREYVMDEKAASGYVGGYKGKNTYDK 171          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Cavefish
Match: tppp2 (tubulin polymerization promoting protein family member 3 [Source:NCBI gene;Acc:103026174])

HSP 1 Score: 61.6178 bits (148), Expect = 5.165e-11
Identity = 57/148 (38.51%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  363 KTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            K   K+C D K+   K  T+ DVDI F K      + I F  F   + +     +    K +E A+ + +   I    P + G TK +K  A +RLTD   YTG+ KE FD E+GKGKGK GRE + D+    GYV  YKG  SY+ K
Sbjct:   29 KNFVKLCKDCKVIDGKNITSTDVDIVFSKVKVKSARVITFEQFIQAMTELATKRF--KGKGQEEAL-QLLYGLIAGKEPSNVGVTKVAKAAAVDRLTDSSKYTGSHKERFD-ESGKGKGKVGREDIPDT---SGYVSAYKGQGSYEDK 169          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Cavefish
Match: tppp2 (tubulin polymerization promoting protein family member 3 [Source:NCBI gene;Acc:103026174])

HSP 1 Score: 61.6178 bits (148), Expect = 6.081e-11
Identity = 57/148 (38.51%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  363 KTIKKICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            K   K+C D K+   K  T+ DVDI F K      + I F  F   + +     +    K +E A+ + +   I    P + G TK +K  A +RLTD   YTG+ KE FD E+GKGKGK GRE + D+    GYV  YKG  SY+ K
Sbjct:   36 KNFVKLCKDCKVIDGKNITSTDVDIVFSKVKVKSARVITFEQFIQAMTELATKRF--KGKGQEEAL-QLLYGLIAGKEPSNVGVTKVAKAAAVDRLTDSSKYTGSHKERFD-ESGKGKGKVGREDIPDT---SGYVSAYKGQGSYEDK 176          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Cavefish
Match: TPPP (tubulin polymerization promoting protein [Source:NCBI gene;Acc:103029217])

HSP 1 Score: 59.3066 bits (142), Expect = 6.391e-10
Identity = 59/160 (36.88%), Postives = 81/160 (50.62%), Query Frame = 3
Query:  342 GSTTATDKTIK-----KICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            G T AT K +      K+C D  +   K+ T  DVDI F K      + I ++ F   L++     + K    EE+A  E++ + I    P   G T+A       RLTD   +TG+ KE FD ETG+GKGK GR  +VD+    GYV GYK   SY++K
Sbjct:   67 GDTRATGKEMHGKNWSKLCKDCGVIDGKSITLTDVDIVFSKVKNKSGRTITYSQFREALSELARKRF-KDKSGEEAA--EEVFKMIEGKSPVIAGVTRAVASPTVSRLTDTSKFTGSHKERFD-ETGRGKGKAGRVDMVDT---SGYVSGYKHAGSYEKK 219          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Sea Lamprey
Match: TPPP (tubulin polymerization promoting protein [Source:HGNC Symbol;Acc:HGNC:24164])

HSP 1 Score: 71.2478 bits (173), Expect = 4.455e-15
Identity = 69/179 (38.55%), Postives = 87/179 (48.60%), Query Frame = 3
Query:  297 DIKSVFLAFCDATKKGSTTATDKTIK-----KICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCK----KEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            DI S+  +F      G T AT K +      K+C D K+   K  T+ DVDI F K      + I F  F+  L +        SCK    K+E    E+  + I    P  HG TKA+  G   RLTD   YTG  K  FD ETGKGKGK GRE + D++   GYV  Y+   +YDQK
Sbjct:   14 DIASLEDSFKKFAVLGDTKATGKELNGKNFAKLCKDCKVIDGKAITSTDVDIAFSKVKQKAARVITFEEFKEALQQL-------SCKRFKDKDEQEALEETYKLIAGKSPIIHGVTKATNKGGVGRLTDPSKYTGTHKMRFD-ETGKGKGKAGREDIPDTR---GYVHSYRDAGTYDQK 181          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Nematostella
Match: EDO36688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU5])

HSP 1 Score: 77.7962 bits (190), Expect = 3.165e-17
Identity = 74/177 (41.81%), Postives = 98/177 (55.37%), Query Frame = 3
Query:  291 MSD--IKSVFLAFC--DATKKGSTTATDKT-IKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKE--IDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQ 800
            MSD  +++ F +FC   A  KG+    D     K+  D  LY + FT+ D DI F +     K E  I+F  F+  L    + A  K   K++  VG+  ++     GP + GATKA K G  ERLTD K YTG+ KE FD ++GKGKG EGR    D KAA+GYVG YKG  +YD+
Sbjct:    1 MSDDQLQAKFESFCAFGAGAKGAQPLMDNAKFGKMFRDLHLYDQKFTSTDTDIIFSRTEVKPKTERKINFNQFKVALG---LCAEKKFGSKDQ--VGKLTEKICKGKGPATSGATKAVKVGGVERLTDTKCYTGSHKERFD-KSGKGKGIEGR-VDRDDKAAQGYVGNYKGEGTYDK 170          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Nematostella
Match: EDO48995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHK7])

HSP 1 Score: 71.633 bits (174), Expect = 4.962e-15
Identity = 64/172 (37.21%), Postives = 89/172 (51.74%), Query Frame = 3
Query:  291 MSDIKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKE--IDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQ 800
            + +I   F AF    K       +    K+  D K+Y K FT  D DI F +     K E  ++F+ F+  L+   + A  K  K+E+  V + + +     GP +   TK  K GA +RLTD + YTG+ KE FD ETGKG+G EGR    D  A  GYVG Y+G ++YDQ
Sbjct:    6 LHEIFKSFCAFGAGCKDAQPLMDNAKFAKLFRDLKIYDKKFTQIDSDIIFNRPEVKSKSERKVNFSQFKAALS---LCAEKKYGKRED--VIKLVDKICEGKGPVASKTTKVVKAGAVDRLTDTRKYTGSHKERFD-ETGKGRGIEGR-VDRDPHAEAGYVGNYRGRDTYDQ 170          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Medaka
Match: tppp3 (tubulin polymerization-promoting protein family member 3 [Source:NCBI gene;Acc:101170163])

HSP 1 Score: 72.4034 bits (176), Expect = 9.721e-15
Identity = 63/172 (36.63%), Postives = 91/172 (52.91%), Query Frame = 3
Query:  309 VFLAFCDATKKGSTTATDKTIK-----KICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQKK 806
            +  AF      G T A+ K +      K+C D K+   K  T  DVDI F K      + I +  F+  L +  +  + K   +EE+   + I + +   GP + G TKA+K  A +RLTD   YTG+ KE FD E+G+GKG+EGRE +V++    GYVG YK   ++D KK
Sbjct:   10 LLTAFQKFAVHGDTKASGKELNGKNWAKLCKDCKIIDGKHVTGTDVDIIFTKVKQKTARVITYEEFQRALQELALKRF-KGQSQEEAL--QSICKLVEGQGPANVGVTKAAKIAAVDRLTDPSRYTGSHKERFD-ESGRGKGREGREELVENT---GYVGAYKNAGTFDIKK 174          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Medaka
Match: tppp2 (tubulin polymerization-promoting protein family member 3 [Source:NCBI gene;Acc:101167683])

HSP 1 Score: 66.6254 bits (161), Expect = 9.143e-13
Identity = 66/179 (36.87%), Postives = 84/179 (46.93%), Query Frame = 3
Query:  285 DIMSDIKSVFLAFCDATKKGSTTATDKTIK-----KICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            D M  +  V  AF      G T AT K +      KIC D  +   K  T  DVDI F K      + I F  F   L +   P   K   K+E+   + +   +    P + G TK +K  A +RLTD   YTG+ KE FD E+GKGKGK GR  + D+    GYV  YKG  +YD K
Sbjct:    3 DGMVTLAEVETAFQKFAVHGDTKATGKEMHGKNFAKICKDCHITDGKNVTTTDVDIVFSKVKAKSARVITFEQFNQALTEL-APKRFKGKSKDEAL--QQLYGLLAGKEPANVGVTKVAKAAAVDRLTDTTKYTGSHKERFD-ESGKGKGKAGRADIPDT---SGYVAAYKGTGTYDDK 174          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Medaka
Match: TPPP (tubulin polymerization promoting protein [Source:NCBI gene;Acc:101162550])

HSP 1 Score: 52.7582 bits (125), Expect = 6.424e-8
Identity = 56/160 (35.00%), Postives = 76/160 (47.50%), Query Frame = 3
Query:  342 GSTTATDKTIK-----KICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            G T AT K +      K+C D  +   K  T  DVDI F K      + I +  F+  L +     Y     +E  A   ++ + I    P   G T+A       RLTD   +TG+ KE FD ETG+GKGK GR  +VD+    GYV GYK   +Y++K
Sbjct:   18 GDTRATGKDMHGKNWSKLCKDCGVIDGKNITLTDVDIVFSKVKKKTCRTITYDEFKVALGELARKKYKDKTGEEAEA---EVFKLIEGKAPVIAGVTRAVASPTVSRLTDPTKFTGSHKERFD-ETGRGKGKAGRVDIVDT---SGYVSGYKHRGTYEKK 170          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Medaka
Match: TPPP (tubulin polymerization promoting protein [Source:NCBI gene;Acc:101162550])

HSP 1 Score: 52.373 bits (124), Expect = 1.477e-7
Identity = 56/160 (35.00%), Postives = 76/160 (47.50%), Query Frame = 3
Query:  342 GSTTATDKTIK-----KICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            G T AT K +      K+C D  +   K  T  DVDI F K      + I +  F+  L +     Y     +E  A   ++ + I    P   G T+A       RLTD   +TG+ KE FD ETG+GKGK GR  +VD+    GYV GYK   +Y++K
Sbjct:   75 GDTRATGKDMHGKNWSKLCKDCGVIDGKNITLTDVDIVFSKVKKKTCRTITYDEFKVALGELARKKYKDKTGEEAEA---EVFKLIEGKAPVIAGVTRAVASPTVSRLTDPTKFTGSHKERFD-ETGRGKGKAGRVDIVDT---SGYVSGYKHRGTYEKK 227          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Medaka
Match: TPPP (tubulin polymerization promoting protein [Source:NCBI gene;Acc:101162550])

HSP 1 Score: 52.373 bits (124), Expect = 1.477e-7
Identity = 56/160 (35.00%), Postives = 76/160 (47.50%), Query Frame = 3
Query:  342 GSTTATDKTIK-----KICTDAKLYT-KTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            G T AT K +      K+C D  +   K  T  DVDI F K      + I +  F+  L +     Y     +E  A   ++ + I    P   G T+A       RLTD   +TG+ KE FD ETG+GKGK GR  +VD+    GYV GYK   +Y++K
Sbjct:   75 GDTRATGKDMHGKNWSKLCKDCGVIDGKNITLTDVDIVFSKVKKKTCRTITYDEFKVALGELARKKYKDKTGEEAEA---EVFKLIEGKAPVIAGVTRAVASPTVSRLTDPTKFTGSHKERFD-ETGRGKGKAGRVDIVDT---SGYVSGYKHRGTYEKK 227          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Planmine SMEST
Match: SMESG000002261.1 (SMESG000002261.1)

HSP 1 Score: 330.102 bits (845), Expect = 1.483e-114
Identity = 172/172 (100.00%), Postives = 172/172 (100.00%), Query Frame = 3
Query:  291 MSDIKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQKK 806
            MSDIKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETGKGKGKEGREYVVDSKAAEGYVGGYKGMNSYDQKK
Sbjct:    1 MSDIKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETGKGKGKEGREYVVDSKAAEGYVGGYKGMNSYDQKK 172          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Planmine SMEST
Match: SMESG000023000.1 (SMESG000023000.1)

HSP 1 Score: 184.111 bits (466), Expect = 2.967e-57
Identity = 102/174 (58.62%), Postives = 128/174 (73.56%), Query Frame = 3
Query:  291 MSD--IKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKII-SNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            MSD  +K++FL FCDA KKGSTTATDKTI +IC D K++ K F +N  DIEFR  IGN K++++F  F+ F+   F  AYA + K +++   + IK KI+ S GP  HG TK S D AT+RLTDVK YTGA KE FD ++GKGKGK+GREY+VDSKA EGYV GYK MN+YD+K
Sbjct:    1 MSDTELKTIFLRFCDAVKKGSTTATDKTITRICKDCKIFNKNFDSNRCDIEFRGFIGNAKRDVEFVKFKEFIETRFSKAYATAMKIDQNKAVDLIKDKIVLSGGPVGHGTTKLSTDSATQRLTDVKSYTGAHKERFDLDSGKGKGKDGREYLVDSKAQEGYVSGYKEMNTYDKK 174          
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Planmine SMEST
Match: SMESG000026839.1 (SMESG000026839.1)

HSP 1 Score: 172.17 bits (435), Expect = 1.144e-52
Identity = 95/173 (54.91%), Postives = 116/173 (67.05%), Query Frame = 3
Query:  291 MSDIKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAY--AKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETXXXXXXEGREYVVDSKAAEGYVGGYKGMNSYDQK 803
            M D+K+ F +FCD  KKGSTT TDKT+KKICTD K+Y K F  N  DI+FRK IGN +K+IDF  F  F+      AY  A++   E++   +++K K+    P  HG T  S D AT RLTDVKGYTGA KE FD ETG+GKG +GREY+    A EGYVGGYKG N+YD K
Sbjct:    1 MDDLKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAV--KELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNK 171          
The following BLAST results are available for this feature:
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPPP33.910e-1339.19tubulin polymerization promoting protein family me... [more]
TPPP33.910e-1339.19tubulin polymerization promoting protein family me... [more]
TPPP33.910e-1339.19tubulin polymerization promoting protein family me... [more]
TPPP33.910e-1339.19tubulin polymerization promoting protein family me... [more]
TPPP25.035e-1238.79tubulin polymerization promoting protein family me... [more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tppp-12.468e-636.21Tubulin polymerization-promoting protein homolog ... [more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ringer5.573e-936.63gene:FBgn0266417 transcript:FBtr0344399[more]
ringer5.573e-936.63gene:FBgn0266417 transcript:FBtr0344401[more]
ringer5.573e-936.63gene:FBgn0266417 transcript:FBtr0344398[more]
ringer5.573e-936.63gene:FBgn0266417 transcript:FBtr0344400[more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tppp36.017e-1538.64tubulin polymerization-promoting protein family me... [more]
tppp36.017e-1538.64tubulin polymerization-promoting protein family me... [more]
tppp23.399e-1338.01tubulin polymerization-promoting protein family me... [more]
tppp24.645e-1338.01tubulin polymerization-promoting protein family me... [more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rabep13.030e-1237.08rabaptin, RAB GTPase binding effector protein 1 [S... [more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tppp21.296e-1337.33tubulin polymerization-promoting protein family me... [more]
Tppp21.296e-1337.33tubulin polymerization-promoting protein family me... [more]
Tppp31.664e-1239.19tubulin polymerization-promoting protein family me... [more]
Tppp31.664e-1239.19tubulin polymerization-promoting protein family me... [more]
Tppp31.664e-1239.19tubulin polymerization-promoting protein family me... [more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3T077|TPPP2_BOVIN3.849e-1437.58Tubulin polymerization-promoting protein family me... [more]
sp|Q2VPM9|TPPP3_XENLA5.798e-1339.55Tubulin polymerization-promoting protein family me... [more]
sp|Q0P5Y3|TPPP2_MOUSE9.066e-1337.33Tubulin polymerization-promoting protein family me... [more]
sp|Q3ZCC8|TPPP3_BOVIN1.606e-1239.86Tubulin polymerization-promoting protein family me... [more]
sp|Q9BW30|TPPP3_HUMAN1.878e-1239.19Tubulin polymerization-promoting protein family me... [more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419QFE11.066e-5763.53Tubulin polymerization-promoting protein family me... [more]
A0A4S2LGH02.248e-5761.76Uncharacterized protein OS=Opisthorchis felineus O... [more]
H2KRM53.212e-5763.53Tubulin polymerization-promoting protein family me... [more]
A0A183NZT72.293e-5661.40Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A094ZQP06.063e-5661.40Tubulin polymerization-promoting protein family me... [more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tppp25.165e-1138.51tubulin polymerization promoting protein family me... [more]
tppp26.081e-1138.51tubulin polymerization promoting protein family me... [more]
TPPP6.391e-1036.88tubulin polymerization promoting protein [Source:N... [more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TPPP4.455e-1538.55tubulin polymerization promoting protein [Source:H... [more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO366883.165e-1741.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489954.962e-1537.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tppp39.721e-1536.63tubulin polymerization-promoting protein family me... [more]
tppp29.143e-1336.87tubulin polymerization-promoting protein family me... [more]
TPPP6.424e-835.00tubulin polymerization promoting protein [Source:N... [more]
TPPP1.477e-735.00tubulin polymerization promoting protein [Source:N... [more]
TPPP1.477e-735.00tubulin polymerization promoting protein [Source:N... [more]
back to top
BLAST of Tubulin polymerization-promoting protein family member 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000002261.11.483e-114100.00SMESG000002261.1[more]
SMESG000023000.12.967e-5758.62SMESG000023000.1[more]
SMESG000026839.11.144e-5254.91SMESG000026839.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001237 ID=SMED30001237|Name=Tubulin polymerization-promoting protein family member 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1057bp
TTCGAAATCACTTAGTGTAGTGAGAGGAATGATAAATCGATTGATTGCAT
GCAAGCACAATTTCTGTTACAGATATTTGAAGAGATTTTTTTGATAATCA
TACAAAAATACACATGCATTCTGTGTTTGTTTGTAAACAATCAATACTCA
AGTTAATAGAATTTCAAATCAAAAATTTCAACAGTTATAAAAACTCATAC
TATATTTTATACCAAGATTCTCGGTGATATTTAAAGAACCATTGTCAGAG
TATAATTTATAAAAGTTTATTAAAACAACAAAACGACATCATGTCTGATA
TAAAATCTGTTTTTCTGGCGTTTTGCGACGCAACGAAAAAAGGATCTACA
ACGGCCACTGATAAAACAATCAAAAAGATATGCACTGACGCAAAATTATA
CACGAAAACATTTACGGCCAATGATGTTGATATCGAGTTCAGAAAATGTA
TCGGGAATCAGAAAAAAGAAATTGACTTTGCCGGATTTGAAAATTTTTTG
AATAAGTTTTTCATTCCCGCATACGCTAAATCGTGTAAAAAAGAAGAATC
GGCTGTTGGAGAAGATATTAAACAAAAAATTATTAGTAATGGCCCGAAAT
CTCATGGTGCAACTAAAGCCAGTAAAGATGGAGCGACTGAACGACTAACT
GATGTCAAAGGATATACCGGAGCCCGAAAAGAAGCTTTTGATGCAGAAAC
TGGCAAAGGGAAAGGTAAAGAAGGTCGAGAATATGTAGTCGATTCAAAGG
CAGCAGAAGGATATGTAGGAGGTTATAAAGGAATGAATTCATATGACCAA
AAGAAATAAGCATAAACACAATAAAACAAATTTAATCAGTTTCTATGTTT
TATTTAGAAATTTTGATTGAAATTTATATCAACATTGTAATGTATTTTGA
CATTTCATTCTTAACATTTGTTTTTAGTCTTTTATTGGATAAATAATATA
GCCTTATTTCAATCGATATCTGACAAAATTTGTTTGTTGAATGCTAGTCA
ATAAGGGAATAATAGCAGCATGTATCACGCGTAACACTCCTATTCAAAAA
TTATTTT
back to top

protein sequence of SMED30001237-orf-1

>SMED30001237-orf-1 ID=SMED30001237-orf-1|Name=SMED30001237-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=173bp
MSDIKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEF
RKCIGNQKKEIDFAGFENFLNKFFIPAYAKSCKKEESAVGEDIKQKIISN
GPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETGKGKGKEGREYVV
DSKAAEGYVGGYKGMNSYDQKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR008907P25-alpha
IPR011992EF-hand-dom_pair
Vocabulary: biological process
TermDefinition
GO:0001578microtubule bundle formation
GO:0046785microtubule polymerization
Vocabulary: molecular function
TermDefinition
GO:0015631tubulin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 1..102
e-value: 1.9E-10
score: 42.9
IPR008907P25-alphaPFAMPF05517p25-alphacoord: 6..164
e-value: 2.6E-42
score: 144.6
IPR008907P25-alphaPANTHERPTHR12932P25 ALPHA-RELATEDcoord: 2..170
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 2..131